Center for Mass Spectrometry and Proteomics Phone (612) (612)

Size: px
Start display at page:

Download "Center for Mass Spectrometry and Proteomics Phone (612) (612)"

Transcription

1 Outline Database search types Peptide Mass Fingerprint (PMF) Precursor mass-based Sequence tag Results comparison across programs Manual inspection of results Terminology Mass tolerance MS/MS search FASTA Tandem MS Precursor mass Product ion Theoretical mass Experimental mass Sequence tag de novo sequencing

2 Three Strategies for Protein Inference from Peptide MS or MS/MS Data DATA INPUT: Peptide Mass List (MS1) Peptide MS/MS (MS2) Search TYPE: Peptide Mass Fingerprint (PMF) (historical) Precursor Mass-based 2 Sequencebased (de novo or mass tag) 1 3

3 1 Peptide Mass Fingerprint (PMF) Historical: after 1D or 2D in-gel Digestion of single bands or spots Current applications: limited; decreasing utility Component Input (Data) Target Search Parameters Description Peptide Mass List Mass type (Mr or MH+) Average or Monoisotopic Protein FASTA Sequence Database Proteolytic enzyme # Missed enzyme cleave sites Amino acid modifications Mass tolerance

4 Absolute Intensity 1 Peptide Mass Fingerprint: INPUT UNKNOWN PROTEIN (amino acid sequence): GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTG HPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLT ALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLE FISDAIIHVLHSHPGNFGADAQGAMTKALELFRND IAAKYKELGFQG B) Acquire MALDI-TOF Mass Spectrum of peptide mixture A) In gel Trypsin digestion GLSDGEWQQVLNVWGK VEADIAGHGQEVLIR LFTGHPETLEK TEAEMK ASEDLK HGTVVLTALGGILK GHHEAELKPLAQSHATK YLEFISDAIIHVLHSHPGNFGADAQGAMTK ALELFR NDIAAK ELGFQG m/z C) Experimental Peptide Mass (or m/z) List m/z Peptide NDIAAK ELGFQG ASEDLK TEAEMK ALELFR LFTGHPETLEK HGTVVLTALGGILK VEADIAGHGQEVLIR GLSDGEWQQVLNVWGK GHHEAELKPLAQSHATK YLEFISDAIIHVLHSHPGNFGADAQGAMTK

5 1 PMF TARGET: Protein FASTA Sequence Database >sp P B_HUMAN protein beta/alpha OS=Homo sapiens GN=YWHAB PE=1 SV=3 MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD AGEGEN >sp P B_HUMAN Isoform Short of protein beta/alpha OS=Homo sapiens GN=YWHAB MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWR VISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLK MKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE ILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAG EGEN >sp P E_HUMAN protein epsilon OS=Homo sapiens GN=YWHAE PE=1 SV=1 MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE EQNKEALQDVEDENQ >sp Q F_HUMAN protein eta OS=Homo sapiens GN=YWHAH PE=1 SV=4 MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESK VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFS VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE EAGEGN >sp P G_HUMAN protein gamma OS=Homo sapiens GN=YWHAG PE=1 SV=2 MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD DGGEGNN >sp P S_HUMAN protein sigma OS=Homo sapiens GN=SFN PE=1 SV=1 MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWR VLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFY LKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFH YEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGG EAPQEPQS etc UniProt (example) The Universal Protein Resource (UniProt) is a comprehensive resource for protein sequence and annotation data. UniProt is a collaboration between the European Bioinformatics Institute (EBI), the Swiss Institute of Bioinformatics (SIB) and the Protein Information Resource (PIR). Across the three institutes close to 150 people are involved through different tasks such as database curation, software development and support. Example: 20,292 entries for taxonomy: "Homo sapiens (Human) [9606] AND reviewed:yes

6 1 PMF Search Parameters Review: Trypsin Proteolytic Enzyme and 0 Missed Cleave Site (#MC) modifications Example: Theoretical Trypsin Digest Peptide Mass List (truncated) for a Single Protein: Trypsin = Enzyme Missed Cleave Sites = 0

7 1 PMF Search Parameters: Trypsin Proteolytic Enzyme and 1 Missed Cleave Site MSO = Methionine Oxidation (amino acid modification) artif modifications modifications

8 1 PMF Parameter: Peptide Mass Deviation (+/- m/z) High resolution measurement / Range: Mouse proteins with Trypsin peptide in this range Low resolution measurement 631 +/- 1 Range: Mouse proteins with Trypsin peptide in this range m/z

9 1 Mass Measurement Error Calculation Error Expression Fractional Error Expression Multiply by: ppm / Theoretical value 1,000,000 % / Theoretical value 100 where Δ = Experimental (or observed) Theoretical m/z value Example: Experimental/observed value (i.e., the data acquired by the mass spectrometer) = m/z Theoretical value (calculated from periodic table, after the peak is identified) = m/z Delta (Δ) = Error Expression Error Equation Error ppm (0.079/ )*1,000, ppm % (0.079/ )* % A USEFUL REFERENCE: Brenton AG, Godfrey AR. Accurate mass measurement: terminology and treatment of data. J Am Soc Mass Spectrom Nov;21(11):

10 1 MASCOT Peptide Mass Fingerprint Search

11 1 MASCOT PMF Search Parameter Page

12 1 PMF Search QUERY (Experimental Data) m/z Peptide NDIAAK ELGFQG ASEDLK TEAEMK ALELFR LFTGHPETLEK HGTVVLTALGGILK VEADIAGHGQEVLIR GLSDGEWQQVLNVWGK GHHEAELKPLAQSHATK YLEFISDAIIHVLHSHPGNFGADAQGAMTK Search Score Compare QUERY to THEORETICAL PEPTIDE MASS LIST for each protein in the database Parameters: Enzyme Missed cleave site Amino acid mods Mass tolerance Probability-based MOWSE Score (often, the protein with highest number of peptide matches has the highest score)

13 1

14 1

15 1 PMF Search: Results Interpretation Is the protein ID experimentally rational? Does the MW of protein in search results match MW determined by SDS-PAGE? Does the pi of protein in search results match pi determined by 2D-PAGE? Perform MS/MS if no protein match

16 Three Strategies for Protein Inference from Peptide MS or MS/MS Data DATA INPUT: Peptide Mass List (MS1) Peptide MS/MS (MS2) Search TYPE: Peptide Mass Fingerprint (PMF) (historical) Precursor Mass-based 2 Sequencebased (de novo or mass tag) 1 3

17 2 Tandem MS: Precursor Mass-based Search Component Input (Data) Target Search Parameters Description Precursor Mass & Product Ion Masses Charge state Average or Monoisotopic Protein FASTA Sequence Database Proteolytic enzyme # Missed enzyme cleave sites Amino acid modifications Mass tolerances: Peptide/Precursor Mass Product Ions Masses

18 2 Tandem MS: Precursor Mass-based Search 1. Each MS/MS spectra has 2 data-rich Components 2. Database search for each MS/MS spectra has 2 STEPS

19 2 Tandem MS: Precursor Mass-based Search REVIEW: Each MS/MS Spectra has Two Data-Rich Components In te n s ity, c o u n ts Example: m/z = Precursor m/z +TOF MS: Experiment 1, min from bruce w 2-5 humjak3 tryp.wiff a= e-004, t0= e COMPONENT 1: Intact Peptide Max counts m/z, amu In te n s ity, c o u n ts +TOF Product (612.8): Experiment 2, min from bruce w 2-5 humjak3 tryp.wiff a= e-004, t0= e a COMPONENT 2: Product Ion Mass (m/z) values and Intensities after Peptide Fragmentation a2b2 y b y y a3-nh3(2+) y y4 y7(2+) a4 y8(2+) b4 a5 y y y Max counts m/z, amu y9

20 Tandem MS: Precursor Mass-based Search STEP 1: Find Theoretical Peptides (from in silico Protein Digest) within user specified Precursor Mass Tolerance from MS1 spectrum Mass [M + H] +1 Protein GenBank ID# Peptide gi SRNLGPSTSR gi RASVDIGISR gi MoxRTFMoxISR gi QTYENYTR gi REEMHESR gi IDLVSMoxHSR gi IFLPGHYAR gi FMLPGDTHR gi NMoxRQHDTR gi EVPETKDTR PEPTIDE CANDIDATES 2 evaluate 1 st candidate (next slide) etc etc etc

21 2 Tandem MS: Precursor Mass-based Search STEP 2: Generate Theoretical Product Ion Table for Peptide Candidate SRNLGPSTSR Theoretical Product Ion Table evaluate 1 st candidate Residue a b b-h2o b-nh3 y y-h2o y-nh3 S, Ser R, Arg N, Asn L, Leu G, Gly P, Pro S, Ser T, Thr S, Ser R, Arg

22 2 Tandem MS: Precursor Mass-based Search Compare theoretical product ions to experimental product Ions from MS2 spectrum

23 Intensity 2 REVIEW: b-type fragment ions NH3+ A E P T I R COOH NH2 NH2 A E P T A E P NH2 A E NH2 A m/z

24 Intensity 2 REVIEW: y-type fragment ions NH3+ A E P T I R COOH HOOC HOOC R I T P R I T HOOC R I HOOC R m/z

25 Intensity 2 REVIEW: b- and y-type Fragment ions: PEPTIDE TANDEM MASS SPECTRUM NH3+ A E P T I R COOH b y b y b y b y b y m/z

26 2 Tandem MS: Precursor Mass-based Search SUMMARY- for Each MS/MS Spectrum: Generate theoretical product ion tables for all peptide candidates Compare theoretical product ions to experimental product Ions from MS2 spectrum Score all candidate peptides Rank peptides by Score

27 2 Tandem MS: Precursor Mass-based Search STEP 1 Find Theoretical Peptide Matches from in silico Protein Digest in the range: Experimental Precursor Mass +/- Mass Tolerance STEP 2 For each candidate peptide from Step 1: Compare Theoretical Product Ions (b & y, etc) to Experimental Product ions (data) STEP 3 SCORE: many software programs/ algorithms Peptide rank PROTEIN Report and Grouping: many variations

28 2 Tandem MS: Precursor Massbased search Software at UM Sequest X!Tandem MASCOT

29 Three Strategies for Protein Inference from Peptide MS or MS/MS Data DATA INPUT: Peptide Mass List (MS1) Peptide MS/MS (MS2) Search TYPE: Peptide Mass Fingerprint (PMF) (historical) Precursor Mass-based 2 Sequencebased (de novo or mass tag) 1 3

30 3 Sequence-based Searches: WHEN? Unsequenced genome (protein(s) of interest are not in the database) HOMOLOGY-based search Search for amino acid MUTATIONS Search for LARGE NUMBERS of Post Translational Modifications (PTM s)

31 3 Tandem MS: Sequence-based Search STEP 1: Obtain [full or partial] amino acid sequence string directly from the spectrum by de novo Sequencing de novo (Latin) "from the beginning"

32 3 Tandem MS: Sequence-based Search STEP 1: de novo sequencing: amino acid sequence is determined from delta mass values for a series of successive peptide b- or y-type product ions from a Product Ion (MS/MS) spectrum EXAMPLE de novo sequencing: L 113 V 99 A 71 D 115 L 113 E 129 delta masses between peaks correspond to amino acid residue masses See amino acid residue masses:

33 3 Tandem MS: Sequence-based Search STEP 2: QUERY THE PROTEINS Example: AB Sciex Paragon Algorithm For each MS/MS spectrum, multiple, short sequences (taglets) are generated, scored, and matched against protein sequences. Sequence Temperature Values (STV) rank candidate amino acid sequence segments. STV is related to the number of taglet hits per region. Slide content: courtesy of Sean L. Seymour, AB Sciex

34 3 Tandem MS: Sequence-based Search STEP 3: Candidate peptide sequences within protein sequences are identified with Precursor mass AND sequence tag information Include: Enzyme specificity Mass tolerance Amino acid modifications Amino Acid mutations STEP 4: Candidates are Ranked and SCORED

35 3 Tandem MS: Sequence-based Search STEP 3b: Error-tolerant Sequence Tag Reconciliation Includes Amino Acid Mutation Search Component Combination: sequence tag & mass match Slide content: adapted from David L. Tabb, Vanderbilt University: Bioinformatics 2009, Baltimore MD

36 3 MS/MS Sequence-based Software at UM ProteinPilot (AB Sciex) PEAKS (BSI) Direct Tag (D Tabb Lab) MASCOT (Matrix Science LTD) Error Tolerant MS/MS Sequence Tag

37 3 MS/MS Sequence-based Software PepNovo (open source de novo) Frank et al, Anal Chem (2005) 77: PEAKS Studio (Commercial de novo) Ma et al, RCMS (2003) 17: 2337:2342 Lutefisk (early de novo tool) Taylor et al, RCMS (1997) 11: Direct Tag (open source tag inference) Tabb et al, J Proteome Res (2008) 7: InsPecT (open source tag identifier) Tanner et al, Anal Chem (2005) 77:

38 Maximize Identifications with Multiple Software Programs Single Dataset analyzed with multiple software programs: Blue = number of peptide matches Red = number of protein matches

39 Maximize Identifications with Multiple Software Programs

40 Search Algorithm Conclusions 1) Several different search algorithm types exist 2) Each program provides useful results - no unified method exists 3) The same data searched using different algorithms may yield different results (scoring and ranking schemes are distinct)

41 Manual Inspection of Individual MS/MS Spectra Journal requirement (in special cases; see Inspect SINGLE PEPTIDE HITS Site Localization of Post Translational Modifications (PTM s) Detection of unexpected gene products (alternative splice isoforms)

42 STEPS for Manual Inspection of MS/MS Spectra 1) Open RAW data; print spectrum (or, multiple zoomed-in regions of the spectrum) 2) Obtain list of Theoretical Fragment Ions (e.g., open MS Product tool 3) Label printout(s) of spectra with fragment ion types 4) DECISION: a. GOOD MATCH: all/most of the peaks (in the raw data) labeled with fragment ion types b. POOR MATCH: unassigned peaks in the raw data

43 Manual Inspection of MS/MS Spectra Example: RAW data labeled with Fragment Ion Names/Types IT4FYEQFSK IT4 (Fragment Ion Nomenclature Reference: P. Roepstorff & J. Fohlman (2005) Proposal for a Common Nomenclature for Sequence Ions in Mass Spectra of Peptides, Biomedical Spectrometry, 11(11), p 601

PTM Identification and Localization from MS Proteomics Data

PTM Identification and Localization from MS Proteomics Data 05.10.17 PTM Identification and Localization from MS Proteomics Data Marc Vaudel Center for Medical Genetics and Molecular Medicine, Haukeland University Hospital, Bergen, Norway KG Jebsen Center for Diabetes

More information

N- The rank of the specified protein relative to all other proteins in the list of detected proteins.

N- The rank of the specified protein relative to all other proteins in the list of detected proteins. PROTEIN SUMMARY file N- The rank of the specified protein relative to all other proteins in the list of detected proteins. Unused (ProtScore) - A measure of the protein confidence for a detected protein,

More information

Spectral Counting Approaches and PEAKS

Spectral Counting Approaches and PEAKS Spectral Counting Approaches and PEAKS INBRE Proteomics Workshop, April 5, 2017 Boris Zybailov Department of Biochemistry and Molecular Biology University of Arkansas for Medical Sciences 1. Introduction

More information

ProteinPilot Software Overview

ProteinPilot Software Overview ProteinPilot Software Overview High Quality, In-Depth Protein Identification and Protein Expression Analysis Sean L. Seymour and Christie L. Hunter SCIEX, USA As mass spectrometers for quantitative proteomics

More information

Application Note TOF/MS

Application Note TOF/MS Application Note TOF/MS New Level of Confidence for Protein Identification: Results Dependent Analysis and Peptide Mass Fingerprinting Using the 4700 Proteomics Discovery System Purpose The Applied Biosystems

More information

Utilizing novel technology for the analysis of therapeutic antibodies and host cell protein contamination

Utilizing novel technology for the analysis of therapeutic antibodies and host cell protein contamination Utilizing novel technology for the analysis of therapeutic antibodies and host cell protein contamination Kelli Jonakin, Ph.D. Senior Field Application Scientist, Seattle, WA Eric Johansen, Ph.D. Senior

More information

Improving Productivity with Applied Biosystems GPS Explorer

Improving Productivity with Applied Biosystems GPS Explorer Product Bulletin TOF MS Improving Productivity with Applied Biosystems GPS Explorer Software Purpose GPS Explorer Software is the application layer software for the Applied Biosystems 4700 Proteomics Discovery

More information

Proteomics and some of its Mass Spectrometric Applications

Proteomics and some of its Mass Spectrometric Applications Proteomics and some of its Mass Spectrometric Applications What? Large scale screening of proteins, their expression, modifications and interactions by using high-throughput approaches 2 1 Why? The number

More information

De novo sequencing in the identification of mass data. Wang Quanhui Liu Siqi Beijing Institute of Genomics, CAS

De novo sequencing in the identification of mass data. Wang Quanhui Liu Siqi Beijing Institute of Genomics, CAS De novo sequencing in the identification of mass data Wang Quanhui Liu Siqi Beijing Institute of Genomics, CAS The difficulties in mass data analysis Although the techniques of genomic sequencing are being

More information

ProteinPilot Report for ProteinPilot Software

ProteinPilot Report for ProteinPilot Software ProteinPilot Report for ProteinPilot Software Detailed Analysis of Protein Identification / Quantitation Results Automatically Sean L Seymour, Christie Hunter SCIEX, USA Powerful mass spectrometers like

More information

FACTORS THAT AFFECT PROTEIN IDENTIFICATION BY MASS SPECTROMETRY HAOFEI TIFFANY WANG. (Under the Direction of Ron Orlando) ABSTRACT

FACTORS THAT AFFECT PROTEIN IDENTIFICATION BY MASS SPECTROMETRY HAOFEI TIFFANY WANG. (Under the Direction of Ron Orlando) ABSTRACT FACTORS THAT AFFECT PROTEIN IDENTIFICATION BY MASS SPECTROMETRY by HAOFEI TIFFANY WANG (Under the Direction of Ron Orlando) ABSTRACT Mass spectrometry combined with database search utilities is a valuable

More information

Peptide and protein identification in mass spectrometry based proteomics. Yafeng Zhu, PhD student Karolinska Institutet, Scilifelab

Peptide and protein identification in mass spectrometry based proteomics. Yafeng Zhu, PhD student Karolinska Institutet, Scilifelab Peptide and protein identification in mass spectrometry based proteomics Yafeng Zhu, PhD student Karolinska Institutet, Scilifelab 2017-10-12 Content How is the peptide sequence identified? What is the

More information

Supplemental Materials

Supplemental Materials Supplemental Materials MSGFDB Parameters For all MSGFDB searches, the following parameters were used: 30 ppm precursor mass tolerance, enable target-decoy search, enzyme specific scoring (for Arg-C, Asp-N,

More information

Automation of MALDI-TOF Analysis for Proteomics

Automation of MALDI-TOF Analysis for Proteomics Application Note #MT-50 BIFLEX III / REFLEX III Automation of MALDI-TOF Analysis for Proteomics D. Suckau, C. Köster, P.Hufnagel, K.-O. Kräuter and U. Rapp, Bruker Daltonik GmbH, Bremen, Germany Introduction

More information

Spectrum Mill MS Proteomics Workbench. Comprehensive tools for MS proteomics

Spectrum Mill MS Proteomics Workbench. Comprehensive tools for MS proteomics Spectrum Mill MS Proteomics Workbench Comprehensive tools for MS proteomics Meeting the challenge of proteomics data analysis Mass spectrometry is a core technology for proteomics research, but large-scale

More information

About OMICS Group Conferences

About OMICS Group Conferences About OMICS Group OMICS Group International is an amalgamation of Open Access publications and worldwide international science conferences and events. Established in the year 2007 with the sole aim of

More information

Proteomics software at MSI. Pratik Jagtap Minnesota Supercomputing institute

Proteomics software at MSI. Pratik Jagtap Minnesota Supercomputing institute Proteomics software at MSI. Pratik Jagtap Minnesota Supercomputing institute http://www.mass.msi.umn.edu/ Proteomics software at MSI. proteomics : emerging technology proteomics workflow search algorithms

More information

Protein Valida-on (Sta-s-cal Inference) and Protein Quan-fica-on. Center for Mass Spectrometry and Proteomics Phone (612) (612)

Protein Valida-on (Sta-s-cal Inference) and Protein Quan-fica-on. Center for Mass Spectrometry and Proteomics Phone (612) (612) Protein Valida-on (Sta-s-cal Inference) and Protein Quan-fica-on Terminology Pep-de Spectrum Match Target / Decoy False discovery rate Shared pep-de Parsimony One hit wonders SPECTRUM Rela-ve Abundance

More information

ProteinPilot Software for Protein Identification and Expression Analysis

ProteinPilot Software for Protein Identification and Expression Analysis ProteinPilot Software for Protein Identification and Expression Analysis Providing expert results for non-experts and experts alike ProteinPilot Software Overview New ProteinPilot Software transforms protein

More information

1638 Molecular & Cellular Proteomics 6.9

1638 Molecular & Cellular Proteomics 6.9 Supplemental Material can be found at: http://www.mcponline.org/cgi/content/full/t600050-mcp200/ DC1 Technology The Paragon Algorithm, a Next Generation Search Engine That Uses Sequence Temperature Values

More information

Highly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs

Highly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs Technical Overview Highly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs Authors Stephen Madden, Crystal Cody, and Jungkap Park Agilent Technologies, Inc. Santa Clara, California,

More information

Practical Tips. : Practical Tips Matrix Science

Practical Tips. : Practical Tips Matrix Science Practical Tips : Practical Tips 2006 Matrix Science 1 Peak detection Especially critical for Peptide Mass Fingerprints A tryptic digest of an average protein (30 kda) should produce of the order of 50

More information

Bioinformatics for proteomics

Bioinformatics for proteomics Purdue-UAB Botanicals Center for Age-Related Disease Bioinformatics for proteomics Stephen Barnes, PhD Purdue-UAB Botanical Center Workshop 2002 Mass Spectrometry Methods in Botanicals Research Objectives

More information

Advances in analytical biochemistry and systems biology: Proteomics

Advances in analytical biochemistry and systems biology: Proteomics Advances in analytical biochemistry and systems biology: Proteomics Brett Boghigian Department of Chemical & Biological Engineering Tufts University July 29, 2005 Proteomics The basics History Current

More information

基于质谱的蛋白质药物定性定量分析技术及应用

基于质谱的蛋白质药物定性定量分析技术及应用 基于质谱的蛋白质药物定性定量分析技术及应用 蛋白质组学质谱数据分析 单抗全蛋白测序及鉴定 Bioinformatics Solutions Inc. Waterloo, ON, Canada 上海 中国 2017 1 3 PEAKS Studio GUI Introduction Overview of PEAKS Studio GUI Project View Tasks, running info,

More information

Algorithm for Matching Additional Spectra

Algorithm for Matching Additional Spectra Improved Methods for Comprehensive Sample Analysis Using Protein Prospector Peter R. Baker 1, Katalin F. Medzihradszky 1 and Alma L. Burlingame 1 1 Mass Spectrometry Facility, Dept. of Pharmaceutical Chemistry,

More information

MIAPE: Mass Spectrometry Informatics

MIAPE: Mass Spectrometry Informatics MIAPE: Mass Spectrometry Informatics Pierre-Alain Binz[1,2]*, Robert Barkovich[3], Ronald C. Beavis[4], David Creasy[5], David M. Horn[6], Randall K. Julian Jr.[7], Sean L. Seymour[8], Chris F. Taylor[9],

More information

Quantitative mass spec based proteomics

Quantitative mass spec based proteomics Quantitative mass spec based proteomics Tuula Nyman Institute of Biotechnology tuula.nyman@helsinki.fi THE PROTEOME The complete protein complement expressed by a genome or by a cell or a tissue type (M.

More information

New Approaches to Quantitative Proteomics Analysis

New Approaches to Quantitative Proteomics Analysis New Approaches to Quantitative Proteomics Analysis Chris Hodgkins, Market Development Manager, SCIEX ANZ 2 nd November, 2017 Who is SCIEX? Founded by Dr. Barry French & others: University of Toronto Introduced

More information

A New Strategy for Quantitative Proteomics Using Isotope-Coded Protein Labels

A New Strategy for Quantitative Proteomics Using Isotope-Coded Protein Labels ICPL TM -Isotope Coded Label A New Strategy for Quantitative Proteomics Using Isotope-Coded Labels Alexander Schmidt Department for Max-Planck-Institute of Biochemistry Spotfire User Conference 2004, Cologne

More information

Nature Biotechnology: doi: /nbt Supplementary Figure 1. The workflow of Open-pFind.

Nature Biotechnology: doi: /nbt Supplementary Figure 1. The workflow of Open-pFind. Supplementary Figure 1 The workflow of Open-pFind. The MS data are first preprocessed by pparse, and then the MS/MS data are searched by the open search module. Next, the MS/MS data are re-searched by

More information

Proteomics: A Challenge for Technology and Information Science. What is proteomics?

Proteomics: A Challenge for Technology and Information Science. What is proteomics? Proteomics: A Challenge for Technology and Information Science CBCB Seminar, November 21, 2005 Tim Griffin Dept. Biochemistry, Molecular Biology and Biophysics tgriffin@umn.edu What is proteomics? Proteomics

More information

Key questions of proteomics. Bioinformatics 2. Proteomics. Foundation of proteomics. What proteins are there? Protein digestion

Key questions of proteomics. Bioinformatics 2. Proteomics. Foundation of proteomics. What proteins are there? Protein digestion s s Key questions of proteomics What proteins are there? Bioinformatics 2 Lecture X roteomics How much is there of each of the proteins? - Absolute quantitation - Stoichiometry What (modification/splice)

More information

RockerBox. Filtering massive Mascot search results at the.dat level

RockerBox. Filtering massive Mascot search results at the.dat level RockerBox Filtering massive Mascot search results at the.dat level Challenges Big experiments High amount of data Large raw and.dat files (> 2GB) How to handle our results?? The 2.2 peptide summary could

More information

Proteomics And Cancer Biomarker Discovery. Dr. Zahid Khan Institute of chemical Sciences (ICS) University of Peshawar. Overview. Cancer.

Proteomics And Cancer Biomarker Discovery. Dr. Zahid Khan Institute of chemical Sciences (ICS) University of Peshawar. Overview. Cancer. Proteomics And Cancer Biomarker Discovery Dr. Zahid Khan Institute of chemical Sciences (ICS) University of Peshawar Overview Proteomics Cancer Aims Tools Data Base search Challenges Summary 1 Overview

More information

Využití cílené proteomiky pro kontrolu falšování potravin: identifikace peptidových markerů v mase pomocí LC- Q Exactive MS/MS

Využití cílené proteomiky pro kontrolu falšování potravin: identifikace peptidových markerů v mase pomocí LC- Q Exactive MS/MS Využití cílené proteomiky pro kontrolu falšování potravin: identifikace peptidových markerů v mase pomocí LC- Q Exactive MS/MS Michal Godula Ph.D. Thermo Fisher Scientific The world leader in serving science

More information

Proteomics Informatics (BMSC-GA 4437)

Proteomics Informatics (BMSC-GA 4437) Proteomics Informatics (BMSC-GA 4437) Instructor David Fenyö Contact information David@FenyoLab.org htt://fenyolab.org/resentations/proteomics_informatics_2013/ Learning Objectives Be able analyze a roteomics

More information

How to view Results with Scaffold. Proteomics Shared Resource

How to view Results with Scaffold. Proteomics Shared Resource How to view Results with Scaffold Proteomics Shared Resource Starting out Download Scaffold from http://www.proteomes oftware.com/proteom e_software_prod_sca ffold_download.html Follow installation instructions

More information

Protein Grouping, FDR Analysis and Databases.

Protein Grouping, FDR Analysis and Databases. Protein Grouping, FDR Analysis and Databases. March 15th 2012 Pratik Jagtap The Minnesota http://www.mass.msi.umn.edu/ Protein Grouping, FDR Analysis and Databases Overview. Protein Grouping : Concept

More information

Quantification of Isotope Encoded Proteins in 2D Gels

Quantification of Isotope Encoded Proteins in 2D Gels Quantification of Isotope Encoded Proteins in 2D Gels Using Surface Enhanced Resonance Raman Giselle M. Knudsen 1, Brandon M. Davis 2, Shirshendu K. Deb 1, Yvette Loethen 2, Ravindra Gudihal 1, Pradeep

More information

Mass Spectrometry Based Proteomics Data Analysis Using GalaxyP

Mass Spectrometry Based Proteomics Data Analysis Using GalaxyP Mass Spectrometry Based Proteomics Data Analysis Using GalaxyP GCC 2015 GalaxyP Workshop July 6th, 2015 Norwich, UK Presenters: Tim Griffin, Pratik Jagtap and James Johnson Documentation: Kevin Murray,

More information

LTQ Orbitrap XL Hybrid FT Mass Spectrometer Unrivaled Performance and Flexibility

LTQ Orbitrap XL Hybrid FT Mass Spectrometer Unrivaled Performance and Flexibility m a s s s p e c t r o m e t r y LTQ Orbitrap XL Hybrid FT Mass Spectrometer Unrivaled Performance and Flexibility Part of Thermo Fisher Scientific LTQ Orbitrap XL OFFERING OUTSTANDING MASS ACCURACY, RESOLVING

More information

Innovations for Protein Research. Protein Research. Powerful workflows built on solid science

Innovations for Protein Research. Protein Research. Powerful workflows built on solid science Innovations for Protein Research Protein Research Powerful workflows built on solid science Your partner in discovering innovative solutions for quantitative protein and biomarker research Applied Biosystems/MDS

More information

Ariadne tutorial 1: RNA identification

Ariadne tutorial 1: RNA identification Ariadne tutorial 1: RNA identification 0. Introduction In this tutorial, we are going to introduce how to characterize RNA MS/MS data by using the Ariadne server via the Internet. How do you start searching

More information

ENHANCED PROTEIN AND PEPTIDE CHARACTERIZATION

ENHANCED PROTEIN AND PEPTIDE CHARACTERIZATION Agilent MassHunter BioConfirm Software ENHANCED PROTEIN AND PEPTIDE CHARACTERIZATION Spectrum Algorithm Peak Modeling Deconvolution Mass 16951.778 Sequence Name Myoglobin (horse) Target mass 16951.673

More information

d Yield of peptide (µm)

d Yield of peptide (µm) a Pro template DN native trn mix pre-charged Pro-tRN Pro T7 RN polymerase [ 4 ]sp Met Lys ly sprs MetRS LysRS lyrs E. coli ribosome Tyr TyrRS 5 amino acids and 5 aminoacyl-trn synthetases other protein

More information

Ensure your Success with Agilent s Biopharma Workflows

Ensure your Success with Agilent s Biopharma Workflows Ensure your Success with Agilent s Biopharma Workflows Steve Madden Software Product Manager Agilent Technologies, Inc. June 5, 2018 Agenda Agilent BioPharma Workflow Platform for LC/MS Intact Proteins

More information

An Improved Approach for Glycan Structure Identification from HCD MS/MS Spectra

An Improved Approach for Glycan Structure Identification from HCD MS/MS Spectra Introduction Method Experiments An Improved Approach for Glycan Structure Identification from HCD MS/MS Spectra Weiping Sun, Yi Liu, Gilles Lajoie, Bin Ma and Kaizhong Zhang Department of Computer Science,

More information

Proteomics. Proteomics is the study of all proteins within organism. Challenges

Proteomics. Proteomics is the study of all proteins within organism. Challenges Proteomics Proteomics is the study of all proteins within organism. Challenges 1. The proteome is larger than the genome due to alternative splicing and protein modification. As we have said before we

More information

Agilent Software Tools for Mass Spectrometry Based Multi-omics Studies

Agilent Software Tools for Mass Spectrometry Based Multi-omics Studies Agilent Software Tools for Mass Spectrometry Based Multi-omics Studies Technical Overview Introduction The central dogma for biological information flow is expressed as a series of chemical conversions

More information

Supporting Information for

Supporting Information for Supporting Information for CharmeRT: Boosting peptide identifications by chimeric spectra identification and retention time prediction Viktoria Dorfer*,,a, Sergey Maltsev,b, Stephan Winkler a, Karl Mechtler*,b,c.

More information

Put the PRO in Protein Characterization

Put the PRO in Protein Characterization Put the PRO in Protein Characterization Aaron Boice LC/Q-TOF Product Manager 5-June-2017 Agenda The Right Tools for the Job Tackling Intact Proteins Break it Down Peptides and PTMs Sweet Success Released

More information

BIOINFORMATICS ORIGINAL PAPER

BIOINFORMATICS ORIGINAL PAPER BIOINFORMATICS ORIGINAL PAPER Vol 25 no 22 29, pages 2969 2974 doi:93/bioinformatics/btp5 Data and text mining Improving peptide identification with single-stage mass spectrum peaks Zengyou He and Weichuan

More information

Protein Reports CPTAC Common Data Analysis Pipeline (CDAP)

Protein Reports CPTAC Common Data Analysis Pipeline (CDAP) Protein Reports CPTAC Common Data Analysis Pipeline (CDAP) v. 4/13/2015 Summary The purpose of this document is to describe the protein reports generated as part of the CPTAC Common Data Analysis Pipeline

More information

Supporting Online Material for

Supporting Online Material for www.sciencemag.org/cgi/content/full/1144622/dc1 Supporting Online Material for Genome Transplantation in Bacteria: Changing One Species to Another Carole Lartigue, John I. Glass, * Nina Alperovich, Rembert

More information

ProMass HR Applications!

ProMass HR Applications! ProMass HR Applications! ProMass HR Features Ø ProMass HR includes features for high resolution data processing. Ø ProMass HR includes the standard ProMass deconvolution algorithm as well as the full Positive

More information

Bioinformatic Tools. So you acquired data.. But you wanted knowledge. So Now What?

Bioinformatic Tools. So you acquired data.. But you wanted knowledge. So Now What? Bioinformatic Tools So you acquired data.. But you wanted knowledge So Now What? We have a series of questions What the Heck is That Ion? How come my MW does not match? How do I make a DB to search against?

More information

Informatics on MS-Based Proteomics

Informatics on MS-Based Proteomics Informatics on MS-Based Proteomics Yet-Ran Chen 陳逸然 Associate Research Fellow / Associate Professor Agricultural Biotech. Research Center / Institute of Biotechnology & Genomics and Systems Biology Academia

More information

How to view Results with. Proteomics Shared Resource

How to view Results with. Proteomics Shared Resource How to view Results with Scaffold 3.0 Proteomics Shared Resource An overview This document is intended to walk you through Scaffold version 3.0. This is an introductory guide that goes over the basics

More information

Really high sensitivity mass spectrometry and Discovery and analysis of protein complexes

Really high sensitivity mass spectrometry and Discovery and analysis of protein complexes Really high sensitivity mass spectrometry and Discovery and analysis of protein complexes The PRIME lab and AMS Importance of protein complexes in biology Methods for isolation of protein complexes In

More information

High-throughput Proteomic Data Analysis. Suh-Yuen Liang ( 梁素雲 ) NRPGM Core Facilities for Proteomics and Glycomics Academia Sinica Dec.

High-throughput Proteomic Data Analysis. Suh-Yuen Liang ( 梁素雲 ) NRPGM Core Facilities for Proteomics and Glycomics Academia Sinica Dec. High-throughput Proteomic Data Analysis Suh-Yuen Liang ( 梁素雲 ) NRPGM Core Facilities for Proteomics and Glycomics Academia Sinica Dec. 9, 2009 High-throughput Proteomic Data Are Information Rich and Dependent

More information

Faster, More Sensitive Peptide ID by Sequence DB Compression. Nathan Edwards Center for Bioinformatics and Computational Biology

Faster, More Sensitive Peptide ID by Sequence DB Compression. Nathan Edwards Center for Bioinformatics and Computational Biology Faster, More Sensitive Peptide ID by Sequence DB Compression Nathan Edwards Center for Bioinformatics and Computational Biology MS/MS Search Engines Fail when peptides are missing from sequence database

More information

Web based Bioinformatics Applications in Proteomics. Genbank

Web based Bioinformatics Applications in Proteomics. Genbank Web based Bioinformatics Applications in Proteomics Chiquito Crasto ccrasto@genetics.uab.edu February 9, 2010 Genbank Primary nucleic acid sequence database Maintained by NCBI National Center for Biotechnology

More information

Supplementary Tables. Note: Open-pFind is embedded as the default open search workflow of the pfind tool. Nature Biotechnology: doi: /nbt.

Supplementary Tables. Note: Open-pFind is embedded as the default open search workflow of the pfind tool. Nature Biotechnology: doi: /nbt. Supplementary Tables Supplementary Table 1. Detailed information for the six datasets used in this study Dataset Mass spectrometer # Raw files # MS2 scans Reference Dong-Ecoli-QE Q Exactive 5 202,452 /

More information

Basic protein and peptide science for proteomics. Henrik Johansson

Basic protein and peptide science for proteomics. Henrik Johansson Basic protein and peptide science for proteomics Henrik Johansson Proteins are the main actors in the cell Membranes Transport and storage Chemical factories DNA Building proteins Structure Proteins mediate

More information

Workflows and Pipelines for NGS analysis: Lessons from proteomics

Workflows and Pipelines for NGS analysis: Lessons from proteomics Workflows and Pipelines for NGS analysis: Lessons from proteomics Conference on Applying NGS in Basic research Health care and Agriculture 11 th Sep 2014 Debasis Dash Where are the protein coding genes

More information

Liver Mitochondria Proteomics Employing High-Resolution MS Technology

Liver Mitochondria Proteomics Employing High-Resolution MS Technology Liver Mitochondria Proteomics Employing High-Resolution MS Technology Jenny Ho, 1 Loïc Dayon, 2 John Corthésy, 2 Umberto De Marchi, 2 Antonio Núñez, 2 Andreas Wiederkehr, 2 Rosa Viner, 3 Michael Blank,

More information

Proteomics and Cancer

Proteomics and Cancer Proteomics and Cancer Japan Society for the Promotion of Science (JSPS) Science Dialogue Program at Niitsu Senior High School Niitsu, Niigata September 4th 2006 Vladimir Valera, M.D, PhD JSPS Postdoctoral

More information

Database Searching for Protein Identification and Characterization

Database Searching for Protein Identification and Characterization Database Searching for Protein Identification and Characterization John Cottrell Matrix Science http://tinyurl.com/e4brg jcottrell@matrixscience.com 1 Topics Methods of database searching Practical tips

More information

Application Note # ET-20 BioPharma Compass: A fully Automated Solution for Characterization and QC of Intact and Digested Proteins

Application Note # ET-20 BioPharma Compass: A fully Automated Solution for Characterization and QC of Intact and Digested Proteins Application Note # ET-20 BioPharma Compass: A fully Automated Solution for Characterization and QC of Intact and Digested Proteins BioPharma Compass TM is a fully automated solution for the rapid characterization

More information

Isotopic Resolution of Chromatographically Separated IdeS Subunits Using the X500B QTOF System

Isotopic Resolution of Chromatographically Separated IdeS Subunits Using the X500B QTOF System Isotopic Resolution of Chromatographically Separated IdeS Subunits Using the X500B QTOF System Fan Zhang 2, Sean McCarthy 1 1 SCIEX, MA, USA, 2 SCIEX, CA USA Analysis of protein subunits using high resolution

More information

Strategies for Quantitative Proteomics. Atelier "Protéomique Quantitative" La Grande Motte, France - June 26, 2007

Strategies for Quantitative Proteomics. Atelier Protéomique Quantitative La Grande Motte, France - June 26, 2007 Strategies for Quantitative Proteomics Atelier "Protéomique Quantitative", France - June 26, 2007 Bruno Domon, Ph.D. Institut of Molecular Systems Biology ETH Zurich Zürich, Switzerland OUTLINE Introduction

More information

Mass Spectrometry and Proteomics - Lecture 6 - Matthias Trost Newcastle University

Mass Spectrometry and Proteomics - Lecture 6 - Matthias Trost Newcastle University Mass Spectrometry and Proteomics - Lecture 6 - Matthias Trost Newcastle University matthias.trost@ncl.ac.uk Previously Quantitation techniques Label-free TMT SILAC Peptide identification and FDR 194 Lecture

More information

Representing Errors and Uncertainty in Plasma Proteomics

Representing Errors and Uncertainty in Plasma Proteomics Representing Errors and Uncertainty in Plasma Proteomics David J. States, M.D., Ph.D. University of Michigan Bioinformatics Program Proteomics Alliance for Cancer Genomics vs. Proteomics Genome sequence

More information

Confident Protein ID using Spectrum Mill Software

Confident Protein ID using Spectrum Mill Software Welcome to our E-Seminar: Confident Protein ID using Spectrum Mill Software Slide 1 Spectrum Mill Informatics Software Start with batches of raw MS data! Sp ec t ru m Mi ll Biologist-friendly answers!

More information

Shotgun Proteomics: How Confident are you in that Identification? or Statistical Evaluation of Shotgun Proteomic Data

Shotgun Proteomics: How Confident are you in that Identification? or Statistical Evaluation of Shotgun Proteomic Data Shotgun Proteomics: How Confident are you in that Identification? or Statistical Evaluation of Shotgun Proteomic Data Ron Orlando Complex Carbohydrate Research Center University of Georgia Athens, GA 30602

More information

Sequence Databases and database scanning

Sequence Databases and database scanning Sequence Databases and database scanning Marjolein Thunnissen Lund, 2012 Types of databases: Primary sequence databases (proteins and nucleic acids). Composite protein sequence databases. Secondary databases.

More information

ichemistry SOLUTIONS Integrated chemistries to boost mass spectrometry workflows

ichemistry SOLUTIONS Integrated chemistries to boost mass spectrometry workflows ichemistry SOLUTIONS Integrated chemistries to boost mass spectrometry workflows ichemistry SOLUTIONS ichemistry solutions ichemistry solutions are the world s only reagents and consumables that are customdesigned

More information

Optimization-Based Peptide Mass Fingerprinting for Protein Mixture Identification

Optimization-Based Peptide Mass Fingerprinting for Protein Mixture Identification Optimization-Based Peptide Mass Fingerprinting for Protein Mixture Identification Weichuan Yu, Ph.D. Department of Electronic and Computer Engineering The Hong Kong University of Science and Technology

More information

MBios 478: Mass Spectrometry Applications [Dr. Wyrick] Slide #1. Lecture 25: Mass Spectrometry Applications

MBios 478: Mass Spectrometry Applications [Dr. Wyrick] Slide #1. Lecture 25: Mass Spectrometry Applications MBios 478: Mass Spectrometry Applications [Dr. Wyrick] Slide #1 Lecture 25: Mass Spectrometry Applications Measuring Protein Abundance o ICAT o DIGE Identifying Post-Translational Modifications Protein-protein

More information

Comparability Analysis of Protein Therapeutics by Bottom-Up LC-MS with Stable Isotope-Tagged Reference Standards

Comparability Analysis of Protein Therapeutics by Bottom-Up LC-MS with Stable Isotope-Tagged Reference Standards Comparability Analysis of Protein Therapeutics by Bottom-Up LC-MS with Stable Isotope-Tagged Reference Standards 16 September 2011 Abbott Bioresearch Center, Worcester, MA USA Manuilov, A. V., C. H. Radziejewski

More information

Cell Signaling Technology

Cell Signaling Technology Cell Signaling Technology PTMScan Direct: Multipathway v2.0 Proteomics Service Group January 14, 2013 PhosphoScan Deliverables Project Overview Methods PTMScan Direct: Multipathway V2.0 (Tables 1,2) Qualitative

More information

Appendix. Table of contents

Appendix. Table of contents Appendix Table of contents 1. Appendix figures 2. Legends of Appendix figures 3. References Appendix Figure S1 -Tub STIL (41) DVFFYQADDEHYIPR (55) (64) AVLLDLEPR (72) 1 451aa (1071) YLNENQLSQLSVTR (1084)

More information

11/22/13. Proteomics, functional genomics, and systems biology. Biosciences 741: Genomics Fall, 2013 Week 11

11/22/13. Proteomics, functional genomics, and systems biology. Biosciences 741: Genomics Fall, 2013 Week 11 Proteomics, functional genomics, and systems biology Biosciences 741: Genomics Fall, 2013 Week 11 1 Figure 6.1 The future of genomics Functional Genomics The field of functional genomics represents the

More information

Exam MOL3007 Functional Genomics

Exam MOL3007 Functional Genomics Faculty of Medicine Department of Cancer Research and Molecular Medicine Exam MOL3007 Functional Genomics Thursday December 20 th 9.00-13.00 ECTS credits: 7.5 Number of pages (included front-page): 5 Supporting

More information

Combination of Isobaric Tagging Reagents and Cysteinyl Peptide Enrichment for In-Depth Quantification

Combination of Isobaric Tagging Reagents and Cysteinyl Peptide Enrichment for In-Depth Quantification Combination of Isobaric Tagging Reagents and Cysteinyl Peptide Enrichment for In-Depth Quantification Protein Expression Analysis using the TripleTOF 5600 System and itraq Reagents Vojtech Tambor 1, Christie

More information

Mass Spectrometry in Proteomics

Mass Spectrometry in Proteomics Mass Spectrometry in Proteomics Bin Ma Assistant Professor Canada Research Chair in Bioinformatics Department of Computer Science University of Western Ontario bma@csd.uwo.ca From the Genome to the Proteome

More information

Filter-based Protein Digestion (FPD): A Detergent-free and Scaffold-based Strategy for TMT workflows

Filter-based Protein Digestion (FPD): A Detergent-free and Scaffold-based Strategy for TMT workflows Supporting Information Filter-based Protein Digestion (FPD): A Detergent-free and Scaffold-based Strategy for TMT workflows Ekaterina Stepanova 1, Steven P. Gygi 1, *, Joao A. Paulo 1, * 1 Department of

More information

with Database Search of Tandem Mass Spectra

with Database Search of Tandem Mass Spectra MCP Papers in Press. Published on August 14, 2008 as Manuscript M800103-MCP200 Spectral Dictionaries: Integrating De Novo Peptide Sequencing with Database Search of Tandem Mass Spectra Sangtae Kim 1, Nitin

More information

Biotherapeutic Non-Reduced Peptide Mapping

Biotherapeutic Non-Reduced Peptide Mapping Biotherapeutic Non-Reduced Peptide Mapping Routine non-reduced peptide mapping of biotherapeutics on the X500B QTOF System Method details for the routine non-reduced peptide mapping of a biotherapeutic

More information

Supplementary information, Figure S1A ShHTL7 interacted with MAX2 but not another F-box protein COI1.

Supplementary information, Figure S1A ShHTL7 interacted with MAX2 but not another F-box protein COI1. GR24 (μm) 0 20 0 20 GST-ShHTL7 anti-gst His-MAX2 His-COI1 PVDF staining Supplementary information, Figure S1A ShHTL7 interacted with MAX2 but not another F-box protein COI1. Pull-down assays using GST-ShHTL7

More information

with Database Search of Tandem Mass Spectra

with Database Search of Tandem Mass Spectra MCP Papers in Press. Published on August 14, 2008 as Manuscript M800103-MCP200 Spectral Dictionaries: Integrating De Novo Peptide Sequencing with Database Search of Tandem Mass Spectra Sangtae Kim 1, Nitin

More information

Hongwei Xie, Martin Gilar, and John C. Gebler Waters Corporation, Milford, MA, U.S.A. INTRODUCTION EXPERIMENTAL

Hongwei Xie, Martin Gilar, and John C. Gebler Waters Corporation, Milford, MA, U.S.A. INTRODUCTION EXPERIMENTAL Analysis of Deamidation and Oxidation in MONOCLONAL Antibody Using Peptide Mapping with UPLC/MS E Hongwei Xie, Martin Gilar, and John C. Gebler Waters Corporation, Milford, MA, U.S.A. INTRODUCTION Monoclonal

More information

Instrumental Solutions for Metabolomics

Instrumental Solutions for Metabolomics Instrumental Solutions for Metabolomics Dr. Desislav Donchev US14702384-16012196010132-S01-A01.tif 300 400 500 600 700 800 3100 3200 3300 3400 3500 3600 3700 3800 Color Scale R = [52 1484] G = [26 514]

More information

Nature Biotechnology: doi: /nbt Supplementary Figure 1

Nature Biotechnology: doi: /nbt Supplementary Figure 1 Supplementary Figure 1 The mass accuracy of fragment ions is important for peptide recovery in wide-tolerance searches. The same data as in Figure 1B was searched with varying fragment ion tolerances (FIT).

More information

Protein De novo Sequencing

Protein De novo Sequencing Protein De novo Sequencing by Rong Wang A thesis presented to the University of Waterloo in fulfillment of the thesis requirement for the degree of Master of Mathematics in Computer Science Waterloo, Ontario,

More information

LC/MS/MS Solutions for Biomarker Discovery QSTAR. Elite Hybrid LC/MS/MS System. More performance, more reliability, more answers

LC/MS/MS Solutions for Biomarker Discovery QSTAR. Elite Hybrid LC/MS/MS System. More performance, more reliability, more answers LC/MS/MS Solutions for Biomarker Discovery QSTAR Elite Hybrid LC/MS/MS System More performance, more reliability, more answers More is better and the QSTAR Elite LC/MS/MS system has more to offer. More

More information

The best proteomics: combination of upfront reduction of sample complexity, reproducible resolution, and effective follow up

The best proteomics: combination of upfront reduction of sample complexity, reproducible resolution, and effective follow up The best proteomics: combination of upfront reduction of sample complexity, reproducible resolution, and effective follow up Helen Kim, Ph.D. Dept of Pharmacology & Toxicology University of Alabama at

More information

Protein Bioinformatics Part I: Access to information

Protein Bioinformatics Part I: Access to information Protein Bioinformatics Part I: Access to information 260.655 April 6, 2006 Jonathan Pevsner, Ph.D. pevsner@kennedykrieger.org Outline [1] Proteins at NCBI RefSeq accession numbers Cn3D to visualize structures

More information

Supplementary Information

Supplementary Information Identifying sources of tick blood meals using unidentified tandem mass spectral libraries Özlem Önder 1, Wenguang Shao 2, Brian Kemps 1, Henry Lam 2,3,*, Dustin Brisson 1,* 1 Department of Biology, University

More information