Product Datasheet. OVOL2 Antibody NBP Unit Size: 0.1 ml

Transcription

1 Product Datasheet OVOL2 Antibody NBP Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Publications: 5 Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 10/22/2018 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at

2 NBP OVOL2 Antibody Product Information Unit Size Concentration Storage Clonality Preservative Isotype Purity Buffer 0.1 ml Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Polyclonal 0.02% Sodium Azide IgG Immunogen affinity purified PBS (ph 7.2) and 40% Glycerol Page 1 of 4 v.20.1 Updated 10/22/2018 Product Description Host Rabbit Gene ID Gene Symbol Species OVOL2 Human, Mouse, Rat Reactivity Notes Mouse and rat reactivity reported in scientific literature (PMID: ). Reactivity reported in scientific literature (PMID: ) Specificity/Sensitivity Immunogen Product Application Details Applications Specificity of human, mouse, rat OVOL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. This antibody was developed against Recombinant Protein corresponding to amino acids: QYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKKLAALLQ GKLTSAHQENTSLSEEEERK Western Blot, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin Recommended Dilutions Western Blot 0.4 ug/ml, Immunohistochemistry 1:500-1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry- Paraffin 1:500-1:1000 Application Notes For IHC-Paraffin, HIER ph 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

3 Images Western Blot: OVOL2 Antibody [NBP ] - Analysis in human cell lines A-431 and A-549 using anti-ovol2 antibody. Corresponding OVOL2 RNA-seq data are presented for the same cell lines. Loading control: anti-ppib. Page 2 of 4 v.20.1 Updated 10/22/2018 Immunocytochemistry/Immunofluorescence: OVOL2 Antibody [NBP ] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green. Staining of human testis shows nuclear positivity in cells in seminiferous ducts. Staining of human cerebellum shows nuclear positivity in neurons and in Purkinje cells.

4 Staining of human endometrium shows nuclear positivity in glandular cells. Page 3 of 4 v.20.1 Updated 10/22/2018 Staining of human liver shows no nuclear positivity in hepatocytes as expected. Publications Renaud S, Chakraborty D, Mason C et al. OVO-like 1 regulates progenitor cell fate in human trophoblast development. Proc Natl Acad Sci U S A Nov 10 [PMID: ] (WB, Mouse, Rat) Ito T, Tsuji G, Ohno F et al. Potential role of the OVOL1-OVOL2 axis and c-myc in the progression of cutaneous squamous cell carcinoma. Mod. Pathol. Mar :00AM [PMID: ] (WB, Human) Fu H, Qi L, Chen L et al. Expression of Ovol2 is related to epithelial characteristics and shows a favorable clinical outcome in hepatocellular carcinoma. Onco Targets Ther. Oct :00AM [PMID: ] (Human) Ito T, Tsuji G, Ohno F et al. Activation of the OVOL1-OVOL2 Axis in the Hair Bulb and in Pilomatricoma. Am. J. Pathol Feb 09 [PMID: ] (IHC-P, Human) Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013 Apr [PMID: ]

5 Novus Biologicals USA E. Briarwood Avenue Centennial, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product: