Product Datasheet. p62/sqstm1 Antibody (2C11) H M01. Unit Size: 0.1 mg. Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Transcription

1 Product Datasheet p62/sqstm1 Antibody (2C11) H M01 Unit Size: 0.1 mg Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. Reviews: 7 Publications: 175 Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 9/16/2018 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at

2 H M01 p62/sqstm1 Antibody (2C11) Product Information Unit Size Concentration Storage Clonality Clone Preservative Isotype Purity 0.1 mg Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. Monoclonal 2C11 No Preservative IgG2a Kappa IgG purified Buffer PBS (ph 7.4) Product Description Host Mouse Gene ID 8878 Gene Symbol Species Reactivity Notes SQSTM1 Human, Mouse, Rat, Rabbit Specificity/Sensitivity SQSTM1 - sequestosome 1 Immunogen Notes Page 1 of 4 v.20.1 Updated 9/16/2018 Rat reactivity reported in scientific literature (PMID: ). Human reactivity reported in scientific literature (PMID: ). Rabbit reactivity reported in scientific literature (PMID: ). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions. SQSTM1 (AAH , 1 a.a a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAAL FPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRD HRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGL HRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPR PPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHG GKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKI ALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPS SLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQ TKNYDIGAALDTIQYSKHPPPL Quality control test: Antibody Reactive Against Recombinant Protein. This product is produced by and distributed for Abnova, a company based in Taiwan. Product Application Details Applications Recommended Dilutions Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Frozen, Immunoprecipitation Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Frozen

3 Images Western Blot: p62/sqstm1 Antibody (2C11) [H M01] - WB analysis of recombinant p62 protein (immunogen, KDa) using SQSTM1/p62 antibody (clone 2C11). Page 2 of 4 v.20.1 Updated 9/16/2018 Western Blot: p62/sqstm1 Antibody (2C11) [H M01] - WB analysis of p62 in p62 WT and KO mouse hepatocytes and HepG2 cell lysate using anti-p62/sqstm1 antibody clone 2C11. Sample lane1: p62 +/- mouse hepatocytes, lane 2: p62 -/- mouse hepatocytes, lane3: Wt mouse hepatocytes, lane 4: HepG2 cells. This image is from a verified customer product review. Immunocytochemistry/Immunofluorescence: p62/sqstm1 Antibody (2C11) [H M01] - ICC-IF analysis of SQSTM1 protein in HeLa cell using SQSTM1/p62 antibody (clone 2C11) at 10 ug/ml concentration. Immunocytochemistry/Immunofluorescence: p62/sqstm1 Antibody (2C11) [H M01] - Analysis of p62 in SH-SY5Y cells using antip62/sqstm1 antibody. Red - p62 puncta; Blue - nuclear DAPI; Green - Cytoskeleton. Image from verified customer review.

4 ELISA: p62/sqstm1 Antibody (2C11) [H M01] - Detection limit for recombinant GST tagged SQSTM1 is approximately 0.03ng/ml as a capture antibody. Page 3 of 4 v.20.1 Updated 9/16/2018 Publications Feng X, Jia Y, Zhang Y et al. Ubiquitination of UVRAG by SMURF1 promotes autophagosome maturation and inhibits hepatocellular carcinoma growth. Autophagy Jan :00AM [PMID: ] (WB) Henderson MX, Peng C, Trojanowski JQ, Lee VMY. LRRK2 activity does not dramatically alter alpha-synuclein pathology in primary neurons. Acta Neuropathol Commun 2018 May 31 [PMID: ] (Human) Bresciani A, Spiezia MC, Boggio R et al. Quantifying autophagy using novel LC3B and p62 TR-FRET assays. PLoS One 2018 Mar 19 [PMID: ] Thomas-Jardin SE, Kanchwala MS, Jacob J et al. Identification of an IL-1-induced gene expression pattern in AR(+) PCa cells that mimics the molecular phenotype of AR(-) PCa cells. Prostate 2018 Jun [PMID: ] Zhang Y, Mun SR, Linares JF et al. ZZ-dependent regulation of p62/sqstm1 in autophagy. Nat Commun. Oct :00AM [PMID: ] (WB, Human) Ashraf N, Duarte-Silva S, Shaw E et al. Citalopram Reduces Aggregation of ATXN3 in a YAC Transgenic Mouse Model of Machado-Joseph Disease. Mol. Neurobiol. Sep :00AM [PMID: ] (WB, Mouse) Palomo GM, Granatiero V, Kawamata H et al. Parkin is a disease modifier in the mutant SOD1 mouse model of ALS EMBO Mol Med Aug :00AM [PMID: ] (WB, IHC, Mouse) Orcholski ME, khurshudyan A, Shamskhou EA et al. Reduced carboxylesterase 1 is associated with endothelial injury in methamphetamine-induced pulmonary arterial hypertension. Am. J. Physiol. Lung Cell Mol. Physiol. Aug :00AM [PMID: ] (WB, Human) Schweitzer GG, Collier SL, Chen Z et al. Loss of lipin 1-mediated phosphatidic acid phosphohydrolase activity in muscle leads to skeletal myopathy in mice. FASEB J. Jul :00AM [PMID: ] (IHC-Fr, Mouse) Gstrein T, Edwards A, PristoupilovA A et al. Mutations in Vps15 perturb neuronal migration in mice and are associated with neurodevelopmental disease in humans. Nat. Neurosci. Feb :00AM [PMID: ] (WB, Human) Khan W, Layden BT, Chakrabarti P. Inhibition of mtor complexes protects cancer cells from glutamine starvation induced cell death by restoring Akt stability. Biochim. Biophys. Acta. Mar :00AM [PMID: ] (WB) Ordonez-Gutierrez L, Benito-Cuesta I, Abad JL, Casas J. Dihydroceramide Desaturase 1 Inhibitors Reduce Amyloid-b Levels in Primary Neurons from an Alzheimer's Disease Transgenic Model. Pharm. Res Feb 06 [PMID: ] (Mouse) More publications at

5 Novus Biologicals USA E. Briarwood Avenue Centennial, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Products Related to H M01 NBP HAF007 NB720-B NBP p62/sqstm1 Knockout HeLa Cell Lysate Goat anti-mouse, IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Rabbit anti-mouse IgG (H+L) Secondary Antibody [Biotin] Mouse IgG2a Isotype Control (M2AK) Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product: