Chicken EpithelialGut CellLines 1
|
|
- Andra Hensley
- 6 years ago
- Views:
Transcription
1 Chicken EpithelialGut CellLines 1
2 Content 01 Introduction p 3 02 Characterization p 5 03 Infection and inhibition p 6 04 Protein expression system p 8 05 NutriProof p Contact p 12
3 01...which came first, the chicken or the egg? But seriously, with the primary goal to analyze infection processes in the avian gut system, we decided to generate chicken enterocyte cell lines. Using eggs from specific pathogen-free white Leghorn hens as a source we isolated cells out of the guts (intestine and caecum) of 18- day old embryonic chicken and subjected them to a specialized procedure of plating, growth factor treatment and genetic transformation. Step I Step II Step III Figure 1: Generation process of epithelial chicken gut cell lines from egg to characterized cell clones. In the end we succeeded in isolating more than 240 individual continuously growing epithelial clones representing as judged by eye - at least 5 different epithelial morphotypes. According to their growth characteristics, 12 of these clones were subjected to further studies. The avian origin as well as the epithelial phenotype could be confirmed by the use of marker-specific antibodies. Altogether, we present here the largest collection of chicken epithelial gut cell lines worldwide. 3
4 Figure 2: Chicken cell line 9E6 was stained with cadherin (green). The nucleus was stained with DAPI (blue). 4
5 02 Characterization Cells were characterized with different markers for intestinal epithelium by Western Blot or immunofluorescence (Fig. 2). The chicken origin was confirmed with chicken MHC I antibodies and the karyogram of the cells. Furthermore, the physiological function of chicken cells was checked by interleukin 6 and 8 expression upon stimulation(tab. 1). Characterization by expression Characterization by function cell clone Villin E-cadherin Cytokeratin LPS stimulation Campylobacter infection 8E11 X X X 9E6 X X X 2G4 X X X 10F6 X X X Inductionof IL6 + IL8 (K60) Inductionof IL6 + IL8 (K60) Inductionof IL6 + IL8 (K60) Inductionof IL6 + IL8 (K60) Invasive Highly invasive Invasive Invasive 10B3 X X X u.i.* u.i.* 8E8 X X u.i.* u.i.* u.i.* 9E5 X X u.i.* u.i.* u.i.* 5F6 X X X u.i.* u.i.* 6D2 X u.i.* u.i.* u.i.* u.i.* 9E7 X u.i.* X u.i.* u.i.* 8G8 X X X u.i.* Invasive 6E4 X X X u.i.* u.i.* Table 1: Overview of the characterization of different chicken cell lines. *under investigation 5
6 03 Infection and inhibition A subset of the established chicken gut cell lines has been tested according to its susceptibility (adhesiveness and invasiveness) to various Campylobacter and Salmonella strains. As figures 3-5 illustrate, Campylobacter and Salmonella strains exhibited a distinct potential to infect chicken gut cells. cfu/ml adenocarcinoma cell line Caco-2, which still serves as the most commonly used epithelial gut cell model. 8,00E+05 7,00E+05 6,00E+05 5,00E+05 4,00E+05 3,00E+05 Comparison of chicken gut cell line 8E11 and human Caco-2 cells according to their adhesiveness to Campylobacter jejuni strain cfu/ml 7,00E+05 6,00E+05 5,00E+05 4,00E+05 3,00E+05 2,00E+05 1,00E+05 Comparison of chicken gut cell line 8E11 and human Caco-2 cells according to their susceptibility to Salmonella typhimurium Chicken Caco-2 2,00E+05 1,00E+05 0,00E Time of infection (h) Figure 4: Campylobacter(C. jejuni strain 11168) showed stronger adhesiveness to chicken 8E11 cells compared to human Caco-2 cells. 7,00E+04 6,00E+04 Comparison of chicken gut cell line 8E11 and human Caco-2 cells according to their invasiveness to Campylobacter jejuni strain ,00E+00 3h S. Typhimurium Figure 3: Chicken 8E11 cells showed a higher susceptibility to S. typhimurium compared to human Caco-2 cells (cfu = colony forming units). 6h cfu/ml 5,00E+04 4,00E+04 3,00E+04 Both, Campylobacter jejuni and Salmonella enterica showed higher invasiveness for chicken cells compared to the human colorectal 2,00E+04 1,00E+04 0,00E Time of infection (h) Figure 5: Campylobacter(C. jejuni strain 11168) showed stronger invasiveness for chicken 8E11 cells compared to human Caco-2 cells. 6
7 Using this platform, a powerful in vitro model for the analysis of Campylobacter and Salmonella infection processes was established. This model is also applicable to evaluate novel inhibitors of infection, as we demonstrated with carvacrol, known as an inhibitor of bacterial infection processes. In this context, MicroMol offers its experience to analyze food additives and other substances according to their inhibitory potential. Relying on our expertise, it is also possible to adopt the system onto further infection systems according to clients demands. Inhibition of Campylobacter infection (C. jejuni strain ) with Carvacrol Percentage of inhibition compared to control control 0.1 mm 0.05 mm 0 Adhesion Invasion Figure 6: Carvacrol inhibited the adhesion and invasion of C. jejuni strain on chicken 8E11 cells. 7 Figure 7: The chicken cell line 8E11 was infected with Salmonella for 3 h. Salmonella is stained green. The cells were stained with cadherin (red) and the nuclei with DAPI (blue).
8 04 A novel protein expression system The remarkable expression level upon transfection, the specific pathogen-free origin and cryopreservation in early passages are attributes that qualify chicken cell clone 8E11 as an optimal means for expression of recombinant proteins. Experiments performed in the MicroMol laboratory indicate that expression levels are comparable - and in certain cases even higher - than that of the typical standard cell lines (HEK 293, HEK 293T, CHO- K1) used for recombinant protein production. In addition, the chicken clone 8E11 can be used for the propagation of defined virus strains using the avian environment for replication. Recombinant proteins can be produced in chicken cell line 8E11 upon transfection. The indicated cell lines were transfected with cdnas coding for a recombinant murine antibody. After 24 hours, supernatants were subjected to Protein G purification. Eluates thereof were analyzed by SDS-PAGE/ Western Blot (Fig. 8). Transfection of WT1 HEK HEK Chicken CHO 293T 293 8E11 K1 Figure 8: Western Blot analysis of WT1 protein expressed in standard expression cell lines and chicken clone 8E11. Furthermore, an expression vector coding for the human WT1 protein was transfected in the indicated standard expression cell lines as well as in the chicken clone 8E11. After 24 hours cells were harvested, lysates were prepared and aliquots derived thereof were analyzed by SDS-PAGE/ Western Blot (Fig. 9). Transfection of hqbeta3 HEK HEK CHO Chicken 293T 293 K1 8E11 Figure 9: Western Blot analysis of hqbeta3 protein expressed in standard expression cell lines and chicken clone 8E11. 8
9 Features: Expression in a eukaryotic cell system derived from embryonic tissue of specific pathogen-free(spa) origin Expression in cell clones available in early passages Cells easy to expand to high cell numbers Easy transfection with various protocols and systems High expression levels comparable or even better than standard models HEK293 and CHO-K1 9 Figure 10: Comparative Western Blot analysis between chicken gut cell line (clone 8E11) and HEK 293, HEK293T and CHO K1.
10 05 Further A novel Applications testing system - Protein NutriProof Expression Using the term NutriProof, we combine a series of cell-based assays with the potential to analyze and determine positive and negative effects of food formulations, additives, chemicals and substances used by the feed and poultry industry on a fast and significant primary screening platform. The great advantage of this concept is ability to use a functional active chicken enterocyte cell line as the target for these evaluations. With the first test of this kind NutriTox - we are able to determine or exclude potential toxic effects of food formulations and compounds on the cellular level (Tab. 2). The NutriTox assay was evaluated strictly according to the demands of the DIN ISO (biological evaluation of medical devices*). *MicroMol GmbH is accredited for the biological evaluation of medical devices according to DIN EN/ISO Negative control (medium) L-Methionine (5%) L-Methionine (2.5 %) L-Methionine (1 %) L-Methionine (0.5 %) L-Methionine (0.1 %) Positive control (Phenol 1 %) Score Viability (%) Cytotoxicity (%) Reactivity (OD) Table 2: Evaluation of the toxic potential of L-Methionine in various concentrations. 10
11 Features: Primary screening platform for feed compounds and components based on a cytotoxicity assay with a functional active chicken enterocyte cell lines as target Functionality proven by response to various biological stimuli (Lipopolysaccharide, Campylobacter infection) Fast and significant results on the cellular level Platform implemented strictly according to thedemandsofthedin ISO
12 06 For further information or to place an order please contact us: Hedwigstr. 2-8 D Karlsruhe Contact: Dr. Wolfgang Rudy Phone: / Fax: / Mail: Web:
A group A Streptococcus ADP-ribosyltransferase toxin stimulates a protective IL-1β-dependent macrophage immune response
A group A Streptococcus ADP-ribosyltransferase toxin stimulates a protective IL-1β-dependent macrophage immune response Ann E. Lin, Federico C. Beasley, Nadia Keller, Andrew Hollands, Rodolfo Urbano, Emily
More informationSupplementary Figure 1. Characterization of the POP2 transcriptional and post-transcriptional regulatory elements. (A) POP2 nucleotide sequence
1 5 6 7 8 9 10 11 1 1 1 Supplementary Figure 1. Characterization of the POP transcriptional and post-transcriptional regulatory elements. (A) POP nucleotide sequence depicting the consensus sequence for
More informationAt E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in
Supplementary Materials and Methods Barrier function assays At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in acidic X-gal mix (100 mm phosphate buffer at ph4.3, 3 mm
More informationINTESTINAL ORGANOIDS. IntestiCult and STEMdiff Media for Intestinal Organoid Culture. Scientists Helping Scientists
INTESTINAL ORGANOIDS IntestiCult and STEMdiff Media for Intestinal Organoid Culture Scientists Helping Scientists WWW.STEMCELL.COM CULTURING INTESTINAL ORGANOIDS TABLE OF CONTENTS 3 Introduction 4 IntestiCult
More informationProduct Datasheet. Cytokeratin 8 Antibody (OTI1B12) NBP Unit Size: 0.1 ml. Store at -20C. Avoid freeze-thaw cycles.
Product Datasheet Cytokeratin 8 Antibody (OTI1B12) NBP1-48281 Unit Size: 0.1 ml Store at -20C. Avoid freeze-thaw cycles. Protocols, Publications, Related Products, Reviews, Research Tools and Images at:
More informationNaNoplasmid TM. Platform SIZE MATTERS SMALLER IS BETTER
Nanoplasmid TM Platform NaNoplasmid TM The Nanoplasmid is a dramatically improved Key Cassette (
More informationTransient production of recombinant proteins using the MEXi system
Transient production of recombinant proteins using the MEXi system Dennis Niermeier IBA GmbH Dennis Niermeier 216 Small amounts (mg range) of protein are required in a short time for many experiments and
More informationOriGene GFC-Arrays for High-throughput Overexpression Screening of Human Gene Phenotypes
OriGene GFC-Arrays for High-throughput Overexpression Screening of Human Gene Phenotypes High-throughput Gene Function Validation Tool Introduction sirna screening libraries enable scientists to identify
More informationYour Power for Health. Magnetic cell culturing. The n3d approach
Magnetic cell culturing The n3d approach Greiner Bio-One GmbH November 2015 Agenda CELLSTAR cell-repellent surface for 3D cell culture Magnetic cell culturing The n3d approach Applications Products / Info
More informationDr: RAWIA BADR Associate Professor of Microbiology&Immunology
Dr: RAWIA BADR Associate Professor of Microbiology&Immunology Cell culture Commonly refers to the culture of animal cells and tissues, while the more specific term plant tissue.culture is used only for
More informationElwyn Griffiths, DSc, PhD, UK
GaBI Educational Workshops 5 August 2018, Furama Resort Da Nang, Vietnam 1st ASEAN Overview Workshop on GMP for BIOLOGICALS/BIOSIMILARS Elwyn Griffiths, DSc, PhD, UK Former Director General, Biologics
More informationSupplementary Fig. 1. Schematic structure of TRAIP and RAP80. The prey line below TRAIP indicates bait and the two lines above RAP80 highlight the
Supplementary Fig. 1. Schematic structure of TRAIP and RAP80. The prey line below TRAIP indicates bait and the two lines above RAP80 highlight the prey clones identified in the yeast two hybrid screen.
More informationMolecular & Virology Services
Molecular & Virology Services The laboratory staff at MQA is composed of experienced PhD level scientists whose expertise encompasses the disciplines of microbiology, molecular biology, and biochemistry.
More informationSupplementary Table, Figures and Videos
Supplementary Table, Figures and Videos Table S1. Oligonucleotides used for different approaches. (A) RT-qPCR study. (B) qpcr study after ChIP assay. (C) Probes used for EMSA. Figure S1. Notch activation
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Dynamic Phosphorylation of HP1 Regulates Mitotic Progression in Human Cells Supplementary Figures Supplementary Figure 1. NDR1 interacts with HP1. (a) Immunoprecipitation using
More informationPE11, a PE/PPE family protein of Mycobacterium tuberculosis is involved in cell wall remodeling and virulence
PE11, a PE/PPE family protein of Mycobacterium tuberculosis is involved in cell wall remodeling and virulence Parul Singh 1,2, Rameshwaram Nagender Rao 1, Jala Ram Chandra Reddy 3, R.B.N. Prasad 3, Sandeep
More informationLullaby sirna Transfection Reagent - Results
sirna Transfection Reagent - Results OZ Biosciences is delighted to announce the launching of a new sirna transfection reagent: -sirna. This lipid based transfection reagent is specifically designed for
More informationWST-1 CTLL-2 cell proliferation Kit (ready-to-use)
Immunservice WST-1 CTLL-2 cell proliferation Kit (ready-to-use) Optimized for applications with CTLL-2 cells USER MANUAL For research use only. Not intended for diagnostic or therapeutic procedures 1.
More informationCOMMITTEE FOR VETERINARY MEDICINAL PRODUCTS NOTE FOR GUIDANCE 1 : DNA VACCINES NON-AMPLIFIABLE IN EUKARYOTIC CELLS FOR VETERINARY USE
The European Agency for the Evaluation of Medicinal Products Evaluation of Medicines for Veterinary Use CVMP/IWP/07/98-FINAL COMMITTEE FOR VETERINARY MEDICINAL PRODUCTS NOTE FOR GUIDANCE 1 : DNA VACCINES
More informationgacgacgaggagaccaccgctttg aggcacattgaaggtctcaaacatg
Supplementary information Supplementary table 1: primers for cloning and sequencing cloning for E- Ras ggg aat tcc ctt gag ctg ctg ggg aat ggc ttt gcc ggt cta gag tat aaa gga agc ttt gaa tcc Tpbp Oct3/4
More informationContents. The Right Surface for Every Cell Extracellular Matrices and Biologically Coated Surfaces ECM Mimetic and Advanced Surfaces...
Contents The Right Surface for Every Cell... 1 Extracellular Matrices and Biologically Coated Surfaces... 2 Corning Matrigel Matrix... 2 Corning BioCoat Cultureware... 3 ECM Mimetic and Advanced Surfaces...
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Legends for Supplementary Tables. Supplementary Table 1. An excel file containing primary screen data. Worksheet 1, Normalized quantification data from a duplicated screen: valid
More informationSupplementary Figure 1. TRIM9 does not affect AP-1, NF-AT or ISRE activity. (a,b) At 24h post-transfection with TRIM9 or vector and indicated
Supplementary Figure 1. TRIM9 does not affect AP-1, NF-AT or ISRE activity. (a,b) At 24h post-transfection with TRIM9 or vector and indicated reporter luciferase constructs, HEK293T cells were stimulated
More informationApplications involving the ViroCyt Virus Counter in the production of various recombinant proteins
Applications involving the ViroCyt Virus Counter in the production of various recombinant proteins Chris Kemp Kempbio, Inc. Frederick, MD USA chris.kemp@kempbioinc.com Presentation Summary Kempbio, Inc.
More informationRECENT IMPROVEMENTS TO LONZA S GLUTAMINE SYNTHETASE (GS) GENE EXPRESSION SYSTEM. Dr Robert Gay
RECENT IMPROVEMENTS TO LONZA S GLUTAMINE SYNTHETASE (GS) GENE EXPRESSION SYSTEM Dr Robert Gay Lonza Biologics plc, 2004 The Challenge of the MAb Market Global market for Monoclonal Antibody Therapeutics
More informationCells Culture Techniques Marta Czernik
Cells Culture Techniques 13.03.2018 Marta Czernik Why we need the cell/tissue culture Research To overcome problems in studying cellular behaviour such as: - confounding effects of the surrounding tissues
More informationTRANSFEX - SUPERIOR GENE EXPRESSION FOR HARD-TO-TRANSFECT CELL TYPES. Kevin Grady Product Line Business Manager ASCB Vendor Showcase Dec.
TRANSFEX - SUPERIOR GENE EXPRESSION FOR HARD-TO-TRANSFECT CELL TYPES Kevin Grady Product Line Business Manager ASCB Vendor Showcase Dec. 15, 2013 Outline Overview of transfection TransfeX Primary/hTERT
More informationAntibodies against PCNA were previously described [1]. To deplete PCNA from Xenopus egg
Supplementary information Supplementary methods PCNA antibody and immunodepletion Antibodies against PCNA were previously described [1]. To deplete PCNA from Xenopus egg extracts, one volume of protein
More informationProduct Data Sheet - TRUEMAB
888.267.4436 techsupport@origene.com www.origene.com Name:CK8 (Keratin 8) mouse monoclonal antibody, clone OTI2E4 (formerly 2E4) Product Data Sheet - TRUEMAB Catalog: TA500022 Components: CK8 (Keratin
More informationSupplementary information
Supplementary information Identification of E-cadherin signature sites functioning as cleavage sites for Helicobacter pylori HtrA Thomas P. Schmidt 1*, Anna M. Perna 2*, Tim Fugmann 3, Manja Böhm 4, Jan
More informationBcl-2 family member Bcl-G is not a pro-apoptotic BH3-only protein
Bcl-2 family member Bcl-G is not a pro-apoptotic BH3-only protein Maybelline Giam 1,2, Toru Okamoto 1,2,3, Justine D. Mintern 1,2,4, Andreas Strasser 1,2 and Philippe Bouillet 1, 2 1 The Walter and Eliza
More informationYeast Nuclei Isolation Kit
Yeast Nuclei Isolation Kit Catalog Number KA3951 50 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 General Information...
More informationBIOPHARMACEUTICAL PROCESS EVALUATED FOR VIRAL CLEARANCE
The purpose of Viral Clearance evaluation is to assess the capability of a manufacturing production process to inactivate and/or remove potential viral contaminants. Experience and knowledge in selecting
More informationBiomimetic Tri-Culture Models to Study Gut Microbiota- Epithelial-Immune Interactions In Vitro
Biomimetic Tri-Culture Models to Study Gut Microbiota- Epithelial-Immune Interactions In Vitro We developed an in vitro model to study human gut microbiota-epithelial-immune interactions in Transwell culture
More informationIntegrated Protein Services
Integrated Protein Services Customer-specific protein expression, purification and analysis - - Last date of revision December 2015 Version DC04-0014 www.iba-lifesciences.com Please fill out the following
More informationThe Vaxonella Platform for Oral Recombinant Vaccine Delivery
The Vaxonella Platform for Oral Recombinant Vaccine Delivery Dr Rocky Cranenburgh Chief Scientific Officer Friday 26 th September 2014 4 th International Conference on Vaccines & Vaccination, Valencia
More informationFectoCHO Expression system DNA transfection kit for protein production PROTOCOL
FectoCHO Expression system DNA transfection kit for protein production DESCRIPTION PROTOCOL FectoCHO Expression system is a three-component kit that includes FectoPRO transfection reagent, FectoPRO Booster
More informationThe demonstration that wild-type T-DNA coding region can be replaced by any DNA sequence without any effect on its transfer from A.
The demonstration that wild-type T-DNA coding region can be replaced by any DNA sequence without any effect on its transfer from A. tumefaciens to the plant inspired the promise that A. tumefaciens might
More informationTransIT-PRO Transfection Reagent Protocol for MIR 5740 and 5750
Quick Reference Protocol, SDS and Certificate of Analysis available at mirusbio.com/5740 INTRODUCTION TransIT-PRO Transfection Reagent was developed by empirically testing proprietary lipid and polymer
More informationRespiratory (tract) cell line
Respiratory (tract) cell line 25th April 2007 in TTS in Antalya Kazuhiro Ito NHLI, Imperial College, UK Translational Research In vivo In vitro Patient Healthy Volunteer Animal model Primary cells Cell
More informationFectoPRO DNA transfection kit for Bioproduction PROTOCOL
DNA transfection kit for Bioproduction PROTOCOL DESCRIPTION transfection kit is specifically designed for enhanced Transient Gene Expression using low DNA amounts, in suspension CHO and HEK-293 cells as
More informationThe Molecular Virology Support Core: Adenoviral Vectors and Beyond
The : Adenoviral Vectors and Beyond Christoph A. Kahl, Ph.D. Viral Vector Workshop, May 5th, 2011 Outline 1) Overview of the MVSC 2) Adenoviral Vectors 3) Expertise and Services Overview What does the
More informationFigure S1. Sequence alignments of ATRIP and ATR TopBP1 interacting regions.
A H. sapiens 204 TKLQTS--ERANKLAAPSVSH VSPRKNPSVVIKPEACS-PQFGKTSFPTKESFSANMS LP 259 B. taurus 201 TKLQSS--ERANKLAVPTVSH VSPRKSPSVVIKPEACS-PQFGKPSFPTKESFSANKS LP 257 M. musculus 204 TKSQSN--GRTNKPAAPSVSH
More information(a) Immunoblotting to show the migration position of Flag-tagged MAVS
Supplementary Figure 1 Characterization of six MAVS isoforms. (a) Immunoblotting to show the migration position of Flag-tagged MAVS isoforms. HEK293T Mavs -/- cells were transfected with constructs expressing
More informationfibrils, however, oligomeric structures and amorphous protein aggregates were
Supplementary Figure 1: Effect of equimolar EGCG on αs and Aβ aggregate formation. A D B E αs C F Figure S1: (A-C) Analysis of EGCG treated αs (1 µm) aggregation reactions by EM. A 1:1 molar ratio of EGCG
More informationSupervisor:Dr.M.Aslanimehr Presented by :M.Marandi
Journal Club & MSc Seminar anti adhesin therapy Supervisor:Dr.M.Aslanimehr Presented by :M.Marandi The first stage of microbial infection colonization: the establishment of the pathogen at the appropriate
More informationDevelop Better Assays for Every Human Protein
Develop Better Assays for Every Human Protein OriGene overview Application of transfected over-expression lysates Application of purified recombinant human proteins About OriGene Started in1996 with the
More informationAPPROACHES TO IMPROVING THE PERFORMANCE OF MAMMALIAN CELL CULTURES FOR PROTEIN PRODUCTION
BioLOGIC USA BOSTON, 20 th OCTOBER 2004 APPROACHES TO IMPROVING THE PERFORMANCE OF MAMMALIAN CELL CULTURES FOR PROTEIN PRODUCTION Dr Robert Gay Lonza Biologics 2004 The Challenge of the MAb Market Global
More informationNature Medicine: doi: /nm.4464
Supplementary Fig. 1. Amino acid transporters and substrates used for selectivity screening. (A) Common transporters and amino acid substrates shown. Amino acids designated by one-letter codes. Transporters
More informationLi et al., Supplemental Figures
Li et al., Supplemental Figures Fig. S1. Suppressing TGM2 expression with TGM2 sirnas inhibits migration and invasion in A549-TR cells. A, A549-TR cells transfected with negative control sirna (NC sirna)
More informationProduct Data Sheet - TRUEMAB
888.267.4436 techsupport@origene.com www.origene.com Name:MUC1 (EMA) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6) Product Data Sheet - TRUEMAB Catalog: TA800790 Components: MUC1 (EMA) mouse monoclonal
More informationSUMOstar Gene Fusion Technology
Gene Fusion Technology NEW METHODS FOR ENHANCING FUNCTIONAL PROTEIN EXPRESSION AND PURIFICATION IN INSECT CELLS White Paper June 2007 LifeSensors Inc. 271 Great Valley Parkway Malvern, PA 19355 www.lifesensors.com
More informationCHOgro Expression System
SDS and Certificate of Analysis available at mirusbio.com/6260 INTRODUCTION The CHOgro Expression System is an optimized platform for transient, high titer protein production in suspension CHO derived
More informationSupplementary Materials
Supplementary Materials Supplementary Figure 1. PKM2 interacts with MLC2 in cytokinesis. a, U87, U87/EGFRvIII, and HeLa cells in cytokinesis were immunostained with DAPI and an anti-pkm2 antibody. Thirty
More informationOPPF-UK Standard Protocols: Mammalian Expression
OPPF-UK Standard Protocols: Mammalian Expression Joanne Nettleship joanne@strubi.ox.ac.uk Table of Contents 1. Materials... 3 2. Cell Maintenance... 4 3. 24-Well Transient Expression Screen... 5 4. DNA
More informationArrest-In Transfection Reagent Catalog numbers: ATR1740, ATR1741, ATR1742, ATR1743
Arrest-In Transfection Reagent Catalog numbers: ATR1740, ATR1741, ATR1742, ATR1743 Technical support: 1-888-412-2225 Page 1 Arrest-In Transfection Reagent Catalog numbers: ATR1740, ATR1741, ATR1742, ATR1743
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2271 Supplementary Figure a! WM266.4 mock WM266.4 #7 sirna WM266.4 #10 sirna SKMEL28 mock SKMEL28 #7 sirna SKMEL28 #10 sirna WM1361 mock WM1361 #7 sirna WM1361 #10 sirna 9 WM266. WM136
More informationExecuting T-REX in mammalian cells
Supplementary Figure 1 Executing T-REX in mammalian cells HEK-293 cells cultured (a) in 2x 55 cm 2 adherent cell culture plates, and (b and c) in a 48-well multi-well adherent cell culture plate. No cover
More informationPost-translational modification
Protein expression Western blotting, is a widely used and accepted technique to detect levels of protein expression in a cell or tissue extract. This technique measures protein levels in a biological sample
More informationChapter 20 Recombinant DNA Technology. Copyright 2009 Pearson Education, Inc.
Chapter 20 Recombinant DNA Technology Copyright 2009 Pearson Education, Inc. 20.1 Recombinant DNA Technology Began with Two Key Tools: Restriction Enzymes and DNA Cloning Vectors Recombinant DNA refers
More informationK2 Transfection System
K2 Transfection System DNA & RNA Transfection Kit for Mammalian Cells For order information, SDS, publications and application examples see www.biontex.com Product Order No. Size K2 Transfection System
More informationTranscription Factor Runx3 Is Induced by Influenza A Virus and Double-Strand RNA and
Transcription Factor Is Induced by Influenza A Virus and Double-Strand RNA and Mediates Airway Epithelial Cell Apoptosis Huachen Gan 1, Qin Hao 1, Steven Idell 1,2 & Hua Tang 1 1 Department of Cellular
More informationSupplementary Figure 1. α-synuclein is truncated in PD and LBD brains. Nature Structural & Molecular Biology: doi: /nsmb.
Supplementary Figure 1 α-synuclein is truncated in PD and LBD brains. (a) Specificity of anti-n103 antibody. Anti-N103 antibody was coated on an ELISA plate and different concentrations of full-length
More informationINTEGRATED PROTEIN SERVICES
iba INTEGRATED PROTEIN SERVICES Customer-specific protein expression, purification and analysis Please fill out the following and fax to Europe +49 (0) 551-50672-181 US 1-888-531-6813 Or send the scanned
More informationNature Medicine doi: /nm.3554
SUPPLEMENTARY FIGURES LEGENDS Supplementary Figure 1: Generation, purification and characterization of recombinant mouse IL-35 (ril-35). High-Five insect cells expressing high levels of the bicistronic
More informationProteoGenix. Life Sciences Services and Products. From gene to biotherapeutics Target Validation to Lead optimisation
ProteoGenix Life Sciences Services and Products From gene to biotherapeutics Target Validation to Lead optimisation ProteoGenix Philippe FUNFROCK, founder and CEO French company located in Strasbourg,
More informationVivapure AdenoPACK 20
Technical data and operating instructions. For in vitro use only. Vivapure AdenoPACK 20 Adenovirus (Ad5) purification and concentration kit for up to 20 ml cell culture volume (E.g. 1+15 cm plate) 85030-523-69
More informationInstructions. Torpedo sirna. Additional Material Required. Overview. Important Guidelines. Specifications. Shipping and Storage.
is a state of the art transfection reagent, specifically designed for the transfer of sirna and mirna into a variety of mammalian cell types. It combines high transfection efficiency with low cytotoxicity
More informationSUPPLEMENTARY INFORMATION
The Supplementary Information (SI) Methods Cell culture and transfections H1299, U2OS, 293, HeLa cells were maintained in DMEM medium supplemented with 10% fetal bovine serum. H1299 and 293 cells were
More informationProduct Data Sheet - TRUEMAB
888.267.4436 techsupport@origene.com www.origene.com Name:IL6 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9) Product Data Sheet - TRUEMAB Catalog: TA500067 Components: IL6 mouse monoclonal antibody,
More informationINVESTIGATION OF THE BINDING SPECIFICITY OF IGF-IR USING MONOCLONAL ANTIBODIES
INVESTIGATION OF THE BINDING SPECIFICITY OF IGF-IR USING MONOCLONAL ANTIBODIES By Mehrnaz Keyhanfar, Pharm.D. A thesis submitted to the University of Adelaide, South Australia in fulfilment of the requirements
More informationINOS. Colorimetric Cell-Based ELISA Kit. Catalog #: OKAG00807
INOS Colorimetric Cell-Based ELISA Kit Catalog #: OKAG00807 Please read the provided manual entirely prior to use as suggested experimental protocols may have changed. Research Purposes Only. Not Intended
More informationLoss of Cul3 in Primary Fibroblasts
PSU McNair Scholars Online Journal Volume 5 Issue 1 Humans Being: People, Places, Perspectives and Processes Article 15 2011 Loss of Cul3 in Primary Fibroblasts Paula Hanna Portland State University Let
More informationFigure S1. Optimization of reverse-transfection protocols using GAPDH sirnas. MDA- MB-231 cells were seeded in 96-well plates at a density of 5000
Figure S1. Optimization of reverse-transfection protocols using GAPDH sirnas. MDA- MB-231 cells were seeded in 96-well plates at a density of 5000 cells per well, and reverse transfected with the indicated
More informationSupplementary Figure 1. Intracellular distribution of the EPE peptide. HeLa cells were serum-starved (16 h, 0.1%), and treated with EPE peptide,
Supplementary Figure 1. Intracellular distribution of the EPE peptide. HeLa cells were serum-starved (16 h, 0.1%), and treated with EPE peptide, conjugated with either TAT or Myristic acid and biotin for
More informationBiosafety Level Host Range Propagation Comments
Guidelines BSL for Commonly used Viral Vectors Version 1.0 Office of Animal Care and Institutional Biosafety (OACIB) 1737 West Polk Street (MC 672) 206 Administrative Office Building Chicago, IL 60612
More informationCytoGLOW. IKK-α/β. Colorimetric Cell-Based ELISA Kit. Catalog #: CB5358
CytoGLOW IKK-α/β Colorimetric Cell-Based ELISA Kit Catalog #: CB5358 Please read the provided manual entirely prior to use as suggested experimental protocols may have changed. Research Purposes Only.
More information5.14. GENE TRANSFER MEDICINAL PRODUCTS FOR HUMAN USE. Recombinant vectors Gene transfer medicinal products for human use
EUROPEAN PHARMACOPOEIA 6.0 5.14. Gene transfer medicinal products for human use 01/2008:51400 corrected 6.0 5.14. GENE TRANSFER MEDICINAL PRODUCTS FOR HUMAN USE This general chapter is published for information.
More informationSupplemental Figure 1
Supplemental Figure 1 A IL-12p7 (pg/ml) 7 6 4 3 2 1 Medium then TLR ligands MDP then TLR ligands Medium then TLR ligands + MDP MDP then TLR ligands + MDP B IL-12p4 (ng/ml) 1.2 1..8.6.4.2. Medium MDP Medium
More informationContact Person: Fax: IACUC Protocol Title: Address: Department: Yes. Primers Name: Concentration: Fragment Size:
Transgenic Mouse Request Form Please attach a gel photo and a linear map of the construct to this form. The map should indicate locations of: Promoter/ enhancer, splice site, poly A site, and CAP site.
More informationPLA2 domain in parvoviruses The enzymatic features of viral PLA2
PLA2 domain in parvoviruses Sequence analysis of 21 Pavovirinae members revealed that they contain an 80 amino acid conserved region in their VP1up. 20 amino acids out of the 80 were fully conserved and
More informationVirus- infectious particle consisting of nucleic acid packaged in a protein coat.
Chapter 19 Virus- infectious particle consisting of nucleic acid packaged in a protein coat. Most scientists consider viruses non-living because they cannot reproduce or carry out metabolic activities
More informationVEGFR2 (Phospho-Tyr1175)
Assay Biotechnology Company www.assaybiotech.com Tel: 1-877-883-7988 Fax: 1-877-610-9758 VEGFR2 (Phospho-Tyr1175) Colorimetric Cell-Based ELISA Kit Catalog #: OKAG02081 Please read the provided manual
More informationTransIT-PRO Transfection Kit Protocol for MIR 5700 and 5760
Quick Reference Protocol, SDS and Certificate of Analysis available at mirusbio.com/5700 INTRODUCTION TransIT-PRO Transfection Kit was specifically developed for mammalian protein production in suspension
More informationMulti-Purpose Transfection Reagents
Product Information & Instruction Manual Multi-Purpose Transfection Reagents Cat. No: ScreenFect A S-3001 S-3001-2 S-3001-3 ScreenFect A-plus S-6001 S-6001-2 S-6001-3 www.incella.com Contents 1. Characteristics
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2743 Figure S1 stabilizes cellular protein level, post-transcriptionally. (a, b) and DDR1 were RNAi-depleted from HEK.293.-CBG cells. Western blots with indicated antibodies (a). RT-PCRs
More informationInducible Protein Expression in LEXSY with Monitoring Induction
Inducible Protein Expression in LEXSY with Monitoring Induction - 3rd Generation Expression Kit - Cat.-No. EGE-1410 Jena Bioscience GmbH Loebstedter Str. 80 07749 Jena, Germany Tel.: +49-3641-628-5000
More informationThe Biotechnology Toolbox
Chapter 15 The Biotechnology Toolbox Cutting and Pasting DNA Cutting DNA Restriction endonuclease or restriction enzymes Cellular protection mechanism for infected foreign DNA Recognition and cutting specific
More informationTechnical tips Session 4
Technical tips Session 4 Biotinylation assay: Streptavidin is a small bacterial protein that binds with high affinity to the vitamin biotin. This streptavidin-biotin combination can be used to link molecules
More informationNS5 MTases. Recombinant wild type and mutant E218A MTase domain of WNV NS5
doi:10.1038/nature09489 Supplementary Figure 1. Methylation pattern of wild type and mutant WNV NS5 MTases. Recombinant wild type and mutant E218A MTase domain of WNV NS5 (N-terminal 300 amino acids) were
More informationTransIT -LT1 Transfection Reagent
Protocol for Product Nos. MIR 2300, 2304, 2305, 2306 i n t r o d u c t i o n The easy to use TransIT-LT1 (Low Toxicity) Transfection Reagent provides superior transfection efficiency, cell viability, and
More informationProduct Datasheet. ELK3 Antibody (OTI1H3) NBP Unit Size: 0.1 ml. Store at -20C. Avoid freeze-thaw cycles. Reviews: 1 Publications: 1
Product Datasheet ELK3 Antibody (OTI1H3) NBP2-01264 Unit Size: 0.1 ml Store at -20C. Avoid freeze-thaw cycles. Reviews: 1 Publications: 1 Protocols, Publications, Related Products, Reviews, Research Tools
More informationChapter 17: Immunization & Immune Testing. 1. Immunization 2. Diagnostic Immunology
Chapter 17: Immunization & Immune Testing 1. Immunization 2. Diagnostic Immunology 1. Immunization Chapter Reading pp. 505-511 What is Immunization? A method of inducing artificial immunity by exposing
More information1. Immunization. What is Immunization? 12/9/2016. Chapter 17: Immunization & Immune Testing. 1. Immunization 2. Diagnostic Immunology
Chapter 17: Immunization & Immune Testing 1. Immunization 2. Diagnostic Immunology 1. Immunization Chapter Reading pp. 505-511 What is Immunization? A method of inducing artificial immunity by exposing
More informationIt s All in the Hands Genetic Engineering
It s All in the Hands Genetic Engineering Genetic Engineering Genetic Engineering is the technique of modifying the genome of an organism by using recombinant DNA technology. Recombinant DNA (rdna) technology
More informationAndrogen Receptor (Phospho-Tyr363) Colorimetric Cell-Based ELISA Kit. Catalog #: OKAG02138
Androgen Receptor (Phospho-Tyr363) Colorimetric Cell-Based ELISA Kit Catalog #: OKAG02138 Please read the provided manual entirely prior to use as suggested experimental protocols may have changed. Research
More informationSalmonella Antigen Detection (In Food)
DIAGNOSTIC AUTOMATION, INC. 23961 Craftsman Road, Suite D/E/F, Calabasas, CA 91302 Tel: (818) 591-3030 Fax: (818) 591-8383 onestep@rapidtest.com technicalsupport@rapidtest.com www.rapidtest.com See external
More informationXeno-Free Systems for hesc & hipsc. Facilitating the shift from Stem Cell Research to Clinical Applications
Xeno-Free Systems for hesc & hipsc Facilitating the shift from Stem Cell Research to Clinical Applications NutriStem Defined, xeno-free (XF), serum-free media (SFM) specially formulated for growth and
More informationIllumatool ΤΜ Tunable Light System: A Non-Destructive Light Source For Molecular And Cellular Biology Applications. John Fox, Lightools Research.
Illumatool ΤΜ Tunable Light System: A Non-Destructive Light Source For Molecular And Cellular Biology Applications. John Fox, Lightools Research. Fluorescent dyes and proteins are basic analytical tools
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/3/146/ra80/dc1 Supplementary Materials for DNMT1 Stability Is Regulated by Proteins Coordinating Deubiquitination and Acetylation-Driven Ubiquitination Zhanwen
More information