Drug Repositioning Platforms to Predict Drug- Disease Signatures
|
|
- Loraine Wright
- 5 years ago
- Views:
Transcription
1 Drug Repositioning Platforms to Predict Drug- Disease Signatures
2 Drug Repositioning Screen Typical Experiment screening (mostly Irrational) Experimental Methods Transcriptome matching, cell based models Phenotypic screening Protein-protein interaction assays Drug annotation technologies Gene activity mapping In-vivo animal models Observational studies Experimental medicine (case based studies)
3 Cons of Experiment Screening o Experimentally testing drugs against all targets is extremely expensive, and technically not achievable o Even after finding a hit the rational mechanism of action must still be revealed and tested o Not every drug is available commercially, If available, is expensive from the branded company o Set up an assay from scratch is a daunting task, even after setup, not guarantee FDA drugs are going to work o The financial cost per assay run, and, maintaining the target immobilization may alter binding site properties o The amount of potential druggable targets is exponentially increasing, creating the vast possible drugtarget interactions space explore with expt. is a challenge.
4 Not Drug Repositioning Screen In-Silico Methods Computer Based screening (Rational) Target based Protein binding site based similarity Protein-Ligand Docking Simulations Chemical centric Physico-chemical properties Chemical similarity Shape similarity Other methods Drug disease relationships, Drug regulated gene expression, Side effect profile, Literature Mining of smallmolecules
5 Drug Repositioning Screen Docking = virtual screening gold standard Structure based fit ligands into the real atomic structure of the protein or use homology model P ><SF > < S6/M2 > KcsA 65 ALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWF VGREQE MthK 364 SLYWTFVTIATVGYGDYSPSTPLGMYFTVTLIVLGIGTFAVAVERLLEFL INREQM KvAP 198 ALWWAVVTATTVGYGDVVPATPIGKVIGIAVMLTGISALTLLIGTVSNMFGKIL----VGEPEP ratkv AFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQA hkv AFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQS hkv AFWWAVVTMTTVGYGDMRPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPA hkv SFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAI Docking, MD simulations
6 Drug Repositioning Screen Virtual Screening Performance (existing computer screening methods) Poor correlation of K i values with docking score (2,335 holo protein structures) Poor correlation of IC 50 values with docking score (2,335 holo protein structures) Naiem T, Oakland P, Byers S, Dakshanamurthy S. Comb. Chem. & High Thro. Scr (Most accessed article))
7 Challenges to Virtual Screening Inadequate treatment of solvent effect: Solvent water and counter ions are needed to treat proper volume, change shape of the binding site, bridging interaction Conformational change and entropy not included Good affinity prediction not necessarily leads to correct biological binding mode Inadequate treatment of protein (and drug) dynamicity i.e. docking treat protein as rigid All these factors contribute to high false positives and false negatives in virtual screening
8 Drug Repositioning Screen Given low hit rate, Need a New Comprehensive Method? o TMFS method using Proteo-chemometric approach combines ligand and protein centric to predict high hit rate. o TMFS method is combined to systems medicine, patient survival data with gene expressions to predict mechanism of action and make drug-disease relationships for new therapeutics (standalone or combination) 1. Sivanesan Dakshanamurthy et al. J. Med. Chem. 2012, 55, (triggered hundreds of press releases) 2. Naiem T, Oakland P, Byers S, Dakshanamurthy S. Comb. Chem. & High Thro. Scr (Most accessed article) 3. Assefnia et al. Cadherin-11 in poor prognosis malignancies and rheumatoid arthritis: common target, common therapies. Oncotarget Mar 30;5(6):
9 TMFS Method Train: Match: Fit: Train the drugs -> Ref. ligands, proteins (topology, properties), expt. data Match their topology, properties Fit the data with expt. Data, and integrate it with systems medicine pipeline Streamline: Streamline the hits using the TMFS score 1. Sivanesan Dakshanamurthy et al. J. Med. Chem. 2012, 55, (triggered hundreds of press releases) 2. Naiem T, Oakland P, Byers S, Dakshanamurthy S. Comb. Chem. & High Thro. Scr (Most accessed article) 3. Assefnia et al. Cadherin-11 in poor prognosis malignancies and rheumatoid arthritis: common target, common therapies. Oncotarget Mar 30;5(6):
10 TMFS Method Algorithm Z score rank ordered viz. top 1 through top 40 target hits for each drug Z Y(, ) k p l 1 i 1 [ f i (, ) p l i 1 f (, )] c l j n 1 X n (, ) CS( OLIC) c l normalized docking score normalized Euclidean distance scores protein pocket, FDA drugs, Ref. native ligands Ligand based descriptor score Ligand shape, physicochemical properties of FDA drugs, Ref. native ligands Ligand topology descriptor score surface properties of FDA drugs, Ref. native ligands Ligand - Protein contact points score CS (OLIC) = S (OLIC-R) - S (OLIC-T) contact point score of FDA drugs contact point score of reference ligands 1. Sivanesan Dakshanamurthy et al. J. Med. Chem. 2012, 55, (triggered hundreds of press releases) 2. Naiem T, Oakland P, Byers S, Dakshanamurthy S. Comb. Chem. & High Thro. Scr (Most accessed article) 3. Assefnia et al. Cadherin-11 in poor prognosis malignancies and rheumatoid arthritis: common target, common therapies. Oncotarget Mar 30;5(6):
11 TMFS Method Algorithm RePurposeVS Method 1. Sivanesan Dakshanamurthy et al. J. Med. Chem. 2012, 55, (triggered hundreds of press releases) 2. Naiem T, Oakland P, Byers S, Dakshanamurthy S. Comb. Chem. & High Thro. Scr (Most accessed article))
12 RePurposeVS Z-rank score Example: Sutent (Sunitinib) -> predicted alternate targets 1. Sivanesan Dakshanamurthy et al. J. Med. Chem. 2012, 55, (triggered hundreds of press releases) 2. Naiem T, Oakland P, Byers S, Dakshanamurthy S. Comb. Chem. & High Thro. Scr (Most accessed article))
13 Performance of the RepurposeVS o 37% increase in enrichment at the top 1% compared to GLIDE (commercial software) o 48% increase in enrichment at the top 5% compared to GLIDE.
14 Application: Drug Repositioning Alternative Targets of FDA Blockbuster Drugs
15 FDA Blockbuster Alternate Targets Sutent (Sunitinib) is predicted to hit the greatest number of protein targets followed by Alimta. Prograf, Valcote, Concerta, Sifrol, Niaspan, Exelon, Evodart, Sevorane, and Klacid have no hits
16 Repurposing Potential New Disease Classes Anti-neoplastic drugs have the greatest repurposing potential Anti-infective drugs have low repurposing potential Anti-psychotic, anti-bacterial drugs have modest repurposing potential
17 Validation of Predictions To calculate the percent correctly predicted (PCP) targets, PCP i 1 ( nb ji na nx ji ji nb ny ji ji ny nz ji ji ne ji ) x100 where i < # drugs, j < #targets o RpurposeVS predicts drug-target associations with greater than 91% accuracy for the majority of drugs
18 NextGenRepurposeVS: Connected to Molecular Mechanistic Pathways and Disease Associations Subset of drug-function-pathway-disease network A. Predicted number of (A) KEGG pathways B. GO molecular functions affected by each drug MAPK network, many drugs target multiple disease classes, central pathway in pathogenesis of many diseases.
19 Experiment Validation I o Mebendazole binds with some kinases at affinity ranging from 5µM to 90nM o Mebendazole as a Therapeutic Option in Drug Resistant Melanoma in-vitro and in-vivo o Mebendazole program are planned for dose escalation clinical trial with new formulations 1. Sivanesan Dakshanamurthy et al. J. Med. Chem. 2012, 55, (triggered hundreds of press releases) 2. Naiem T, Oakland P, Byers S, Dakshanamurthy S. Comb. Chem. & High Thro. Scr (Most accessed article) 3. Assefnia et al. Cadherin-11 in poor prognosis malignancies and rheumatoid arthritis: common target, common therapies. Oncotarget Mar 30;5(6):
20 Experimental Validation I o As predicted by TMFS, Mebendazole inhibits several kinases at an affinity ranging from 15µM to 90nM VEGFR2 KIT PDGFRβ PDGFRα nm nm nm ABL1 DYRK1B JNK3 CDK7 P38α JNK2 1. Sivanesan Dakshanamurthy et al. J. Med. Chem. 2012, 55, (triggered hundreds of press releases) 2. Naiem T, Oakland P, Byers S, Dakshanamurthy S. Comb. Chem. & High Thro. Scr (Most accessed article)
21 Experiment Validation II o Celecoxib (1.42 μm), and Dimethyl Celecoxib (1.56 μm) interacted with CDH11 o Celecoxib and DMC completed early stage preclinical studies in-vivo model 1. Sivanesan Dakshanamurthy et al. J. Med. Chem. 2012, 55, (triggered hundreds of press releases) 2. Assefnia et al. Cadherin-11 in poor prognosis malignancies and rheumatoid arthritis: common target, common therapies. Oncotarget Mar 30;5(6):
22 Celecoxib and DiMethyl Celecoxib binding to CDH11 (G) Gel Analysis: Celecoxib reduces the CDH11 dimer fraction (Native gel comparison of cadherin-11 in the absence (left) and presence (right) of celecoxib) (H) SPR assay: Celecoxib (1.42 μm), and Dimethyl Celecoxib (1.56 μm) interacted with CDH11 CDH11 CDH11 1. Sivanesan Dakshanamurthy et al. J. Med. Chem. 2012, 55, (triggered hundreds of press releases) 2. Assefnia et al. Cadherin-11 in poor prognosis malignancies and rheumatoid arthritis: common target, common therapies. Oncotarget Mar 30;5(6):
23 Summary TMFS method hit rate is greater than 91% accuracy for the majority of drugs. Anti-hookworm medication Mebendazole repurposed to specific kinases for possible drug resistant melanoma. Anti-inflammatory drug Celecoxib and DMC repurposed to CDH11, can be used for rheumatoid arthritis, IBD, and poor prognosis malignancies for which no targeted therapies exist. NextGenRePurposeVS provided new disease connections for many drugs and insight into their mechanism of action. Several drugs has been validated in-vitro and in-vivo, provided the validity of our screening tools; TMFS, RePurposeVS and NextGenRepurpose.
Fig. 1. A schematic illustration of pipeline from gene to drug : integration of virtual and real experiments.
1 Integration of Structure-Based Drug Design and SPR Biosensor Technology in Discovery of New Lead Compounds Alexis S. Ivanov Institute of Biomedical Chemistry RAMS, 10, Pogodinskaya str., Moscow, 119121,
More informationLigand docking. CS/CME/Biophys/BMI 279 Oct. 22 and 27, 2015 Ron Dror
Ligand docking CS/CME/Biophys/BMI 279 Oct. 22 and 27, 2015 Ron Dror 1 Outline Goals of ligand docking Defining binding affinity (strength) Computing binding affinity: Simplifying the problem Ligand docking
More informationPolypharmacology. Giulio Rastelli Molecular Modelling and Drug Design Lab
Polypharmacology Giulio Rastelli Molecular Modelling and Drug Design Lab www.mmddlab.unimore.it Dipartimento di Scienze della Vita Università di Modena e Reggio Emilia giulio.rastelli@unimore.it Magic
More informationApplied Protein Services
Applied Protein Services Applied Protein Services A Window into the Future Development risk and attrition rates remain two of the greatest challenges to a successful biopharmaceutical pipeline. To help
More informationCombining Target-Based and Phenotypic Discovery Assays for Drug Repurposing. Sharlene Velichko, Ph.D. Director of Research Biology November 11, 2017
Combining Target-Based and Phenotypic Discovery Assays for Drug Repurposing Sharlene Velichko, Ph.D. Director of Research Biology November 11, 2017 1 Drug Repurposing Finding new life for old drugs Initial
More informationRecent Progress of Interprotein s Research Activities. Interprotein Corporation
Recent Progress of Interprotein s Research Activities - INTENDD and AI-guided INTENDD - Interprotein Corporation 1 Interprotein Corporation Location: Osaka, Japan Year Established: 2001 CEO & President:
More informationIntroduction to Drug Design and Discovery
Introduction to Drug Design and Discovery Course: Drug Design Course code: 0510412 Dr. Balakumar Chandrasekaran Dr. Bilal Al-Jaidi Assistant Professors, Pharmaceutical Medicinal Chemistry, Faculty of Pharmacy,
More informationRMSD-BASED CLUSTERING AND QR FACTORIZATION. Rob Swift, UCI Tuesday, August 2, 2011
RMSD-BASED CLUSTERING AND QR FACTORIZATION Rob Swift, UCI Tuesday, August 2, 2011 Outline Biomolecular flexibility, a few examples CADD pipeline overview RMSD clustering QR factorization Our evolving ideas
More informationCHAPTER 4. Milestones of the drug discovery
CHAPTER 4 Milestones of the drug discovery 4.Milestones of the drug discovery: Highlights the importance of the below critical milestones of the drug discovery and correlated to the current research. 1.
More informationCOMPUTER AIDED DRUG DESIGN: AN OVERVIEW
Available online on 19.09.2018 at http://jddtonline.info Journal of Drug Delivery and Therapeutics Open Access to Pharmaceutical and Medical Research 2011-18, publisher and licensee JDDT, This is an Open
More informationIn Vitro Pharmacology Services
In Vitro Pharmacology Services Simplify Your Drug Discovery Workflow What s What s Inside: Inside: Why DiscoverX Services x GPCR Screening & Profiling x Kinase Screening & Profiling x Safety Screening
More informationOutline. Background. Background. Background and past work Introduction to present work ResultsandDiscussion Conclusions Perspectives BIOINFORMATICS
Galactosemia Foundation 2012 Conference Breakout Session G July 20th, 2012, 14:15 15:15 Computational Biology Strategy for the Development of Ligands of GALK Enzyme as Potential Drugs for People with Classic
More informationDrug Repositioning. Cresset European User Group Meeting 21 st June 2012
Drug Repositioning Cresset European User Group Meeting 21 st June 2012 Repositioning-some definitions The most fruitful basis for the discovery of a new drug is to start with an old drug Sir James Black,
More informationEngage with us on Twitter: #Molecule2Miracle
Engage with us on Twitter: #Molecule2Miracle Kassy Perry President & CEO Perry Communications Group PhRMA Alliance Development Consultant.@kassyperry Emily Burke, Ph.D. Director of Curriculum BioTech
More informationDruggability & DruGUI. Ahmet Bakan Department of Computational and Systems Biology
Druggability & DruGUI Ahmet Bakan ahb12@pitt.edu Department of Computational and Systems Biology Target Druggability Can a given biological target, such as a protein, bind with high affinity to a drug?
More informationDiscovery of a First-In-Class Topically Bioavailable Kit Inhibitor With Clinical Activity Using Computational Chemogenomics Technology
20131009-03 Discovery of a First-In-Class Topically Bioavailable Kit Inhibitor With Clinical Activity Using Computational Chemogenomics Technology James Hendrix, Ph.D. President - Technology Med Chem &
More informationApplication of Deep Learning to Drug Discovery
Application of Deep Learning to Drug Discovery Hiroshi Tanaka Tohoku Medical Megabank Orga nization, Tohoku University Current Situation of Drug Discovery Rapid increase of R&D expenditure More than 1B
More informationProducts & Services. Customers. Example Customers & Collaborators
Products & Services Eidogen-Sertanty is dedicated to delivering discovery informatics technologies that bridge the target-tolead knowledge gap. With a unique set of ligand- and structure-based drug discovery
More informationIntegration of FDSS7000 into a modular robotic system for Open Innovation drug discovery
Integration of FDSS7000 into a modular robotic system for Open Innovation drug discovery José Manuel Brea & María Isabel Loza BioFarma, Santiago de Compostela DRUG DISCOVERY OPEN INNOVATION CLOSED innovation
More informationWhat is an Aptamer? smallest unit of repeating structure
What is an Aptamer? apto: mer: to fit smallest unit of repeating structure Aptamers are single stranded folded oligonucleotides that bind to molecular (protein) targets with high affinity and specificity
More informationPrediction of Protein-Protein Binding Sites and Epitope Mapping. Copyright 2017 Chemical Computing Group ULC All Rights Reserved.
Prediction of Protein-Protein Binding Sites and Epitope Mapping Epitope Mapping Antibodies interact with antigens at epitopes Epitope is collection residues on antigen Continuous (sequence) or non-continuous
More informationIntroducing a Highly Integrated Approach to Translational Research: Biomarker Data Management, Data Integration, and Collaboration
Introducing a Highly Integrated Approach to Translational Research: Biomarker Data Management, Data Integration, and Collaboration 1 2 Translational Informatics Overview Precision s suite of services is
More informationProtein-Ligand Docking powered by Volunteer Compouting
Docking@Home: Protein-Ligand Docking powered by Volunteer Compouting Michela Taufer and Trilce Estrda Global Computing Lab Computer and Information Sciences University of Delaware 1 Principles of Drug
More informationFrom Bench to Bedside: Role of Informatics. Nagasuma Chandra Indian Institute of Science Bangalore
From Bench to Bedside: Role of Informatics Nagasuma Chandra Indian Institute of Science Bangalore Electrocardiogram Apparent disconnect among DATA pieces STUDYING THE SAME SYSTEM Echocardiogram Chest sounds
More informationChemoinformatic Tools for the Hit Discovery Process
Chemoinformatic Tools for the Hit Discovery Process GmbH Björn Windshügel May 29 2013 ESP in a Nutshell Established in 2007 Service provider for academics High-throughput screening High-content screening
More informationTARGET VALIDATION. Maaike Everts, PhD (with slides from Dr. Suto)
TARGET VALIDATION Maaike Everts, PhD (with slides from Dr. Suto) Drug Discovery & Development Source: http://dlab.cl/molecular-design/drug-discovery-phases/ How do you identify a target? Target: the naturally
More informationVirtual Screening Manager for Grids
Large-scale distributed in silico drug discovery using VSM-G Leo GHEMTIO : Phd Student (lghemtio@loria.fr) Bernard MAIGRET : Advisor (maigret@loria.fr) INRIA LORRAINE, http://www.loria.fr Virtual Screening
More informationREIMAGINING DRUG DEVELOPMENT:
Biology Reconstructed REIMAGINING DRUG DEVELOPMENT: Accurate Disease Modeling To Drive Successful Therapies Julia Kirshner, CEO julia@zpredicta.com 1 SUCCESS RATES OF DRUG DEVELOPMENT ARE LOW, " PARTICULARLY
More informationImmunogenicity of Therapeutic Proteins. Steven J Swanson, Ph.D. Executive Director, Clinical Immunology
Immunogenicity of Therapeutic Proteins Steven J Swanson, Ph.D. Executive Director, Clinical Immunology swanson@amgen.com Causes of Immunogenicity Sequence differences between therapeutic protein and endogenous
More informationExploring Polypharmacology in Drug Discovery and Repurposing Using the CANDO Platform
Send Orders for Reprints to reprints@benthamscience.ae Current Pharmaceutical Design, 2016, 22, 000-000 1 Exploring Polypharmacology in Drug Discovery and Repurposing Using the CANDO Platform Gaurav Chopra
More informationPREDICTION AND SIMULATION OF MULTI-TARGET THERAPIES FOR TRIPLE NEGATIVE BREAST CANCER THROUGH A NETWORK-BASED DATA INTEGRATION APPROACH
University of Pavia Dep. of Electrical, Computer and Biomedical Engineering PREDICTION AND SIMULATION OF MULTI-TARGET THERAPIES FOR TRIPLE NEGATIVE BREAST CANCER THROUGH A NETWORK-BASED DATA INTEGRATION
More informationQuo vadis Drug Discovery
Quo vadis Drug Discovery Donatella Verbanac, Dubravko Jelić, Sanja Koštrun, Višnja Stepanić, Dinko Žiher PLIVA - Research Institute, Ltd. Prilaz baruna Filipovića 29, 10000 Zagreb, CROATIA The Pharmaceutical
More informationCAN-FITE BIOPHARMA LTD. (Exact name of Registrant as specified in its charter)
UNITED STATES SECURITIES AND EXCHANGE COMMISSION Washington, D.C. 20549 FORM 6-K Report of Foreign Private Issuer Pursuant to Rule 13a-16 or 15d-16 Under the Securities Exchange Act of 1934 For the Month
More informationSupplementary information for Small molecule inhibitors block Gas6-inducible TAM activation and tumorigenicity
Supplementary information for Small molecule inhibitors block Gas6-inducible TAM activation and tumorigenicity Stanley G. Kimani 1 *, Sushil Kumar 1 *, Nitu Bansal 2 *, Kamalendra Singh 3, Vladyslav Kholodovych
More informationSmall-Molecule Drug Target Identification/Deconvolution Technologies
Small-Molecule Drug Target Identification/Deconvolution Technologies Case-Studies Shantani Target ID Technology Tool Box Target Deconvolution is not Trivial = A single Tool / Technology May Not necessarily
More informationPharmaceutical Informatics and the Pathway to Personalized Medicines
Pharmaceutical Informatics and the Pathway to Personalized Medicines Sangtae Kim and Venkat Venkatasubramanian Purdue University ICCS2007 DDDAS Workshop Beijing May 26-28, 2007 Outline The Grand Challenge
More informationProgress and Future Directions in Integrated Systems Toxicology. Mary McBride Agilent Technologies
Progress and Future Directions in Integrated Systems Toxicology Mary McBride Agilent Technologies 1 Toxicity testing tools of the late 20 th century Patchwork approach to testing dates back to the 1930
More informationDrug Discovery in Chemoinformatics Using Adaptive Neuro-Fuzzy Inference System
Drug Discovery in Chemoinformatics Using Adaptive Neuro-Fuzzy Inference System Kirti Kumari Dixit 1, Dr. Hitesh B. Shah 2 1 Information Technology, G.H.Patel College of Engineering, dixit.mahi@gmail.com
More informationthe PLATFORM Pipeline in Lyon AREA
the PLATFORM Pipeline in Lyon AREA Do you have development or partnership projects in Life Sciences? Are you interested in developing your business in France? This overview is designed to give you an idea
More informationBioFarma USEF. Expertise in drug discovery projects
BioFarma USEF Expertise in drug discovery projects Since more than 15 years, we have provided custom assay development, compound profiling, high-throughput screening services and collaborations in over
More informationThe use of target immobilised NMR screening to identify and develop fragment binders to Hsp90
The use of target immobilised MR screening to identify and develop fragment binders to sp90 ot topics in drug discovery: finding the next lead 11 ovember 2009 John Porter 2009 UCB Celltech Introduction
More informationNonclinical Data to Support FIH Clinical Trials for Cancer Immunotherapies. Whitney S. Helms, PhD IOM, February 29,2016
Nonclinical Data to Support FIH Clinical Trials for Cancer Immunotherapies Whitney S. Helms, PhD IOM, February 29,2016 Disclaimer The views disseminated in this talk are my own and do not necessarily represent
More informationAssembly Biosciences Jefferies 2015 Microbiome Summit. December 16, 2015
Assembly Biosciences Jefferies 2015 Microbiome Summit December 16, 2015 Forward-Looking Statements This presentation contains forward-looking statements regarding future events. Forward-looking statements
More informationIntroduction to Assay Development
Introduction to Assay Development A poorly designed assay can derail a drug discovery program before it gets off the ground. While traditional bench-top assays are suitable for basic research and target
More informationPersonalized Medicine A new challenge for applied human pharmacology?
Personalized Medicine A new challenge for applied human pharmacology? Jochen Theis, MD FFPM InHeCon Leipzig 2 nd March 2012 Personalized Medicine: Predicting Variability in Drug Response InHeCon Jochen
More informationB-cell Epitope Prediction and Cloning monoclonal ADAs
B-cell Epitope Prediction and Cloning monoclonal ADAs Stefan Ryser, CEO, Trellis Bioscience 3 rd International Symposium on Higher Order Structure of Protein Therapeutics Arlington, Virginia, February
More informationleading the way in research & development
leading the way in research & development people. passion. possibilities. ABBVIE 2 immunology AbbVie Immunology has a demonstrated record of success in identifying and developing both small molecule and
More informationApplying Affimers. Dr Amanda Nicholl at Avacta Life Sciences. Improving Antibody PK Assay Development
Improving Pharmacokinetic Assays in a Regulatory Bioanalysis Setting Applying Affimers With an increasing number of antibody-based therapeutics entering the clinic, the need for validated anti-idiotypic
More informationGene expression connectivity mapping and its application to Cat-App
Gene expression connectivity mapping and its application to Cat-App Shu-Dong Zhang Northern Ireland Centre for Stratified Medicine University of Ulster Outline TITLE OF THE PRESENTATION Gene expression
More informationMarch Company Introduction. Microbiome R&D and Business Collaboration Forum: Europe Myriam Golembo, VP Development
March 2018 Company Introduction Microbiome R&D and Business Collaboration Forum: Europe Myriam Golembo, VP Development Biomx At A Glance We are a microbiome drug discovery company developing customized
More informationFDA Draft Guidance on Immunogenicity Testing
FDA Draft Guidance on Immunogenicity Testing Susan Kirshner, Ph.D. Associate Chief, Laboratory of Immunology Division of Therapeutic Proteins OBP/CDER/FDA EBF 2010 Guidance for Industry Assay Development
More informationDRUG DISCOVERY AND DEVELOPMENT-PRECLINICAL ASPECTS
DRUG DISCOVERY AND DEVELOPMENT-PRECLINICAL ASPECTS 4th November 2014 Biomedicine Masters Program, Lund University Wayne Russell, PhD. ZEALAND PHARMA AGENDA TODAYS TALK: - INTRODUCTION TO DRUG DISCOVERY
More informationOptimizing the Development of Biosimilars Using PK/PD: Recent Scientific and Regulatory Advances
Optimizing the Development of Biosimilars Using PK/PD: Recent Scientific and Regulatory Advances Jian Wang, MD, PhD Chief, Clinical Evaluation Division Biologics and Genetic Therapies Directorate Health
More informationHow Targets Are Chosen. Chris Wayman 12 th April 2012
How Targets Are Chosen Chris Wayman 12 th April 2012 A few questions How many ideas does it take to make a medicine? 10 20 20-50 50-100 A few questions How long does it take to bring a product from bench
More informationUsing Computational Chemistry to Identify New Uses for Old Medicines
Using Computational Chemistry to Identify New Uses for Old Medicines http://www.re-pharm.com alan@re-pharm.com Re-Pharm summary > Clinical-stage company actively building a drug development pipeline >
More informationYork University School of Medicine, NY. Bhagavathi A. Narayanan, PhD 1, Caroline Cunnigham 1 and Amitabha Mazumder, MD 2. Title
Title Suppression of Human Multiple Myeloma Cell Growth by TBL-12 in Combination with low doses of Velcade: Insight in to the modulation of IL-6/STAT-3 mechanisms Bhagavathi A. Narayanan, PhD 1, Caroline
More informationUnique PK-PD properties of biotechnology-based therapeutics [mabs] and First In Human dose considerations. [mabs -monoclonal antibodies ] Peter Lloyd
Unique PK-PD properties of biotechnology-based therapeutics [mabs] and First In Human dose considerations [mabs -monoclonal antibodies ] Peter Lloyd Head of Pharmacokinetics-Pharmacodynamics Novartis Biologics
More informationFDA Perspective on the Preclinical Development of Cancer Vaccines
FDA Perspective on the Preclinical Development of Cancer Vaccines Richard D. McFarland Ph.D., M.D. Medical Officer CBER/OCTGT/DCEPT mcfarlandr@cber.fda.gov Cancer Vaccine Clinical Trials Workshop Alexandria,
More informationFast Track Drug Development The Clinical (Caleidoscopic) Perspective
20 Years AGAH, Annual Meeting, Hamburg 21.-23. February 2010 Fast Track Drug Development The Clinical (Caleidoscopic) Perspective Fritz R. Bühler, MD ECPM, University of Basel European Innovative Medicine
More informationBiosimilar Development Clinical Investigator Considerations
Biosimilar Development Clinical Investigator Considerations June 2011 www.ppdi.com Biosimilar products are not new in the pharmaceutical industry. However, the pending expiration of numerous therapeutic
More informationSynthetic vaccine research and development. Comprehensive and innovative synthetic biology solutions and technologies
Synthetic vaccine research and development Comprehensive and innovative synthetic biology solutions and technologies From plan to product, Thermo Fisher Scientific supports your synthetic vaccine goals
More informationDrug Discovery and Development at NIH for Rare and Neglected Diseases September 29, 2009
Drug Discovery and Development at NIH for Rare and Neglected Diseases September 29, 2009 Melissa Ashlock, Christopher P. Austin, Steve Groft Genetic Alliance Posted in the Resource Repository at: http://www.resourcerepository.org/documents/1692/drugdiscoveryanddevelopmentat
More informationDennis Wright, Ph.D. Professor of Medicinal Chemistry NPDD Initiative UCONN School of Pharmacy University of Connecticut
Craig M. Crews, Ph.D. Lewis B. Cullman Professor of Molecular, Cellular, and Developmental Biology Chemistry, Pharmacology Center for Molecular Discovery Yale University Dennis Wright, Ph.D. Professor
More informationMolecular Diagnostics Regulation Shifting from a Biomarker-Based Approach to an Algorithm-Based Approach
Molecular Diagnostics Regulation Shifting from a Biomarker-Based Approach to an Algorithm-Based Approach Presented by Kathryn Scheckel Co-authored with Gary Marchant May 27, 2015 Molecular Diagnostics
More informationA Life-cycle Approach to Dose Finding Studies
A Life-cycle Approach to Dose Finding Studies Rajeshwari Sridhara, Ph.D. Director, Division of Biometrics V Center for Drug Evaluation and Research, USFDA This presentation reflects the views of the author
More informationIs AI the Holy Grail for Drug Discovery? Using AI and In Silico Methods to Design Drugs
Is AI the oly Grail for Drug Discovery? Using AI and In Silico Methods to Design Drugs Ed Addison, CEO ed.addison@cloudpharmaceuticals.com Phone: (910) 398-1200 www.cloudpharmaceuticals.com WY USE AI &
More informationsignificant concerns no or very low predictive power
Your feedback Citizens concerns should be considered How to ensure ethical concerns are harnessed to drive change? Don t separate Non-animal and animal approaches they are integrated Avoid overstating
More informationWhat s New in Discovery Studio 2.5.5
What s New in Discovery Studio 2.5.5 Discovery Studio takes modeling and simulations to the next level. It brings together the power of validated science on a customizable platform for drug discovery research.
More informationSolving Structure Based Design Problems using Discovery Studio 1.7 Building a Flexible Docking Protocol
Solving Structure Based Design Problems using Discovery Studio 1.7 Building a Flexible Docking Protocol C. M. (Venkat) Venkatachalam Fellow, Life Sciences Dipesh Risal Marketing, Life Sciences Overview
More informationFragment-based screening of enzyme drug targets: Microfluidic mobility shift assay improves confidence in candidate selection
Fragment-based screening of enzyme drug targets: Microfluidic mobility shift assay improves confidence in candidate selection Introduction Fragment-based lead discovery is establishing itself as valuable
More informationToxicology - Problem Drill 24: Toxicology Studies in Pharmaceutical Development
Toxicology - Problem Drill 24: Toxicology Studies in Pharmaceutical Development No. 1 of 10 1. regulates all the drugs products manufactured and sold in the USA. (A) EMEA (B) IND (C) FDA (D) NDA (E) OSHA
More informationJan Company Introduction. Microbiome Drug Development Europe Assaf Oron, CBO
Jan. 2018 Company Introduction Microbiome Drug Development Europe Assaf Oron, CBO Biomx At A Glance We are a microbiome drug discovery company developing customized phage therapies that target and destroy
More informationCompanion Diagnostics in Autoimmune Disorders: Improving Outcomes Through Personalized Medicine
Companion Diagnostics in Autoimmune Disorders: Improving Outcomes Through Personalized Medicine Carrie Brodmerkel, PhD Immunology Biomarkers Janssen R&D 1 Immune-Mediated Diseases Rheumatoid Arthritis
More informationICH S9 guideline on nonclinical evaluation for anticancer pharmaceuticals - questions and answers
16 May 2018 EMA/CHMP/ICH/453684/2016 Committee for Human Medicinal Products ICH S9 guideline on nonclinical evaluation for anticancer pharmaceuticals - questions and answers Step 5 Transmission to CHMP
More informationPharmacology. Chatchai Chinpaisal, Ph.D. Department of Pharmacology and Toxicology, Faculty of Pharmacy, Silpakorn University.
Pharmacology Chatchai Chinpaisal, Ph.D. Department of Pharmacology and Toxicology, Faculty of Pharmacy, Silpakorn University. 1 PHARMACODYNAMIC STUDIES A. Primary pharmacodynamics primary action in target
More informationSpecialty Lab Services. Deep science at scale
Specialty Lab Services Deep science at scale Advancing biomarker research Our broad expertise and global laboratory footprint deliver deep science at scale Specialty assays drive insight into preclinical
More informationPhase 1 Clinical Studies First-In-Human (FIH) <Chapter 31> Pharmacologically-Guided Dose Escalation
Phase 1 Clinical Studies First-In-Human (FIH) Pharmacologically-Guided Dose Escalation Jerry M. Collins, Ph.D. Developmental Therapeutics Program Division of Cancer Treatment and Diagnosis,
More informationIntroduction of Development Center for Biotechnology TAIWAN
Introduction of Development Center for Biotechnology TAIWAN DCB Nonprofit Organization Founded in 1984 Funded Mainly by Ministry of Economic Affairs (MOEA), National Science Council and the Industry 394
More informationCombing molecular dynamics and machine learning for advanced pose and free-energy prediction
Combing molecular dynamics and machine learning for advanced pose and free-energy prediction Oleksandr Yakovenko (Alex), PhD Chief Technical Officer IFOWON.CO (a spinoff from BC Cancer Agency) Vancouver,
More informationPharmacophore modeling, virtual computational screening and biological evaluation studies
Pharmacophore modeling, virtual computational screening and biological evaluation studies Drug discovery process plays an important role in identifying new investigational drug-likes and developing new
More informationUse of a Label-Free Platform in a preclinical Contract Research Organization Environment
Use of a Label-Free Platform in a preclinical Contract Research Organization Environment Scott Perschke Director, Assay Development Contents Introduction 2 Problem Statement 2 Previous Options 2 Solution
More informationHuman Hyal-1 from in silico pharmacophore modeling to in vitro inhibitor screening
Human Hyal-1 from in silico pharmacophore modeling to in vitro inhibitor screening Isabelle Lengers 1, *, Fabian Herrmann 2, Samer Haidar 1 and Joachim Jose 1 1 Institute of Pharmaceutical and Medicinal
More informationJan Willem van der Laan
First-in-human studies: Recent experiences in Europe Jan Willem van der Laan Section Pharmacological-Toxicological and Biotechnology Assessment Medicines Evaluation Board, Utrecht First-in-human trials
More informationSol Ruiz, PhD, Spain
GaBI Scientific Meetings ROUNDTABLE ON BIOSIMILARS Pharmacovigilance, Traceability, Immunogenicity 15 November 2016, Real Academia Nacional de Farmacia, Madrid, Spain Sol Ruiz, PhD, Spain Head of Sector,
More informationTargeting the Functional Activity of PrP C as a Novel Strategy for Drug Discovery in Prion Diseases
Targeting the Functional Activity of PrP C as a Novel Strategy for Drug Discovery in Prion Diseases Emiliano Biasini Department of Biochemistry Boston University School of Medicine One protein, two forms:
More informationFinancial Results FY2018 Q3
Financial Results FY2018 Q3 (January to September 2018) Carna Biosciences, Inc. Stock Code:4572 1 FY2018 Q3 Key Highlights Established the clinical development team to initiate clinical trials of Carnaʼs
More informationCompound Re-Profiling. Dr Robert Scoffin CEO, Cresset
Compound Re-Profiling Dr Robert Scoffin CEO, Cresset What is it? F F F N N H 2 N S O O Br > Compound Re-Profiling or Re-Purposing is the process of finding a new clinical use for an existing treatment
More informationOvercoming drug & target interference in ADA and nabassays
Overcoming drug & target interference in ADA and nabassays Robert Nelson Ph.D. MRQA Head of Bioanalytical Laboratory, Novimmune SA 1 Presentation Outline Case Study 1 Drug & target interference in a clinical
More informationChanges to a Potency Bioassay for Biotechnology Products: a Regulatory Perspective Kathleen A. Clouse, Ph.D., Director Division of Monoclonal Antibodi
Changes to a Potency Bioassay for Biotechnology Products: a Regulatory Perspective Kathleen A. Clouse, Ph.D., Director Division of Monoclonal Antibodies Office of Biotechnology Products Center for Drug
More informationGuideline for the quality, safety and efficacy of follow-on biological medicinal products
Guideline for the quality, safety and efficacy of follow-on biological medicinal products 1. Introduction A follow-on biological medicinal product (hereinafter referred to as FOBMP) is considered as a
More informationPioneering Clinical Omics
Pioneering Clinical Omics Clinical Genomics Strand NGS An analysis tool for data generated by cutting-edge Next Generation Sequencing(NGS) instruments. Strand NGS enables read alignment and analysis of
More informationReviewers' comments: Reviewer #1 (Remarks to the Author):
Reviewers' comments: Reviewer #1 (Remarks to the Author): Modulating immune checkpoint pathways like CTLA-4 and PD-1 for cancer immunotherapy has gained much attention in recent years due to their immense
More informationThe Kinase Knowledgebase
The Kinase Knowledgebase Kevin P. Hambly Product Manager Derek A. Debe, Ph.D. Chief Scientific Officer Outline About Eidogen-Sertanty Kinase Knowledgebase Overview Content Curation Process Data Structure
More informationFit-for-purpose limits and Tolerance intervals: connecting the assay performance to the clinical trial
Fit-for-purpose limits and Tolerance intervals: connecting the assay performance to the clinical trial Astrid Jullion & Bruno Boulanger Exploratory Statistics Pharmacometrics Lou, living with epilepsy
More informationDocking. Why? Docking : finding the binding orientation of two molecules with known structures
Docking : finding the binding orientation of two molecules with known structures Docking According to the molecules involved: Protein-Ligand docking Protein-Protein docking Specific docking algorithms
More informationExpression Profiling for
RNAi Screen, NGS and Expression Profiling for Biomarker Discovery Namjin Chung Applied Genomics Bristol-Myers Squibb 2012 DOT Oct 2, 2012 Boston, MA Pharmacogenomics Study of the role of inheritance in
More informationAN TB IOTIC. This project is funded by the European Union. This project is funded by the European Union.
TUBERCULOSIS Tuberculosis () today rivals HIV/AIDS as the leading cause of death from infectious diseases. The number of patients has never been higher than today and the growing proportion of drug-resistant
More informationValidating drug repurposing signals using electronic health records: a case study of metformin associated with reduced cancer mortality
Validating drug repurposing signals using electronic health records: a case study of metformin associated with reduced cancer mortality Hua Xu, PhD School of Biomedical Informatics, UTHealth JAMIA Journal
More informationJuly 4, 2017 Shigenori Ohkawa, Ph.D. Head of Central Pharmaceutical Research Institute
Research and Development at JTʼs Pharmaceutical Business July 4, 2017 Shigenori Ohkawa, Ph.D. Head of Central Pharmaceutical Research Institute FORWARD-LOOKING STATEMENTS This presentation contains forward-looking
More informationIMPROVE SPEED AND ACCURACY OF MONOCLONAL ANTIBODY BIOANALYSIS USING NANOTECHNOLOGY AND LCMS
IMPROVE SPEED AND ACCURACY OF MONOCLONAL ANTIBODY BIOANALYSIS USING NANOTECHNOLOGY AND LCMS As scientists gain an advanced understanding of diseases at the molecular level, the biopharmaceutical industry
More information