Site-Specific ADC Generation Using SMARTag Technology
|
|
- Allen Bryan
- 6 years ago
- Views:
Transcription
1 Site-Specific ADC Generation Using SMARTag Technology David Rabuka, PhD World ADC Summit San Diego, Oct 2015
2 SMARTag TM technology: Site-specific protein modification using bioorthogonal chemistry Site-Specific Conjugation Sletten EM and Bertozzi CR Angew. Chem. Int. Ed. 2009, 48, Rabuka D Curr. Opin. Chem. Biol. 2010, 14, Patterson DM et. al. ACS Chem. Biol. 2014, 9,
3 Benefits of site-specific ADC technology Biologic Advantages Enhanced Potency Improved Biophysical Characteristics Improved PK Increased Serum Half-Life Improved Payload Stability Less TOXICITY Increased TI amount Lot 1 amount 0 amount Lot Lot 3 CMC Advantages Reproducible, simplified Analytics Albers AE, et al. Eur J Med Chem 2014, 88, 3-9 Drake PM, et al. Bioconjugate Chem :
4 SMARTag TM technology: Simple and efficient approach for generating site-specific conjugates CHO Cell SMARTag TM mab SMARTag TM ADC FGE formylglycine generating enzyme (CxPxR specific) protein expression conjugation aldehyde generation in vivo standard purification site-specific payload placement SH H O H O xpxr cysteine (thiol) H O xpxr formylglycine (aldehyde) Rabuka, D., et al., at Protoc. 2012, 7,
5 The SMARTag TM Platform Enables Optimization Through SAR Exploration Site Selection Cytotoxicity Pharmacokinetics Efficacy Toxicity Linker Composition DAR 4
6 Hydrazinyl-Iso-Pictet-Spengler (HIPS) Ligation to Formylglycine Gives a Stable Carbon-Carbon Bond H H 2 + R O H H H R H H R Pictet-Spengler reaction H Me H Me + R O H R H Me Me H R Me Me Pictet-Spengler ligation Me H Me Bioconjugation: C-C bond formation Me Me Me Me O H H O Agarwal, P. W. et al. Bioconjugate Chem. 2013, 24, Liu, J. et al. Sci Rep. 2015, in press.
7 A SMARTag HIPS MMAE-conjugate is more stable than a conventional Cys-MMAE conjugate at 37 C in rat plasma 120 HIPS C C conjugation Anti-MMAE signal/anti-fc signal (normalized) SMARTag "conjugate"" MMAE- Conven9onal"Cys"Conjugate" TBOS plasma Starting point 7 d 14 d 6
8 SMARTag TM mab Position Engineering: Tags can be Placed Throughout the Protein SITE SELECTIO SMARTag TM mabs MULTIPLE OPTIMIZED SITES BIOPHYSICAL PROPERTIES Aggregation <5% Antigen binding o Impact Internalization o Impact Melting Temp. o Impact FcRn binding o Impact Immunogenicity* Low Risk *Antitope Episcreen 7
9 Tag Position Greatly Influences Inhibition of Tumor Growth In Vivo Conjugation Site Matters 1 2 tumor volume (mm 3 ) Site 1 Site 2 Site 3 T-DM1 Vehicle time since dose (d) Site selection dramatically affects tumor growth inhibition Drake PM, et al. Bioconjugate Chem :
10 GPEx Cell Lines Enable Robust SMARTag TM mab Production with High Titers and Tag Conversion PROTEI PRODUCTIO Clone 5 Clone 4 Clone 3 Clone 2 Clone titer (g/l) 75 pg/cell/day O H O H Clone 4 Clone aldehyde (%) 9
11 GPEx Cell Lines Enable Robust SMARTag TM mab Production with Full Conversion of Multiple Tags on a Single Antibody PROTEI PRODUCTIO Clone 3 Clone 2 Clone titer (g/l) Site 2 Site 1 Clone 3 Clone 2 Clone aldehyde (%) 10
12 Exploring the Effects of Linker Composition on SMARTag TM ADCs Mean tumor volume (mm 3 ) Vehicle Linker 1 Linker 2 4AP Various linkers tested for in vivo efficacy, stability, PK against multiple targets 4AP ADC linker had superior in vivo efficacy, biophysical properites Days Albers AE, et al. Eur J Med Chem 2014, 88,
13 αher2 4AP is highly monomeric and comprises a single light and heavy chain species MW kd SEC-HPLC HIC-HPLC ) αher2 CT (R) 2) αher2 CT-4AP ADC (R) 3) αher2 CT (R) 4) αher2 CT-4AP ADC (R) 1 2 PLRP-HPLC Conjugated HC, expected 51,245 Da LC-MS: DAR 1.8 Light chain, expected 23,443 Da 12
14 Homogenous ADC Peptide Mapping: Site specific 4AP conjugation (fgly) relative to DM1 conjugation (lysine) HER2 Light Chain DIQMTQSPSSLSASVGDRVTITCRASQDVTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQ QHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLFYPREAKVQWKVDALQSGSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFRGEC Kadcyla LC Sequence Coverage = 214 of 214 =.0% HER2 Heavy Chain EVQLVESGGGLVQPGGSLRLSCAASGFIKDTYIHWVRQAPGKGLEWVARIYPTGYTRYADSVKGRFTISADTSKTAYLQMSLRAE DTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICVHKPSTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFWYVDGVEVHAKTKPREEQYSTYRVVSVLTVLHQDWLGKEYKCKVSKALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKQVSLTCLVKGFYPSDIAVEWESGQPEYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGVFSCSVMHEALHHYTQKSLS LSPGK HC Sequence Coverage = 450 of 450 =.0% HER2 Light Chain DIQMTQSPSSLSASVGDRVTITCRASQDVTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQ QHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLFYPREAKVQWKVDALQSGSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFRGEC αher2 4AP Redwood Heavy Chain EVQLVESGGGLVQPGGSLRLSCAASGFIKDTYIHWVRQAPGKGLEWVARIYPTGYTRYADSVKGRFTISADTSKTAYLQMSLRAE DTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICVHKPSTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFWYVDGVEVHAKTKPREEQYSTYRVVSVLTVLHQDWLGKEYKCKVSKALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKQVSLTCLVKGFYPSDIAVEWESGQPEYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGVFSCSVMHEALHHYTQKSLS LSPGSLCTPSRGS HC Sequence Coverage = 426 of 456 = 93.4% _ = Conjugation site(s) 13
15 The αher2 4AP ADC binds antigen equally well as wild-type antibody (trastuzumab) 4 Absorbance (A.U.) αher2 WT αher2 4AP ng/ml Binding to HER2-His protein as measured by ELISA 14
16 ADCs made with 4AP maytansine are highly potent in vitro against multiple cell lines and different target antigens Maytansine αher2 4AP 0.1 Maytansine αcd22 4AP Kadcyla 0.08 IC50 [nm] Drug IC50 [nm] Drug CI-87 BT-474 Sk-Br-3 0 Ramos WSU-DLCL2 15
17 The αher2 4AP ADC does not show bystander killing against antigen-negative cells in vitro HER2- Ramos Cells HER2- WSU-DLCL2 Cells % Viability 50 % Viability 50 αher2 4AP Kadcyla αher2 4AP Kadcyla Concentration Ab [nm] Concentration Ab [nm] 16
18 The αher2 4AP conjugate shows superior stability relative to Kadcyla in rat plasma at 37 C over 2 weeks 120 Anti-maytansine signal/anti-fc signal (normalized) CT 4AP Kadcyla Starting point 7 d 14 d ELISA-based readout comparing maytansine signal to antibody signal. Loss of payload is indicated by a decrease in the maytansine/fc ratio. 17
19 ADCs made with 4AP maytansine display improved in vivo stability relative to Kadcyla as exemplified by a rat PK study 0000 αcd22 4AP Total Ab αcd22 4AP Total Conjugate αcd22 4AP Total ADC 000 αher2 4AP Total Conjugate αher2 4AP Total Ab αher2 4AP Total ADC 000 Kadcyla Total Ab Kadcyla Total Conjugate Kadcyla Total ADC ng/ml 00 ng/ml ng/ml Days post-dose Days post-dose Days post-dose Analyte αcd22 4AP T ½ (days) αher2 4AP T ½ (days) Kadcyla T ½ (days) Total antibody Total conjugate (DAR >0) Total ADC (DAR sensitive)
20 The αher2 4AP conjugate outperformed Kadcyla at equal drug loading, and was similar to Kadcyla at equal antibody loading Kadcyla DAR: 3.5 αher2 4AP DAR: Body weight was not affected by dosing Endpoint Tumor volume (mm 3 ) Days Relative body weight (%) 4 stable disease Days post-dose Vehicle Isotype 4AP, 6 mg/kg αher2 4AP, 3 mg/kg αher2 4AP, 6 mg/kg Kadcyla, 3 mg/kg 19
21 The αher2 4AP conjugate provided enduring tumor control leading to significant survival benefits compared to Kadcyla Percent survival Days post-dose Vehicle Isotype 4AP, 6 mg/kg αher2 4AP, 3 mg/kg αher2 4AP, 6 mg/kg Kadcyla, 3 mg/kg 8 mice/group CI-87 xenografts Dosing started when tumors reached ~268 mm 3. Animals dosed 1x/wk for 4 wk. Error bars = S.E.M. 20
22 The αcd22 4AP conjugate was highly efficacious against WSU-DLCL2 xenografts 2500 Mean tumor volume (mm 3 ) Endpoint Vehicle αcd22 4AP 6 complete responses (75%); 3 durable to end of study mg/kg Days 21
23 A single dose exploratory rat toxicity study based on the Kadcyla toxicology program was performed Test Article DAR Dose (mg/kg) # of Rats Vehicle n/a 0 5 4AP ADC AP ADC AP ADC AP ADC Kadcyla Kadcyla Kadcyla Single bolus i.v. injection on day 1. Based on Poon et al. 2013, Toxicology and Applied Pharmacology 22
24 o mortality was observed for rats dosed with a 4AP ADCs, even at 60 mg/kg, which was a lethal dose for Kadcyla Test article Dose (mg/kg) Mortality Vehicle 0 0/5 4AP ADC 6 0/5 4AP ADC 20 0/5 4AP ADC 40 0/5 4AP ADC 60 0/5 Kadcyla 6 0/5 Kadcyla 20 1/5 70 Kadcyla 60 5/ Body weight (% of control) Days post-dose Equivalent drug dosing Vehicle 1 Kadcyla, 6 mg/kg Kadcyla, 20 mg/kg Kadcyla, 60 mg/kg αcd22 4AP, 6 mg/kg αcd22 4AP, 20 mg/kg αcd22 4AP, 40 mg/kg αcd22 4AP, 60 mg/kg αher2 4AP, 6 mg/kg αher2 4AP, 20 mg/kg αher2 4AP, 60 mg/kg 4AP ADC treatment caused minimal weight loss, with less impact than Kadcyla at equal drug dosing 23
25 4AP ADC effects on the liver and platelets 00 ight ontrol) of (% control) of control) ALT (% of control) ht of control) t weight (% control) of control) (% of control) % of eight dy control) of of weight (% control) (% of of control) (% of control) ody y weight (% (% of of control) of (% f weight control) of Body control) (% weight Body weight of control) (% of control) (% of control) y ody weight weight Body (% of (% weight control) of control) (% of control) Dose 80 (mg/kg) Body Body weight weight Body (% weight (% of Body of control) (% weight of control) (% of control) Body Body weight weight (% Body of (% control) weight of control) (% of control) control) of control) (% of control) Body weight (% of control) Platelets (thousand/µl) Body weight (% of control) Dose (mg/kg) Vehicle 1 Kadcyla, Vehicle 6 mg/kg 1 Kadcyla, Vehicle Kadcyla, 120 mg/kg 6 mg/kg Kadcyla, Vehicle Kadcyla, mg/kg 20 mg/kg Vehicle Vehicle 1 Kadcyla, Vehicle 1 1 αcd22 Kadcyla, 1 Vehicle Vehicle 4AP, 20 6 Kadcyla, mg/kg Kadcyla, mg/kg Vehicle 1 αcd22 Kadcyla, 6 4AP, 1 Vehicle 6 Kadcyla, Vehicle Kadcyla, Vehicle Vehicle Kadcyla, 60 Kadcyla, mg/kg αcd22 4AP, mg/kg 20 mg/kg Kadcyla, Kadcyla, αcd AP, Vehicle m 60 Kadcyla, 6 mg/kg 1 20 Kadcyla, Vehicle Kadcyla, αcd22 αcd mg/kg 6 20 mg/kg Vehicle 604AP, 4AP, Vehicle 6 40 m Vehicle Kadcyla, Vehicle mg/kg mg/kg Kadcyla, αcd22 4AP, mg/kg 40 Kadcyla, Kadcyla, 6020 mg/kg αcd22 Kadcyla, 4AP, mg/kg 60 Vehicle 4AP, AP, m Kadcyla, 1 αcd22 Kadcyla, m αher mg/kg AP, mg/kg mg/k αcd22 Kadcyla, 60 mg/kg αcd22 αher2 4AP, 4AP, mg/kg αcd22 Kadcyla, 60 mg/kg 4AP, 20 6 Kadcyla, Kadcyla, Kadcyla, αcd AP, 20 m Kadcyla, αher mg/kg mg/kg αher2 αcd Kadcyla, Kadcyla, 4AP, 20 6 mg/kg 4AP, 4AP, 4AP, αcd22 Kadcyla, αcd22 4AP, 60 4AP, 60 mg/kg 40 4AP, m Kadcyla, mg/kg Kadcyla, Kadcyla, αcd22 Kadcyla, αcd αher2 60 4AP, 20 αher2 4AP, 20 4AP, mg/kg 6 mg/kg αcd22 αher2 αcd22 40 m αcd22 4AP, 4AP, Kadcyla, 4AP, mg/kg mg/kg 20 mg/kg αcd22 αher2 6 αcd AP, 4AP, m 4AP, 6 mg/kg mg/kg 6 mg/kg αcd AP, αher2 4AP, 6 mg/kg 20 6 m αcd22 αher2 αcd22 αcd AP, mg/kg 20 6 m 4AP, 20 αcd AP, AP, 40 mg/kg mg/k αher2 4AP, 4AP, αcd22 mg/kg αcd22 αcd22 4AP, 6 4AP, 20 mg/kg 40 40m αcd22 4AP, αcd22 4AP, mg/kg 40 mg/kg mg/kg 6 αher2 αcd22 4AP, mg/kg mg/kg αher2 4AP, 4AP, mg/kg mg/kg αher2 4AP, 4AP, 4AP, 4AP, m αcd22 αher2 4AP, αcd22 αcd22 αher mg/kg 6 60 αher2 4AP, 6 mg/kg αher2 4AP, mg/kg AP, 6 60 αher2 αher2 4AP, 60 4AP, 4AP, 4AP, mg/k mg/kg 6 m m αher2 αher2 4AP, 4AP, 4AP, 20 4AP, 660 mg/kg m m αher2 4AP, 4AP, mg/kg αher2 αher2 4AP, 4AP, 4AP, 60 4AP, 20 mg/kg αher2 4AP, 60 mg m αher2 αher2 4AP, 4AP, 60 mg 60 Vehicle 1 Kadcyla, 6 mg/kg Kadcyla, 20 mg/kg Vehicle 1 Kadcyla, 60 mg/kg Kadcyla, 6 mg/kg αcd22 4AP, 6 mg/kg Vehicle Kadcyla, 1 20 mg/kg αcd22 4AP, 20 mg/kg Vehicle Kadcyla, 1660 mg/kg mg/kg αcd22 Kadcyla, 4AP, mg/kg 6 mg/kg αcd22 Kadcyla, 4AP, mg/kg 20 mg/kg Kadcyla, αher2 αcd22 4AP, 4AP, 60 mg/kg 6 40 mg/kg mg/kg mg/kg αher2 αcd22 4AP, 4AP, mg/kg mg/kg αcd22 αher2 αcd22 αher2 4AP, 4AP, mg/kg mg/kg αcd22 αher2 4AP, mg/kg αcd22 αher2 4AP, mg/kg mg/kg αher2 4AP, 620 mg/kg αher2 4AP, mg/kg αher2 4AP, 60 mg/kg 24
26 Toxicokinetics of the αher2 4AP in non-human primates reveals excellent stability of the conjugate mg/kg total antibody 10 mg/kg total conjugate 000 ng/ml Hours post-dose 25
27 The αher2 4AP was very well tolerated in cynomolgus safety studies up to 60 mg/kg Alanine amino transferase (IU/L) Day 1 Day 3 Day 5 Platelets (% of predose levels)
28 The SMARTag TM Platform Summary: Optimizing ADC Components PROTEI PRODUCTIO GPEx CELL LIE EGIEERIG SITE SELECTIO MULTIPLE OPTIMIZED PLACEMETS SITE-SPECIFIC COJUGATIO STABLE, PROPRIETARY CHEMISTRIES MODULAR LIKERS SOLUBILITY, RELEASE TRIGGER CYTOTOXI MULTIPLE PAYLOADS 27
29 Acknowledgements Catalent Biologics West Dr. Penelope Drake Dr. Robyn Barfield Dr. Yun Kim Dr. Al Garofalo Dr. Jesse McFarland Dr. Romas Kudirka Dr. Leon Xu Stefanie Banas Adam Carlson Beatty Huang Lesley Jones Wes Zmolek Catalent Biologics Madison Dr. Gregory Bleck Dr. Dona York Additional Funding 28
30 CATALET BIOLOGICS WEST 5703 HOLLIS STREET EMERYVILLE, CA
The SMARTag TM ADC Technology Platform
The SMARTag TM ADC Technology Platform 2 3 4 World Class Protein Production Capability New State of the Art Facility Madison, WI Expanded GPEx Cell Line Engineering capacity Flexible Non cgmp production
More informationCreating Highly Efficacious ADCs for Low-Expression Targets While Improving Therapeutic Index TIM LOWINGER, PHD
Creating Highly Efficacious ADCs for Low-Expression Targets While Improving Therapeutic Index TIM LOWINGER, PHD CSO Mersana Therapeutics VC-backed Biotech in Cambridge, MA Investors: NEA, Pfizer, Fidelity,
More informationXpress CF+ : A Cell-Free Platform for the Rapid Screening and Production of Homogeneous ADCs
Xpress CF+ : A Cell-Free Platform for the Rapid Screening and Production of Homogeneous ADCs Alexander R. Steiner, M.S. Director, Protein Biochemistry Tuesday Feb 3 rd, 215 Making novel drugs is Pammolli
More informationDevelopment and Manufacture of a Novel Drug- Linker: Enabling High DAR ADCs. Michael J Kaufman, Ph.D. Senior Vice President, CMC
Development and Manufacture of a Novel Drug- Linker: Enabling High DAR ADCs Michael J Kaufman, Ph.D. Senior Vice President, CMC Legal Disclaimer This presentation contains forward-looking statements that
More informationChallenges in Bioassay Development for ADCs and Their Utility for Measuring In-vitro Activity of Conjugate Variants
Challenges in Bioassay Development for ADCs and Their Utility for Measuring In-vitro Activity of Conjugate Variants Sonia Connaughton, Ph.D. Senior Scientist, Bioanalytical Science Bioassays 214: Scientific
More informationAntibody-Drug Conjugates The Road to the Current State. Nila Das, Ph.D. American Drug Delivery & Formulation Summit San Diego, CA June 13, 2016
Antibody-Drug Conjugates The Road to the Current State Nila Das, Ph.D. American Drug Delivery & Formulation Summit San Diego, CA June 13, 2016 1 Current Status of ADCs C&E News. 2014, 92(3): 13-21 2 Current
More informationVELTIS : INNOVATIVE ALBUMIN BASED TECHNOLOGY FOR HALF- LIFE EXTENSION AND OPTIMIZATION OF BIOTHERAPEUTICS
VELTIS : INNOVATIVE ALBUMIN BASED TECHNOLOGY FOR HALF- LIFE EXTENSION AND OPTIMIZATION OF BIOTHERAPEUTICS Dr Mikael Bjerg Caspersen Industrial Biotechnology Conference August 10 th 2015 INNOVATIVE TECHNOLOGY
More informationAntibody-drug Conjugates: Characterization and Control Strategies of Lysine-linked Products
Antibody-drug Conjugates: Characterization and Control Strategies of Lysine-linked Products Fred Jacobson Protein Analytical Chemistry Genentech, Inc. CASSS CMC Strategy Forum Japan 2013 December 9-10,
More informationADCS, WHAT IS INDUSTRY DOING TODAY? AN OVERVIEW
ADCS, WHAT IS INDUSTRY DOING TODAY? AN OVERVIEW Johannes Stanta PhD Scientific Manager, Bioanalysis EBF ADC Training day June 2017 Copyright 2017 Covance. All Rights Reserved ADC Bioanalytical PK Assays
More informationTowards an in vivo Stability Assay for ADCs and Their Metabolites in Serum by Affinity Capture LC-MS
Towards an in vivo Stability Assay for ADCs and Their Metabolites in Serum by Affinity Capture LC-MS mz (@Dr_mz13), PhD 11-Feb-2013 One of the challenges of ADCs includes the development of a method to
More informationAntibody Targeted Amanitin Conjugates (ATACs) Expanding the ADC Landscape With a New Payload Targeting RNA Polymerase II
Antibody Targeted Amanitin Conjugates (ATACs) Expanding the ADC Landscape With a New Payload Targeting RNA Polymerase II ADC Summit 2016 San Diego Andreas Pahl CS Heidelberg Pharma GmbH Ladenburg, Germany
More informationWorkshop F: Linker Design: Why so complex?
Genomics Institute of the Novartis Research Foundation Workshop F: Linker Design: Why so complex? Bernhard Geierstanger October 10, 2016 Antibody Drug Conjugates Novel targets & Biology Diverse set of
More informationIntra-tumor Catabolites (fate of ADC) can Predict ADC Efficacy. Donglu Zhang, Ph.D. Genentech Feb 21, 2017 World ADC Berlin-2017
Intra-tumor Catabolites (fate of ADC) can Predict ADC Efficacy Donglu Zhang, Ph.D. Genentech Feb 21, 2017 World ADC Berlin-2017 1 Outline ADC structure and mechanism of action (MOA) Can we use PK or PK-PD
More informationOncology Product and Platform Partnering Opportunity
Protein Medicinal Chemistry with an Expanded Genetic Code Oncology Product and Platform Partnering Opportunity April 2017 Ambrx has Made Advances in Proprietary Platform and Titer while Achieving Clinical
More informationBench-to-Bedside Translation of ADCs using PK/PD M&S. Dhaval K. Shah, Ph.D.
Bench-to-Bedside Translation of ADCs using PK/PD M&S Dhaval K. Shah, Ph.D. dshah4@buffalo.edu 8/23/2016 Outline Overview: ADCs Prediction of Clinical Efficacy using a Multi-Scale Mechanistic PK/PD Model
More informationImmunogenicity Assay Strategies for Antibody-Drug Conjugates
Immunogenicity Assay Strategies for Antibody-Drug Conjugates 8th World ADC Conference, San Diego 20 Sep 2017 Seema Kumar, PhD Associate Scientific Director Global Early Development (GED) EMD Serono Research
More informationThe Promise of DARPins for Site-Specific Drug Conjugation & Pharmacokinetic Optimization
Department of Biochemistry The Promise of DARPins for Site-Specific Drug Conjugation & Pharmacokinetic Optimization Fabian Brandl, Plückthun Group, University of Zurich / University of Bern World ADC Berlin,
More informationRapid Development and Manufacture of ADC's- Integration of Antibody and ADC Process Development and Optimisation"
Rapid Development and Manufacture of ADC's- Integration of Antibody and ADC Process Development and Optimisation" Bo Kara, Director Science and Technology Fujifilm Diosynth Biotechnologies, UK Biomanufacturing
More informationPreclinical to Clinical Translation of Antibody Drug Conjugates
Preclinical to Clinical Translation of Antibody Drug Conjugates Robert Lutz, PhD Crescendo Biopharma Consulting World ADC Summit Berlin 2016 1 Bio ImmunoGen 23 years Researcher in cell death and survival
More informationRecombinant Antibody Production in Therapeutic Antibody Projects. Keshav Vasanthavada Senior Marketing Specialist, GenScript April 7, 2016
Recombinant Antibody Production in Therapeutic Antibody Projects Keshav Vasanthavada Senior Marketing Specialist, GenScript April 7, 2016 Presentation Outline 1 2 3 4 5 Introduction Recombinant Ab Production
More informationANTIBODY DRUG CONJUGATES AND BISPECIFIC ANTIBODIES: SCIENTIFIC & REGULATORY CHALLENGES AND OPPORTUNITIES
ANTIBODY DRUG CONJUGATES AND BISPECIFIC ANTIBODIES: SCIENTIFIC & REGULATORY CHALLENGES AND OPPORTUNITIES Brian DiPaolo 08 June 2017 CASSS Midwest Discussion Group Agenda Introduction Antibody Drug Conjugates
More informationPredicting Clinical Success of ADCs using a Mechanistic Modeling & Simulation Approach
Predicting Clinical Success of ADCs using a Mechanistic Modeling & Simulation Approach Alison Betts Translational Modeling & Simulation Biomedicine Design Department Pfizer Worldwide R&D, Cambridge MA
More informationThermo Scientific MAbPac HIC Columns. Novel Hydrophobic Interaction HPLC Columns. Designed for Monoclonal Antibody Analysis
Thermo Scientific MAbPac HIC Columns Novel Hydrophobic Interaction HPLC Columns Designed for Monoclonal Antibody Analysis Introduction The Thermo Scientific MAbPac HIC column family is designed for separations
More informationAddressing challenges of targeting the macrophage checkpoint, CD47. Marie Kosco-Vilbois, PhD CSO
Addressing challenges of targeting the macrophage checkpoint, CD47 Marie Kosco-Vilbois, PhD CSO 1 CD47 is an immune checkpoint Cancer cell Macrophage Activating eat me signal CD47 Inhibitory don t eat
More informationPLANNING FOR SUCCESS: A CMC STRATEGY FOR BIOSIMILARS
PLANNING FOR SUCCESS: A CMC STRATEGY FOR BIOSIMILARS Louise Angell Lead Scientist 10th Biosimilars & Follow-On Biologics Congregation 9 th May 2017 Copyright @ 2017 Covance. All rights Reserved Overview
More informationConjugation site modulates the in vivo stability and therapeutic activity of antibody conjugates
Conjugation site modulates the in vivo stability and therapeutic activity of antibody conjugates Ben-Quan Shen*, Keyang Xu*, Luna Liu, Helga Raab, Sunil Bhakta, Margaret Kenrick, Kathryn L. Parsons-Reponte,
More informationSite-Specific Protein Conjugation as an ADC Optimization Tool
Site-Specific Protein Conjugation as an ADC ptimization Tool livier Laurent, Ph.D. Vice President, Ambrx AAPS 2014 Conference Ambrx Quick Facts perations San Diego, California-based biopharmaceutical company
More informationExpert Consensus on Quality Control and Preclinical Evaluation of Antibody-Drug Conjugates
Expert Consensus on Quality Control and Preclinical Evaluation of Antibody-Drug Conjugates National Institutes for Food and Drug Control July 20 th, 2018 Contents 1. Overview... 3 2. Manufacturing... 4
More informationAntibody-Drug Conjugate Characterization and Quality Assurance
Antibody-Drug Conjugate Characterization and Quality Assurance Sarah Kennett Division of Monoclonal Antibodies Office of Biotechnology Products OPS/CDER/FDA October 12, 2011 1 Disclaimer The views and
More informationAntibody-Drug Conjugate Bioanalytical Assay Development:
Antibody-Drug Conjugate Bioanalytical Assay Development: Immunogenicity Challenges November 16, 2016 Presented by Corinna Fiorotti, Ph.D. Presentation Overview ADC Overview ADC Assays ADC Immunogenicity
More information6 th EBF Open meeting, Barcelona November 21st, 2013
Validation of an immunoassay to selectively quantify the naked antibody of a new Sanofi Antibody Drug Conjugate: an additional tool for improvement of PK interpretation 6 th EBF Open meeting, Barcelona
More informationStreamline Your Antibody Enrichment Using Scalable Magnetic Bead-Based Chemistries
Streamline Your Antibody Enrichment Using Scalable Magnetic Bead-Based Chemistries Samantha Lewis, Ph.D. 2013. Webinar Outline Introduction Magnetic Bead-Based Method Overview Scalability Chemistries o
More informationColumns for Biomolecules BioLC Column Lines
Columns for Biomolecules BioLC Column Lines Monoclonal Antibodies Glycans GlycanPac Nucleic Acids DNAPac Protein A Accucore Amide-HILIC DNAPac PA1 SEC-1 GlycanPac AXH-1 DNAPac PA2 SCX-1 GlycanPac AXR-1
More informationAbGn-107, an ADC Targets Gastrointestinal Tumors
AbGn-107, an ADC Targets Gastrointestinal Tumors For a Healthier Life Presented by Ron Lin Feb. 22, 2016 All Rights reserved AbGenomics International Inc. 4966 El Camino Real, Suite 200, Los Altos, CA
More informationOverview of the Antibody Drug Conjugate Landscape Godfrey Amphlett WCBP CMC Strategy Forum January 24, 2010
Overview of the Antibody Drug Conjugate Landscape Godfrey Amphlett WCBP CMC Strategy Forum January 24, 2010 Outline of Talk What is an Antibody Drug Conjugate (ADC)? Rationale for developing ADC s What
More informationMonitoring Charge Heterogeneity of Antibody-Maytansinoid Conjugates (AMC) with icief
Monitoring Charge Heterogeneity of Antibody-Maytansinoid Conjugates (AMC) with icief Joyce Lin, Rajesh Krishnamurthy, Alexandru Lazar ImmunoGen, Inc., Waltham, MA CE Pharm 2008 utline I. Introduction of
More informationIdentification of Critical Product Quality Attributes: Impact of Product Variants on Safety and Efficacy
Identification of Critical Product Quality Attributes: Impact of Product Variants on Safety and Efficacy Ziping Wei, Ph.D. Analytical Biochemistry MedImmune January 25, 2010 Outline Why do we need to identify
More informationComparability Analysis of Protein Therapeutics by Bottom-Up LC-MS with Stable Isotope-Tagged Reference Standards
Comparability Analysis of Protein Therapeutics by Bottom-Up LC-MS with Stable Isotope-Tagged Reference Standards 16 September 2011 Abbott Bioresearch Center, Worcester, MA USA Manuilov, A. V., C. H. Radziejewski
More informationJohn Mehl, Bogdan Sleczka, Eugene Ciccimaro, Christian Caporuscio, Ekaterina Deyanova, Richard Huang, Timothy Olah, Celia D Arienzo
Bioanalytical strategies for the quantitation of in-vivo site specific modifications of therapeutic antibodies in early discovery cyno studies using IP-LC-MS John Mehl, Bogdan Sleczka, Eugene Ciccimaro,
More informationWhat s the difference? Challenges in pre-clinical development of biologics
Biologics vs Small MW NCEs What s the difference? Challenges in pre-clinical development of biologics Peter Lloyd Joint Conference of EU Human Pharmacological Societies and 20 th Anniversary of AGAH 31
More informationImmunogenicity of Therapeutic Proteins. Steven J Swanson, Ph.D. Executive Director, Clinical Immunology
Immunogenicity of Therapeutic Proteins Steven J Swanson, Ph.D. Executive Director, Clinical Immunology swanson@amgen.com Causes of Immunogenicity Sequence differences between therapeutic protein and endogenous
More informationThe Trianni Mouse: Best-In-Class Technology for Human Antibody Discovery
The Trianni Mouse: Best-In-Class Technology for Human Antibody Discovery Corporate Overview Co David Meininger, PhD, MBA Chief Business Officer, Trianni 1 Our Mission Trianni is a biotech company with
More informationExceptional Human Antibody Discovery. Corporate Overview
Exceptional Human Antibody Discovery Corporate Overview Co 1 1 Our Mission Trianni is a biotech company with the scientific mission of creating optimized and highly versatile platforms for generation of
More informationPaving the way for Non-Clinical Bioanalytical Partnerships Louise Angell
Paving the way for Non-Clinical Bioanalytical Partnerships Louise Angell Content Overview of non-clinical immunogenicity testing for biologics Regulatory guidance Bioanalytical considerations Risk based
More informationAdvanceBio HIC: a Hydrophobic HPLC Column for Monoclonal Antibody (mab) Variant Analysis
Application Note Biologics Development AdvanceBio HIC: a Hydrophobic HPLC Column for Monoclonal Antibody (mab) Variant Analysis Using the Agilent 16 Infinity II Bio-Inert LC Authors Andrew Coffey and Sandeep
More informationCloudbreak: Antibody-Drug Conjugates for Treatment of MDR Gram-Negative Bacterial Infections
Cloudbreak: Antibody-Drug Conjugates for Treatment of MDR Gram-Negative Bacterial Infections James C. Levin, Ph.D. Director of Preclinical Development Discovery on Target Conference September 26, 2018
More informationRapidly Characterize Antibody- Drug Conjugates and Derive Drug-to-Antibody Ratios Using LC/MS
Rapidly Characterize Antibody- Drug Conjugates and Derive Drug-to-Antibody Ratios Using LC/MS Ning Tang, Ph.D. Agilent Technologies Santa Clara, California, USA Heterogeneity in ADCs Complexity T-DM1 (Genentech)
More informationSubmission preparation what to watch out for
Submission preparation what to watch out for EBF 2017 Boris Gorovits AAPS BIOTEC section Pfizer June 2017 Analytes Commonly Assessed for ADC PK Unconjugated Drug analyte Total Antibody analyte Conjugated
More informationmab quantification in preclinical tissue supports in vitro potency/in vivo efficacy correlations
mab quantification in preclinical tissue supports in vitro potency/in vivo efficacy correlations John T. Mehl, Ph.D. Bioanalytical Research Princeton, NJ AAPS November 4, 2014 San Diego, CA 1 LC-MS/MS
More informationAntibody Services from GenScript
Services from GenScript www.genscript.com GenScript USA Inc. 860 Centennial Ave., Piscataway, NJ 08854 USA Toll-Free: 1-877-436-7274 Fax: 1-732-210-0262 1-732-855-5878 Academic Services Pharmaceutical
More informationAdvanced Characterization of Antibody Drug Conjugates (ADCs) by Liquid Chromatography and Mass Spectrometry (LC/MS) John Gebler, Ph.D.
Advanced Characterization of Antibody Drug Conjugates (ADCs) by Liquid Chromatography and Mass Spectrometry (LC/MS) John Gebler, Ph.D. Director www.waters.com/adc 2015 Waters Corporation 1 2015 Waters
More informationChallenges in Developing a Neutralizing Antibody Assay for a Cyno Toxicology Study
Challenges in Developing a Neutralizing Antibody Assay for a Cyno Toxicology Study Robin Marsden, Sr. Mgr., Bioanalytical Sciences, La Jolla Pharmaceutical Co. Kristine de Dios, M.S., Scientist, Preclinical
More informationBiochromatography Bring more Zen into your life and laboratory
Seminar Biochromatography Bring more Zen into your life and laboratory Method development and maintaining peptide, protein, glycan and anti-body analyses by LC or LC-MS can be very time consuming and might
More informationRecent advances in the synthesis of antibody-drug conjugates
Recent advances in the synthesis of antibody-drug conjugates Author list and affiliations Vijay Chudasama*, Antoine Maruani and Stephen Caddick* Department of Chemistry, University College London, 20 Gordon
More informationDevelopment and Characterization of Multi-Platform Antibody Drug Conjugates
Development and Characterization of Multi-Platform Antibody Drug Conjugates Jason A. Starkey Senior Principal Scientist - BioTherapeutics Pharmaceutical Sciences Pfizer, Inc. This document provides an
More informationACCELERATE YOUR ANTIBODY DRUG DISCOVERY & DEVELOPMENT
ACCELERATE YOUR ANTIBODY DRUG DISCOVERY & DEVELOPMENT Since 2004, GenScript has been customizing antibodies for widespread applications. Our team has experience with over 150 antibody drug discovery projects.
More informationAntibody Generation: challenges and solutions. Glen Marszalowicz, PHD May 10, AM
Antibody Generation: challenges and solutions Glen Marszalowicz, PHD May 10, 2015 9AM GenScript the most cited biology CRO CRISPR Services Gene Services Peptide Services Protein Services Antibody Services
More informationphab Amine and Thiol Reactive Dyes for Antibody Internalization Studies Nidhi Nath, Ph.D. Group Leader, Protein Analysis Promega Corporation
phab Amine and Thiol Reactive Dyes for Antibody Internalization Studies Nidhi Nath, Ph.D. Group Leader, Protein Analysis 1 Outline 1. phab Dyes 2. Protocols for conjugating phab Dyes to antibodies 3. Applications:
More informationLocalized Higher Order Structures of mabs and ADCs Investigated by MS-based Protein Footprinting
Localized Higher Order Structures of s and ADCs Investigated by MS-based Protein Footprinting Lucy Pan, John Valliere-Douglass and Oscar Salas-Solano 6 th International Symposium on the Higher Order Structure
More informationNUVEC. Non-viral adjuvant delivery system for vaccines and cancer treatments. Allan Hey, Head of CMC, N4 Pharma Ltd
NUVEC Non-viral adjuvant delivery system for vaccines and cancer treatments Allan Hey, Head of CMC, N4 Pharma Ltd 1 N4 Pharma plc o Established in 2014 o Listed on Alternative Investment Market (AIM) in
More informationSupplementary Methods Antibodies for flow cytometry Cytotoxicity assay
Supplementary Methods Antibodies for flow cytometry HLA-Cw3 and CD2 expression: LCL 72.22 cell lines were stained with anti-hla-abc-apc (clone G46-2.6, BD) or migg-apc (clone MOPC-2, BD) antibody, or with
More informationFlock House virus VLPs as a tool in structure-based vaccine design. Malaria VLP Development Workshop September 23, 2009
Flock House virus VLPs as a tool in structure-based vaccine design Malaria VLP Development Workshop September 23, 2009 Flock House virus X-ray structure solved at 2.8 Å resolution Particle diameter 35
More informationBiosimilar Monoclonal Antibodies: Registration Requirements. Henry M. J. Leng
Biosimilar Monoclonal Antibodies: Registration Requirements Henry M. J. Leng Disclaimer This presentation is given in my personal capacity and represents only the author s personal views and does not represent
More informationInfectious Disease Programs:
Infectious Disease Programs: Valortim (MDX-133) Fully Human Anti-Anthrax Toxin MAb Candidate for Project BioShield Procurement Israel Lowy, M.D., Ph.D. Senior Director, Clinical Science and Infectious
More informationSupporting Information
Supporting Information Chan et al. 10.1073/pnas.0903849106 SI Text Protein Purification. PCSK9 proteins were expressed either transiently in 2936E cells (1), or stably in HepG2 cells. Conditioned culture
More informationAptevo Therapeutics. ADAPTIR TM Platform: Rapid Development of Novel Protein Therapeutics. World Bispecific Summit Boston, MA September 28, 2017
Aptevo Therapeutics ADAPTIR TM Platform: Rapid Development of Novel Protein Therapeutics World Bispecific Summit Boston, MA September 28, 2017 Peter Pavlik Principal Scientist Agenda Overview of ADAPTIR
More informationOvercoming drug & target interference in ADA and nabassays
Overcoming drug & target interference in ADA and nabassays Robert Nelson Ph.D. MRQA Head of Bioanalytical Laboratory, Novimmune SA 1 Presentation Outline Case Study 1 Drug & target interference in a clinical
More informationThe Complete Solution: Althea s Simplified ADC Supply Chain
The Complete Solution: Althea s Simplified ADC Supply Chain You have the power to make a difference. To make new therapeutics that improve quality of life and inspire a healthier world. To do this, you
More informationSize Exclusion Chromatography/ Mass Spectrometry Analysis of Antibody Drug Conjugates Using the Agilent 1260 Infinity II Bio-Inert LC
Size Exclusion Chromatography/ Mass Spectrometry Analysis of Antibody Drug Conjugates Using the Agilent 126 Infinity II Bio-Inert LC Application Note Biologics & Biosimilars Author Sonja Schneider Agilent
More informationmabs and ADCs analysis by RP
mabs and ADCs analysis by RP Shanhua Lin, Ph.D. The world leader in serving science Protein and mab Separation by HPLC Size difference? YES Size Exclusion Chromatography (SEC) MAbPac SEC-1 NO NO Charge
More informationUNLEASH THE POWER OF PRECISION MEDICINE
FROM BENCH TO BEDSIDE UNLEASH THE POWER OF PRECISION MEDICINE DCB, pioneer in biotech. Your partner in drug discovery. www.dcb.org.tw The Center for Biotechnology With over 400 dedicated researchers and
More informationStrategies to Improve Drug Tolerance in Nab Assays
Strategies to Improve Drug Tolerance in Nab Assays Steven J Swanson, PhD Senior Vice President, Research ImmunoCellular Therapeutics Ltd steven.swanson@imuc.com AAPS National Biotech Conference June 2015
More informationDevelop A Highly Similar" Biosimilar Compound: Lessons Learnt
Develop A Highly Similar" Biosimilar Compound: Lessons Learnt Hui-Chun Li, Ph.D. Sr. Manager of Process Science 2015 Feb 05 3rd Biologics World Taiwan 2015 SPIN OFF ACQUISITION Development Center for Biotechnology
More informationAffimer Biotherapeutics: The preclinical development and validation of a PD-L1 antagonist in mouse
Affimer Biotherapeutics: The preclinical development and validation of a PD-L1 antagonist in mouse NGPT San Diego, 6 th June 2017 Amrik Basran Chief Scientific Officer Avacta Life Sciences Avacta Life
More informationDiscovery and Humanization of Novel High Affinity Neutralizing Monoclonal Antibodies to Human IL-17A
Discovery and Humanization of Novel High Affinity Neutralizing Monoclonal Antibodies to Human IL-17A Contacts: Marty Simonetti martysimonetti@gmail.com Kirby Alton kirby.alton@abeomecorp.com Rick Shimkets
More informationS9 Implementation Working Group ICH S9 Guideline: Nonclinical Evaluation for Anticancer Pharmaceuticals Questions and Answers
S9 Implementation Working Group ICH S9 Guideline: Nonclinical Evaluation for Anticancer Pharmaceuticals Questions and Answers Current version dated 8 June 2016 International Council for Harmonisation of
More informationTrubion Investor Presentation BioCentury NewsMakers in the Biotech Industry Conference September 6, 2007
Trubion Investor Presentation BioCentury NewsMakers in the Biotech Industry Conference September 6, 2007 Peter Thompson, M.D., FACP President, CEO and Chairman Trubion Pharmaceuticals, Inc. Safe Harbor
More informationPrecise Characterization of Intact Monoclonal Antibodies by the Agilent 6545XT AdvanceBio LC/Q-TOF
Precise Characterization of Intact Monoclonal Antibodies by the Agilent 6545XT AdvanceBio LC/Q-TOF Application Note Author David L. Wong Agilent Technologies, Inc. Santa Clara, CA, USA Introduction Monoclonal
More informationSolutions for Your Research
Solutions for Your Research Custom Antibody Services Polyclonal Monoclonal The service we offer is very complete starting from rabbits, mice and rats. The different formats provided by Primm depend on
More informationWhy do LC MS and LBA
Why do LC MS and LBA results differ? A literature evaluation 18 November 2015 Nico van de Merbel An overview In most published BA methods for large molecules, no comparison of platforms (LBA vs LBA, LBA
More informationImmunogenicity Assay Considerations
Immunogenicity Assay Considerations Jochem Gokemeijer Jochem.gokemeijer@bms.com Bioassays and Bioanalytics Method Development, Berkley CA October 8 th 2013 Multi Tiered Immunogenicity Assay Approach Screening
More informationJefferies Healthcare Conference. June 2016
Jefferies Healthcare Conference June 2016 Forward Looking Statements This presentation contains forward-looking statements for purposes of the safe harbor provisions of the Private Securities Litigation
More informationProteoGenix. Life Sciences Services and Products. From gene to biotherapeutics Target Validation to Lead optimisation
ProteoGenix Life Sciences Services and Products From gene to biotherapeutics Target Validation to Lead optimisation ProteoGenix Philippe FUNFROCK, founder and CEO French company located in Strasbourg,
More informationThe World Leader in SPR Technology. Jimmy Page, PhD, Biacore, Inc.
The World Leader in SPR Technology Jimmy Page, PhD, Biacore, Inc. Objectives of Biacore Experiments Yes/No Data» Is there binding?» Ligand Fishing Concentration Analysis: How MUCH? Active Concentration
More informationCase Studies on ultra-sensitive immunoanalytics based on Imperacer (Immuno-PCR) in clinical settings. Jan Detmers, Ph.D. (Chimera Biotec GmbH)
Case Studies on ultra-sensitive immunoanalytics based on Imperacer (Immuno-PCR) in clinical settings. Jan Detmers, Ph.D. (Chimera Biotec GmbH) Agenda 1.Overview Platforms 2.Immuno-PCR (Imperacer ) Technology
More informationSupplement Figure 1. Characterization of the moab. (A) A series of moabs that are anti-hαiib-specific were tested for their ability to bind to
Supplement Figure 1. Characterization of the 312.8 moab. (A) A series of moabs that are anti-hαiib-specific were tested for their ability to bind to platelets. The black line represents the 312.8 moab
More informationNeutralising Assay Methodologies
Neutralising Assay Methodologies March 9 th, 2016 EMA workshop on immunogenicity assessment of biotechnology derived therapeutic proteins Shalini Gupta, PhD Amgen Inc. shalinig@amgen.com 1 Key Points About
More informationAntibody drug conjugate screening and characterization
Antibody drug conjugate screening and characterization Simple and effective tools for monitoring antibody internalization Antibody drug conjugates Visual confi rmation of internalization Over the past
More information06/03/2009. Overview. Preclinical Support for Exploratory Phase I Clinical Trials. Micro-dosing IND. Pharmacological Active Single Dose IND
Preclinical Support for Exploratory Phase I Clinical Trials Clive Joseph, DSRD Sandwich Overview Identify the most appropriate development paradigm - traditional vs alternative IND approach Confidence
More informationImplementation of the Next Generation Effector Function Assays for Comparability Assessments
Implementation of the Next Generation Effector Function Assays for Comparability Assessments March 25, 2014 Poonam Aggarwal Bioassays 2014: Scientific Approaches & Regulatory Strategies to be held March
More informationDDI Assessment for Therapeutic Proteins and ADCs
DDI Assessment for Therapeutic Proteins and ADCs Elimika Pfuma Fletcher, PharmD, PhD Policy Lead Guidance and Policy Team Office of Clinical Pharmacology CDER/FDA 06/21/2017 DDI- 2017 International Conference
More informationSupplemental Material TARGETING THE HUMAN MUC1-C ONCOPROTEIN WITH AN ANTIBODY-DRUG CONJUGATE. Supplemental Tables S1 S3. and
Supplemental Material TARGETING THE HUMAN MUC1-C ONCOPROTEIN WITH AN ANTIBODY-DRUG CONJUGATE Supplemental Tables S1 S3 and Supplemental Figures S1 S10 Supplemental Table S1. PK Parameters for MAb-3D1-MMAE
More informationApplying Affimers. Dr Amanda Nicholl at Avacta Life Sciences. Improving Antibody PK Assay Development
Improving Pharmacokinetic Assays in a Regulatory Bioanalysis Setting Applying Affimers With an increasing number of antibody-based therapeutics entering the clinic, the need for validated anti-idiotypic
More informationMake Your Immunology Research Easy. Kun YIN Associate Director of Marketing Division, GenScript
Make Your Immunology Research Easy Kun YIN Associate Director of Marketing Division, GenScript GenScript Overview Branch Office Amsterdam, Netherlands Branch Office Tokyo, Japan Headquarter, New Jersey,
More informationStrategy for Selecting NAb Assay Format
Strategy for Selecting NAb Assay Format European Bioanalysis Forum 27Sept2016 Jim McNally, Ph.D. Associate Director, Global Early Development Head of Clinical Bioanalytics Merck KGaA AAPS Working Group
More informationVladimir Hanes, MD, USA
GaBI Educational Workshops 20 January 2015, Sheraton Maria Isabel Hotel & Towers, Mexico City, Mexico Vladimir Hanes, MD, USA Medical Director, Oncology Global Biosimilars Development, Amgen Inc GaBI Educational
More informationSupplementary Figure 1. Determination of the purity of CP. a, SDS-PAGE of CP and CP- PTX conjugate, and b, HPLC trace of purified CP.
Supplementary Figure 1. Determination of the purity of CP. a, SDS-PAGE of CP and CP- PTX conjugate, and b, HPLC trace of purified CP. Supplementary Figure 2. Synthesis of CP-PTX conjugate. Supplementary
More informationApplications of HTRF and Tag-lite Assays for HTP Antibody Screening
Applications of HTRF and Tag-lite Assays for HTP Antibody Screening Brigitte Devaux, PhD Bristol Myers Squibb, Redwood City CA HTRF Symposium April 25, 2013 1 Introduction Generate human therapeutic antibodies
More informationOptimization of ADC Process Development. Eric LACOSTE PhD, Chemistry and Biotechnology Development Sanofi Aventis R&D, Vitry sur Seine, France 2016
Optimization of ADC Process Development Eric LACOSTE PhD, Chemistry and Biotechnology Development Sanofi Aventis R&D, Vitry sur Seine, France 2016 Strictly confidential do not distribute without prior
More informationUnique PK-PD properties of biotechnology-based therapeutics [mabs] and First In Human dose considerations. [mabs -monoclonal antibodies ] Peter Lloyd
Unique PK-PD properties of biotechnology-based therapeutics [mabs] and First In Human dose considerations [mabs -monoclonal antibodies ] Peter Lloyd Head of Pharmacokinetics-Pharmacodynamics Novartis Biologics
More information