Product Datasheet. MUC5B Antibody NBP Unit Size: 0.1 ml
|
|
- Joella Stevens
- 5 years ago
- Views:
Transcription
1 Product Datasheet MUC5B Antibody NBP Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Publications: 2 Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 12/2/2018 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at
2 NBP MUC5B Antibody Product Information Unit Size Concentration Storage Clonality Preservative Isotype Purity Buffer 0.1 ml Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Polyclonal 0.02% Sodium Azide IgG Immunogen affinity purified PBS (ph 7.2) and 40% Glycerol Page 1 of 4 v.20.1 Updated 12/2/2018 Product Description Host Rabbit Gene ID Gene Symbol Species Specificity/Sensitivity Immunogen Product Application Details Applications MUC5B Human Specificity of human Mucin 5B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. This antibody was developed against Recombinant Protein corresponding to amino acids: CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFT TAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLR QRGYQVCPVLA Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin Recommended Dilutions Immunohistochemistry 1:500-1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry- Paraffin 1:500-1:1000 Application Notes For IHC-Paraffin, HIER ph 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
3 Images Immunocytochemistry/Immunofluorescence: MUC5B Antibody [NBP ] - Staining of human cell line A549 shows localization to vesicles. Antibody staining is shown in green. Page 2 of 4 v.20.1 Updated 12/2/2018 Immunohistochemistry-Paraffin: MUC5B Antibody [NBP ] - Mucin 5B Antibody [NBP ] - Staining in human colon and skeletal muscle tissues. Corresponding MUC5B RNA-seq data are presented for the same tissues. Immunohistochemistry-Paraffin: MUC5B Antibody [NBP ] - Staining of human colon shows strong cytoplasmic positivity in glandular cells. Immunohistochemistry-Paraffin: MUC5B Antibody [NBP ] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
4 Publications Page 3 of 4 v.20.1 Updated 12/2/2018 Gry M, Oksvold P, Ponten F et al. Tissue specific protein expression in human cells, tissues and organs. J Proteomics Bioinform 2010 Meyerholz DK, Stoltz DA, Namati E et al. Loss of cystic fibrosis transmembrane conductance regulator function produces abnormalities in tracheal development in neonatal pigs and young children. Am J Respir Crit Care Med 2010 Nov [PMID: ]
5 Novus Biologicals USA E. Briarwood Avenue Centennial, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Products Related to NBP NBP PEP HAF008 NB7156 NBP MUC5B Recombinant Protein Antigen Goat anti-rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Goat anti-rabbit IgG (H+L) Secondary Antibody Rabbit IgG Isotype Control Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product: