Product Datasheet. ATF3 Antibody NBP Unit Size: 0.1 ml. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
|
- Edmund Parrish
- 5 years ago
- Views:
Transcription
1 Product Datasheet ATF3 Antibody NBP Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Reviews: 2 Publications: 5 Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 10/30/2018 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at
2 NBP ATF3 Antibody Product Information Unit Size Concentration Storage Clonality Preservative Isotype Purity Buffer 0.1 ml Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Polyclonal 0.02% Sodium Azide IgG Immunogen affinity purified PBS (ph 7.2) and 40% Glycerol Page 1 of 6 v.20.1 Updated 10/30/2018 Product Description Host Rabbit Gene ID 467 Gene Symbol Species ATF3 Human, Feline Reactivity Notes Reactivity reported in scientific literature (PMID: ) Specificity/Sensitivity Immunogen Product Application Details Applications Specificity of human ATF3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. This antibody was developed against Recombinant Protein corresponding to amino acids: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHL CHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKK KEKTEC Western Blot, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Frozen, Immunohistochemistry- Paraffin, Knockout Validated Recommended Dilutions Western Blot 0.4 ug/ml, Immunohistochemistry 1:200-1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry- Paraffin 1:200-1:500, Immunohistochemistry-Frozen, Knockout Validated Application Notes For IHC-Paraffin, HIER ph 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. WB reactivity reported in (PMID: ).
3 Images Knockout Validated: ATF3 Antibody [NBP ] - HeLa human cervical epithelial carcinoma parental cell line lysate and ATF3 knockout (KO) HeLa cell line. PVDF membrane was probed with 0.1 ug/ml of Rabbit Anti-Human ATF3 Polyclonal Antibody (Catalog # NBP ) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for ATF3 at approximately 22 kda (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions. Page 2 of 6 v.20.1 Updated 10/30/2018 Western Blot: ATF3 Antibody [NBP ] - HDLM-2 and Daudi cell lysates. PVDF membrane was probed with 0.1 ug/ml of Rabbit Anti- Human ATF3 Polyclonal Antibody (Catalog # NBP ) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for ATF3 at approximately 22 kda (as indicated) in the HDLM-2 cell line, but is not detectable in the Daudi cell line. This experiment was conducted under reducing conditions. Immunocytochemistry/Immunofluorescence: ATF3 Antibody [NBP ] - Staining of human cell line A-431 shows localization to nucleus and nucleoli. Antibody staining is shown in green. Immunohistochemistry-Frozen: ATF3 Antibody [NBP ] - Image was captured under an epi-fluorescent microscope. Alexa 488 conjugated rabbit antibody was used for the secondary antibody. Immunofluorescent signal was localized in the nucleus. Image from verified customer review.
4 Immunohistochemistry-Paraffin: ATF3 Antibody [NBP ] - Staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells. Page 3 of 6 v.20.1 Updated 10/30/2018 Immunohistochemistry-Paraffin: ATF3 Antibody [NBP ] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells. Immunohistochemistry-Paraffin: ATF3 Antibody [NBP ] - Staining of human skeletal muscle shows no nuclear positivity in myelopoietic cells as expected. Immunohistochemistry-Paraffin: ATF3 Antibody [NBP ] - Staining of human urinary bladder shows moderate to strong nuclear positivity in epithelial cells.
5 Publications Page 4 of 6 v.20.1 Updated 10/30/2018 Mousseau M, Burma NE, Lee KY et al. Microglial pannexin-1 channel activation is a spinal determinant of joint pain Sci Adv Aug :00AM [PMID: ] (IHC-P, Rat) Edagawa M, Kawauchi J, Hirata M et al. Role of Activating Transcription Factor 3 (ATF3) in Endoplasmic Reticulum (ER) Stress-induced Sensitization of p53-deficient Human Colon Cancer Cells to Tumor Necrosis Factor (TNF)- related Apoptosis-inducing Ligand (TRAIL)-mediated Apoptosis through Up-regulation of Death Receptor 5 (DR5) by Zerumbone and Celecoxib. J Biol Chem 2014 Aug 1 [PMID: ] (WB, Human) Wei S, Wang H, Lu C et al. The Activating Transcription Factor 3 Protein Suppresses the Oncogenic Function of Mutant p53 Proteins. J Biol Chem 2014 Mar 28 [PMID: ] (IHC, Human) Hai T, Jalgaonkar S, Wolford CC, Yin X. Immunohistochemical Detection of Activating Transcription Factor 3, a Hub of the Cellular Adaptive-Response Network. Methods Enzymol 2011 [PMID: ] Wu X, Nguyen BC, Dziunycz P et al. Opposing roles for calcineurin and ATF3 in squamous skin cancer. Nature 2010 May [PMID: ]
6 Novus Biologicals USA E. Briarwood Avenue Centennial, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Products Related to NBP NBP NBP PEP HAF008 NB7156 NBP ATF3 Knockout HeLa Cell Lysate ATF3 Recombinant Protein Antigen Goat anti-rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Goat anti-rabbit IgG (H+L) Secondary Antibody Rabbit IgG Isotype Control Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product:
7