Protein-Ligand Analysis with SID
|
|
- Gwendoline Ramsey
- 6 years ago
- Views:
Transcription
1 Protein-Ligand Analysis with SID A new post-simulation analysis tool Dmitry Lupyan, PhD
2 Understanding molecular processes with MD Drug discovery and design Protein-protein interactions + Protein-DNA interactions Protein folding Liang Z et al., PLOSOne 2011 van Dijk et al., Nucl. Acid Res Stranges et al., 2011 PNAS
3 Syk interactions w/inhibitor Spleen Tyrosine Kinase (Syk) with type-ii inhibitor (3tub) Syk interactions with the ligand described as: "The quinoline occupies the ATP pocket interacting with Ala451. The urea makes an H-bond to Asp512 of the DFG sequence as well as Glu420 off the Chelix. The cyclopropyl aryl induces a DFG-out conformation with terminal aryl ring occupying the DFG-out pocket." Lovering et. al. Chem Biol Drug Des (80) 2012
4 Syk interactions w/inhibitor publication Schrödinger tools PDB
5 Typical workflow for analyzing MD simulation of a Protein-Ligand Complex Run MD simulation Check system energy, box size, temperature Calculate RMSD of the protein Calculate RMSD of the ligand Calculate RMSF of the protein Scale RMSF and check if B factor agree with RMSF Figure out if high RMSF values correlate to loops 6. Display protein within 3 Å of a ligand Play/animate trajectory several times Setup up to 100 various measurements to figure out what are the predominant protein-ligand interactions 7. Generate snapshots and plots to communicate my findings 8. Put together a PowerPoint or write up a report
6 Analyzing MD simulation of a Protein-Ligand Complex with SID 1. Run MD simulation 2. Run analysis manually: launch SID automatically: by adding pl_analysis{ } to the msj file 3. View results in SID panel, or export as PDF report/images
7 Analyzing MD simulation of a Protein-Ligand Complex with SID 1. Run MD simulation 2. Run analysis manually: launch SID automatically: by adding pl_analysis{} to the msj file 3. View results in SID panel, or export as PDF report/images Contacts Contacts RMSD RMSF RMSF Rot. Bonds
8 Computed Properties Protein RMSD/RMSF Ligand RMSD/RMSF Secondary structure elements Protein-Ligand contacts Ligand conformational analysis Applications Desmond Simulation Interactions Diagram
9 Protein-Ligand RMSD (PL-RMSD Tab) Protein RMSD Ligand RMSD C-alpha Backbone Side chains Heavy atoms Aligned on Ligand Aligned on Protein Plot feedback
10 Protein RMSF (P-RMSF Tab) Protein RMSF Additionally C-alpha Backbone Side chains Heavy atoms Secondary Structure B factor Ligand contacts Plot feedback
11 Ligand RMSF (L-RMSF Tab) Ligand RMSF Aligned on protein Aligned on ligand Interactive 2d feedback plot feedback
12 Protein-Ligand Contacts (PL-Contacts Tab) Histogram 4 main contact types 11 contact subtypes toggle on/off contacts Timeline View H-bonds Hydrophobic Ionic Water bridges Total # of contacts When/where and how many contact occurred Navigate the trajectory
13 Protein-Ligand Contacts (PL-Contacts Tab) Histogram 4 main contact types H-bonds Hydrophobic Ionic Water bridges
14 Protein-Ligand Contacts (PL-Contacts Tab) Histogram 4 main contact types H-bonds Hydrophobic Ionic Water bridges
15 Protein-Ligand Contacts (PL-Contacts Tab) Timeline View Total # of contacts When/where and how many contact occurred
16 Ligand-Protein Contacts (LP-Contacts Tab) Contacts mapped onto 2-D ligand Change interaction cutoff Navigate the trajectory
17 Ligand Torsions/Rotatable Bonds (L-Torsions Tab) Timeseries of all RB in the ligand Distribution of RB Show torsion potential (OPLS_2005) of all RB
18 Ligand Torsions/Rotatable Bonds (L-Torsions Tab) Timeseries of all RB in the ligand Distribution of RB Show torsion potential (OPLS_2005) of all RB
19 Pyridine Ring Flip N
20 Pyridine Ring Flip publication (3tub.pdb)
21 Does MD add anything new? Syk interactions in publication: "The quinoline occupies the ATP pocket interacting with Ala451. The urea makes an Hbond to Asp512 of the DFG sequence as well as Glu420 off the C-helix. The cyclopropyl aryl induces a DFG-out conformation with terminal aryl ring occupying the DFG-out pocket." With MD analysis, description now can be rewritten: "The quinoline occupies the solvent accessible ATP pocket and H-bonds with the backbone Ala451 via transient interactions. The urea is coordinated predominantly by Glu420 and Asp512, via side chain and backbone, respectively. The pyridine interacts with Phe513 via a intermittent Pi-Pi stacking interaction, as well as Lys402 via side chain H-bond. The cyclopropyl aryl induces a DFG-out conformation with terminal aryl ring, from Phe490, occupying the DFG-out pocket."
22 Export Data, images, create PDF Reports Easily export all plots in PNG and SVG formats Easily export all data into a text file (fixed width) Export PDF report with detail description for each plot to your collegue for ELN for future reference for printing it out and taking it home
23 New direction... Intuitive and easy to use Automation Standardize set of analyses for a given task Used for validation as well as exploration Emphasize visualization is the protein stable? does the ligand remain bound? what type of H-bond or Hydrophobic interaction is this? publication/presentation ready Results should be easy to share Modular framework for customization
24 What's next for prot-lig interactions? SSE GUI panel more interaction types: Ion and metal interactions halogen pi-amide symmetry for ligand RMSD ligand properties: intramolecular hydrogen bonds ionic hydrophobic radius of gyration Mol-SA/SASA/PSA Energetic analyses Workspace interactivity SiteMap integration Fingerprints Clustering Compare simulations Better characterization of ligandwater interactions
25 Thank You! PyDev Pat Lorton, PyD Alex Smondyrev, PhD Kevin Keating, PhD Nicola Zonta, PhD Desmond Teng Lin, PhD Byungchan Kim, PhD Yujie Wu, PhD AppSci/Science Woody Sherman, PhD Thijs Beuming, PhD Dora Warshaviak, PhD Robert Abel, PhD Goran Krilov, PhD UI/UX Mihai Coman Evan Sheehan, MA Evelyn Chambers
26 More information on SID Video tutorial: Desmond User Manual In Maestro, Help > Manuals Index > Desmond User Manual Newsletter: LinkedIn: Dmitry Lupyan
Protocol S1: Supporting Information
Protocol S1: Supporting Information Basis for the specificity of the kinase domain of Abl for peptide substrates The crystal structures reported in this work were obtained using two different ATP analog-peptide
More informationPacking of Secondary Structures
7.88 Lecture Notes - 5 7.24/7.88J/5.48J The Protein Folding and Human Disease Packing of Secondary Structures Packing of Helices against sheets Packing of sheets against sheets Parallel Orthogonal Table:
More informationNanobiotechnology. Place: IOP 1 st Meeting Room Time: 9:30-12:00. Reference: Review Papers. Grade: 50% midterm, 50% final.
Nanobiotechnology Place: IOP 1 st Meeting Room Time: 9:30-12:00 Reference: Review Papers Grade: 50% midterm, 50% final Midterm: 5/15 History Atom Earth, Air, Water Fire SEM: 20-40 nm Silver 66.2% Gold
More informationX-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction
X-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction Tomohisa Shimasaki 1, Hiromi Yoshida 2, Shigehiro Kamitori 2 & Koji
More informationΤάσος Οικονόµου ιαλεξη 8. Kινηση, λειτουργια, ελεγχος.
Τάσος Οικονόµου ιαλεξη 8 Kινηση, λειτουργια, ελεγχος http://ecoserver.imbb.forth.gr/bio321.htm εν ξεχνω. Cell The peptide bond Polypeptides are stabilized by: 1. Covalent bonds= amide bond 2. Noncovalent,
More informationVirtual bond representation
Today s subjects: Virtual bond representation Coordination number Contact maps Sidechain packing: is it an instrumental way of selecting and consolidating a fold? ASA of proteins Interatomic distances
More informationZool 3200: Cell Biology Exam 3 3/6/15
Name: Trask Zool 3200: Cell Biology Exam 3 3/6/15 Answer each of the following questions in the space provided; circle the correct answer or answers for each multiple choice question and circle either
More informationHomology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen
Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Secondary Structure Prediction
CMPS 6630: Introduction to Computational Biology and Bioinformatics Secondary Structure Prediction Secondary Structure Annotation Given a macromolecular structure Identify the regions of secondary structure
More informationHomology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen
Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,
More informationCSE : Computational Issues in Molecular Biology. Lecture 19. Spring 2004
CSE 397-497: Computational Issues in Molecular Biology Lecture 19 Spring 2004-1- Protein structure Primary structure of protein is determined by number and order of amino acids within polypeptide chain.
More informationStructural Bioinformatics (C3210) DNA and RNA Structure
Structural Bioinformatics (C3210) DNA and RNA Structure Importance of DNA/RNA 3D Structure Nucleic acids are essential materials found in all living organisms. Their main function is to maintain and transmit
More informationBuilding an Antibody Homology Model
Application Guide Antibody Modeling: A quick reference guide to building Antibody homology models, and graphical identification and refinement of CDR loops in Discovery Studio. Francisco G. Hernandez-Guzman,
More informationConformational Equilibria and Free Energy Profiles for the Allosteric Transition of the Ribose-binding Protein
doi:10.1016/j.jmb.2005.08.009 J. Mol. Biol. (2005) 353, 196 210 Conformational Equilibria and Free Energy Profiles for the Allosteric Transition of the Ribose-binding Protein Krishna Pratap Ravindranathan,
More informationSolution Structure of the DNA-binding Domain of GAL4 from Saccharomyces cerevisiae
Vol. 14, No. 1-4 175 Solution Structure of the DNA-binding Domain of GAL4 from Saccharomyces cerevisiae James D. Baleja, V. Thanabal, Ted Mau, and Gerhard Wagner Department of Biological Chemistry and
More informationStructural bioinformatics
Structural bioinformatics Why structures? The representation of the molecules in 3D is more informative New properties of the molecules are revealed, which can not be detected by sequences Eran Eyal Plant
More informationAll Rights Reserved. U.S. Patents 6,471,520B1; 5,498,190; 5,916, North Market Street, Suite CC130A, Milwaukee, WI 53202
Secondary Structure In the previous protein folding activity, you created a hypothetical 15-amino acid protein and learned that basic principles of chemistry determine how each protein spontaneously folds
More informationDocking and Design with AutoDock. David S. Goodsell Arthur J. Olson The Scripps Research Institute
Docking and Design with AutoDock David S. Goodsell Arthur J. Olson The Scripps Research Institute Rapid automated docking using: Grid-based energy evaluation Torsion-only conformation search AutoDock History
More informationInvestigating the interactions of FCS-304 and other Monoamine Oxidase (MAO) A Inhibitors Using Molecular Docking
Available online at www.scholarsresearchlibrary.com J. Comput. Method. Mol. Design, 2011, 1 (3): 24-28 (http://scholarsresearchlibrary.com/archive.html) ISSN : 2231-3176 CODEN (USA): JCMMDA Investigating
More informationSupplementary Figure 2 Diagram of the expression vector pet28a with an individual gene of interest. Nature Methods: doi: /nmeth.
Supplementary Figure 1 Microfluidic chip overview. (a) Photograph of a microfluidic chip bonded to a glass slide with a US dime for scale. Control channels are filled with food dye for better visualization.
More informationTERTIARY MOTIF INTERACTIONS ON RNA STRUCTURE
1 TERTIARY MOTIF INTERACTIONS ON RNA STRUCTURE Bioinformatics Senior Project Wasay Hussain Spring 2009 Overview of RNA 2 The central Dogma of Molecular biology is DNA RNA Proteins The RNA (Ribonucleic
More informationHomology modeling and structural validation of tissue factor pathway inhibitor
www.bioinformation.net Hypothesis Volume 9(16) Homology modeling and structural validation of tissue factor pathway inhibitor Piyush Agrawal, Zoozeal Thakur & Mahesh Kulharia* Centre for Bioinformatics,
More informationStructure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München
Structure formation and association of biomolecules Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Motivation Many biomolecules are chemically synthesized
More informationIntroduction to Proteins
Introduction to Proteins Lecture 4 Module I: Molecular Structure & Metabolism Molecular Cell Biology Core Course (GSND5200) Matthew Neiditch - Room E450U ICPH matthew.neiditch@umdnj.edu What is a protein?
More informationOracle Fusion Talent Management
Oracle Fusion Talent Management Service Oracle Fusion Talent Management IT Consultancy Service Oracle Fusion Talent Management Approach & Features Contents Oracle Fusion Talent Management... 3 A. Oracle
More informationReference Guide for Employees: Halogen eappraisal
Reference Guide for Employees: Halogen eappraisal Purpose of the Evaluation Process: eappraisal was designed for managers to evaluate employee performance and achievement for the past year, as well as
More informationLigand docking and binding site analysis with pymol and autodock/vina
International Journal of Basic and Applied Sciences, 4 (2) (2015) 168-177 www.sciencepubco.com/index.php/ijbas Science Publishing Corporation doi: 10.14419/ijbas.v4i2.4123 Research Paper Ligand docking
More informationBETA STRAND Prof. Alejandro Hochkoeppler Department of Pharmaceutical Sciences and Biotechnology University of Bologna
Prof. Alejandro Hochkoeppler Department of Pharmaceutical Sciences and Biotechnology University of Bologna E-mail: a.hochkoeppler@unibo.it C-ter NH and CO groups: right, left, right (plane of the slide)
More informationYour Name: MID TERM ANSWER SHEET SIN: ( )
MIDTERM EXAMINATION (October 23, 2008) BIOE150. Introduction to Bio-Nanoscience & Bio-Nanotechnology Professor Seung-Wuk Lee Fall Semester, 2008 0. Write down your name and the last digit of your SIN in
More informationSUPPLEMENTARY MATERIAL
SUPPLEMENTARY MATERIAL Section 1 Supp. Figure 1. Target-template alignments Alignments of each target sequence with their respective template sequence (PDB code) are shown in a) for attoc64-v TPR with
More informationChapter 3 Nucleic Acids, Proteins, and Enzymes
3 Nucleic Acids, Proteins, and Enzymes Chapter 3 Nucleic Acids, Proteins, and Enzymes Key Concepts 3.1 Nucleic Acids Are Informational Macromolecules 3.2 Proteins Are Polymers with Important Structural
More informationProteins Higher Order Structures
Proteins Higher Order Structures Dr. Mohammad Alsenaidy Department of Pharmaceutics College of Pharmacy King Saud University Office: AA 101 msenaidy@ksu.edu.sa Previously on PHT 426!! Protein Structures
More informationProtein Bioinformatics PH Final Exam
Name (please print) Protein Bioinformatics PH260.655 Final Exam => take-home questions => open-note => please use either * the Word-file to type your answers or * print out the PDF and hand-write your
More informationOverview. Secondary Structure. Tertiary Structure
Protein Structure Disclaimer: All information and images were taken from outside sources and the author claims no legal ownership of any material. Sources for images are linked on each slide and the information
More informationProt-SSP: A Tool for Amino Acid Pairing Pattern Analysis in Secondary Structures
Mol2Net, 2015, 1(Section F), pages 1-6, Proceedings 1 SciForum Mol2Net Prot-SSP: A Tool for Amino Acid Pairing Pattern Analysis in Secondary Structures Miguel de Sousa 1, *, Cristian R. Munteanu 2 and
More informationSTRUCTURAL BIOLOGY. α/β structures Closed barrels Open twisted sheets Horseshoe folds
STRUCTURAL BIOLOGY α/β structures Closed barrels Open twisted sheets Horseshoe folds The α/β domains Most frequent domain structures are α/β domains: A central parallel or mixed β sheet Surrounded by α
More informationCristian Micheletti SISSA (Trieste)
Cristian Micheletti SISSA (Trieste) michelet@sissa.it Mar 2009 5pal - parvalbumin Calcium-binding protein HEADER CALCIUM-BINDING PROTEIN 25-SEP-91 5PAL 5PAL 2 COMPND PARVALBUMIN (ALPHA LINEAGE) 5PAL 3
More informationNucleic Acids, Proteins, and Enzymes
3 Nucleic Acids, Proteins, and Enzymes Chapter 3 Nucleic Acids, Proteins, and Enzymes Key Concepts 3.1 Nucleic Acids Are Informational Macromolecules 3.2 Proteins Are Polymers with Important Structural
More informationIntroduction to Bioinformatics
Introduction to Bioinformatics http://1.51.212.243/bioinfo.html Dr. rer. nat. Jing Gong Cancer Research Center School of Medicine, Shandong University 2011.10.19 1 Chapter 4 Structure 2 Protein Structure
More informationHalogen Goal Setting. Halogen Goal Setting Manager Guide. for Principal Investigators
Halogen Goal Setting Halogen Goal Setting Manager Guide Manager Guide for Principal Investigators Contents Goal Setting Process... 1 Completing the Online Goal Setting Form... 4 Important Notes... 9 Reviewing
More informationPolypeptide backbone (or the main chain)
Polypeptide backbone (or the main chain) [IUPA-IUB ommission on Biochemical omenclature, Abbreviations and Symbols for the Description of the onfor mation of Polypeptide hains. Eur. J. Biochem., 969, 7,
More informationMolecular BioSystems PAPER
Molecular BioSystems Cite this: Mol. BioSyst., 2012, 8, 2680 2691 www.rsc.org/molecularbiosystems Dynamic Article Links PAPER Functional annotation of the mesophilic-like character of mutants in a cold-adapted
More informationinfo@rcsb.org www.pdb.org Bioinformatics of Green Fluorescent Protein This bioinformatics tutorial explores the relationship between gene sequence, protein structure, and biological function in the context
More informationPeakForce Tapping and ScanAsyst An introduction to the technique featuring Bruker s Dimension Edge. Bede Pittenger, Ph.D.
PeakForce Tapping and ScanAsyst An introduction to the technique featuring Bruker s Dimension Edge Bede Pittenger, Ph.D. Dimension Edge with ScanAsyst: High performance AFM breaking down cost and productivity
More informationMolecular docking is one of the widely used approaches
pubs.acs.org/jcim How Good Are State-of-the-Art Docking Tools in Predicting Ligand Binding Modes in Protein Protein Interfaces? Dennis M. Kru ger, Gisela Jessen, and Holger Gohlke* Institute of Pharmaceutical
More informationSupplementary materials. Computational study of β-n-acetylhexosaminidase from. Talaromyces flavus, a glycosidase with high substrate flexibility
Supplementary materials Computational study of β-n-acetylhexosaminidase from Talaromyces flavus, a glycosidase with high substrate flexibility Natallia Kulik 1,*, Kristýna Slámová 2, Rüdiger Ettrich 1,3,
More informationIntegrating multi-scale data on homologous recombination into a new recognition mechanism based on simulations of the RecA-ssDNA/dsDNA structure
Published online 17 September 2015 Nucleic Acids Research, 2015, Vol. 43, No. 21 10251 10263 doi: 10.1093/nar/gkv883 Integrating multi-scale data on homologous recombination into a new recognition mechanism
More informationStructure/function relationship in DNA-binding proteins
PHRM 836 September 22, 2015 Structure/function relationship in DNA-binding proteins Devlin Chapter 8.8-9 u General description of transcription factors (TFs) u Sequence-specific interactions between DNA
More informationMOLECULAR DOCKING STUDIES FOR IDENTIFICATION OF POTENT PHOSPHOINOSITIDE 3-KINASES (PI3KS) INHIBITORS
CHAPTER 7 MLECULAR DCKIG STUDIES FR IDETIFICATI F PTET PHSPHISITIDE 3-KIASES (PI3KS) IHIBITRS 7.1 Introduction Phosphoinositide 3 kinases (PI3Ks) constitute a class of enzymes that catalyse phosphorylation
More information2/23/16. Protein-Protein Interactions. Protein Interactions. Protein-Protein Interactions: The Interactome
Protein-Protein Interactions Protein Interactions A Protein may interact with: Other proteins Nucleic Acids Small molecules Protein-Protein Interactions: The Interactome Experimental methods: Mass Spec,
More informationSupporting Online Material. Av1 and Av2 were isolated and purified under anaerobic conditions according to
Supporting Online Material Materials and Methods Av1 and Av2 were isolated and purified under anaerobic conditions according to published protocols (S1). Crystals of nf-, pcp- and adp-av2:av1 complexes
More informationProtein 3D Structure Prediction
Protein 3D Structure Prediction Michael Tress CNIO ?? MREYKLVVLGSGGVGKSALTVQFVQGIFVDE YDPTIEDSYRKQVEVDCQQCMLEILDTAGTE QFTAMRDLYMKNGQGFALVYSITAQSTFNDL QDLREQILRVKDTEDVPMILVGNKCDLEDER VVGKEQGQNLARQWCNCAFLESSAKSKINVN
More informationReference Guide for Managers: Halogen eappraisal
Reference Guide for Managers: Halogen eappraisal Purpose of the Evaluation Process: eappraisal was designed for managers to evaluate employee performance and achievement for the past year, as well as to
More informationChimeric Protein Engineering
International Journal of Peptide Research and Therapeutics (Ó 2007) DOI: 10.1007/s10989-006-9058-8 Chimeric Protein Engineering Jianwen A. Feng, 1 Lee A. Tessler 1 and Garland R. Marshall 1,2 (Accepted
More informationKinetics Review. Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets)
Quiz 1 Kinetics Review Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets) I will post the problems with solutions on Toolkit for those that can t make
More informationISSN Volume 2 (2015) The 3rd International Conference on Biological Science 2013 (The 3rd ICBS-2013)
ISSN 2413-0877 Volume 2 (2015) 416-421 The 3rd International Conference on Biological Science 2013 (The 3rd ICBS-2013) THE COMPUTATION OF CYCLIC PEPTIDE WITH PROLIN-PROLIN BOND AS FUSION INHIBITOR OF DENV
More informationgreen B 1 ) into a single unit to model the substrate in this reaction. enzyme
Teacher Key Objectives You will use the model pieces in the kit to: Simulate enzymatic actions. Explain enzymatic specificity. Investigate two types of enzyme inhibitors used in regulating enzymatic activity.
More informationCOMPUTATIONAL CHEMISTRY OF THE PORPHYRIN RING SYSTEM
Proceedings of the South Dakota Academy of Science, Vol. 80 (2001) 129 COMPUTATIONAL CHEMISTRY OF THE PORPHYRIN RING SYSTEM Kari Lunder and Arlen Viste Department of Chemistry Augustana College Sioux Falls,
More informationVirtual Screening of compounds to 1-deoxy-Dxylulose 5-phosphate reductoisomerase (DXR) from Plasmodium falciparum
www.bioinformation.net Hypothesis Volume 10(6) Virtual Screening of compounds to 1-deoxy-Dxylulose 5-phosphate reductoisomerase (DXR) from Plasmodium falciparum Kamal Kumar Chaudhary & C.V.S. Siva Prasad*
More informationC. Tight Turns. = -30, φ 3. = 0, and type II approximately = 120, φ 3. = -60, ψ 2. = -90, ψ 3. = +90, ψ 3
Tight turns (also known as reverse turns, β turns, β bends, hairpin bends, 310 bends, kinks, widgets, etc.) are the first and most prevalent type of nonrepetitive structure that has been recognized. While
More informationAstronomy picture of the day (4/21/08)
Biol 205 Spring 2008 Astronomy picture of the day (4/21/08) http://antwrp.gsfc.nasa.gov/apod/ap080421.html Are viruses alive? http://serc.carleton.edu/microbelife/yellowstone/viruslive.html 1 Week 3 Lecture
More informationThe replication of DNA Kornberg 1957 Meselson and Stahl 1958 Cairns 1963 Okazaki 1968 DNA Replication The driving force for DNA synthesis. The addition of a nucleotide to a growing polynucleotide
More informationCase 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005
Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 9 September 005 Focus concept Purification of a novel seed storage protein allows sequence analysis and
More informationMCB 110:Biochemistry of the Central Dogma of MB. MCB 110:Biochemistry of the Central Dogma of MB
MCB 110:Biochemistry of the Central Dogma of MB Part 1. DNA replication, repair and genomics (Prof. Alber) Part 2. RNA & protein synthesis. Prof. Zhou Part 3. Membranes, protein secretion, trafficking
More informationProtein Structure Prediction by Constraint Logic Programming
MPRI C2-19 Protein Structure Prediction by Constraint Logic Programming François Fages, Constraint Programming Group, INRIA Rocquencourt mailto:francois.fages@inria.fr http://contraintes.inria.fr/ Molecules
More informationFrom Variants to Pathways: Agilent GeneSpring GX s Variant Analysis Workflow
From Variants to Pathways: Agilent GeneSpring GX s Variant Analysis Workflow Technical Overview Import VCF Introduction Next-generation sequencing (NGS) studies have created unanticipated challenges with
More informationDefect report-step ABC. Figure 1: YieldManager s enhanced automation framework embeds decision making processes through data analysis
DATASHEET YieldManager Customizable yield management for IC manufacturers Overview For semiconductor foundries and IDMs that must maintain high yield for their products and real-time identification of
More informationUNIFI: The user environment Ken Eglinton Nordic User Training, September 2013
UNIFI: The user environment Ken Eglinton Nordic User Training, September 2013 2013 Waters Corporation 1 What is UNIFI? Single Platform for Chromatography, Mass Spectrometry, Data Management and Laboratory
More informationThe Double Helix. DNA and RNA, part 2. Part A. Hint 1. The difference between purines and pyrimidines. Hint 2. Distinguish purines from pyrimidines
DNA and RNA, part 2 Due: 3:00pm on Wednesday, September 24, 2014 You will receive no credit for items you complete after the assignment is due. Grading Policy The Double Helix DNA, or deoxyribonucleic
More informationChem 465 Biochemistry II
Chem 465 Biochemistry II Name: 2 points Multiple choice (4 points apiece): 1. Which of the following is not true of trna molecules? A) The 3'-terminal sequence is -CCA. B) Their anticodons are complementary
More informationGENETICS الفريق الطبي االكاديمي. DNA Genes & Chromosomes. DONE BY : Buthaina Al-masaeed & Yousef Qandeel. Page 0
GENETICS ومن أحياها DNA Genes & Chromosomes الفريق الطبي االكاديمي DNA Genes & Chromosomes DONE BY : Buthaina Al-masaeed & Yousef Qandeel Page 0 T(0:44 min) In the pre lecture we take about the back bone
More information36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L-
36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L- 37. The essential fatty acids are A. palmitic acid B. linoleic acid C. linolenic
More informationMasayoshi Honda, Jeehae Park, Robert A. Pugh, Taekjip Ha, and Maria Spies
Molecular Cell, Volume 35 Supplemental Data Single-Molecule Analysis Reveals Differential Effect of ssdna-binding Proteins on DNA Translocation by XPD Helicase Masayoshi Honda, Jeehae Park, Robert A. Pugh,
More informationSimulation study of the role of ribosomal exit tunnel on protein folding. Biomolecular Physics and Modeling Group, Department of Physics
Simulation study of the role of ribosomal exit tunnel on protein folding Changjun Chen +, Ercheng Wang +, Pengyu Liu and Yi Xiao* Biomolecular Physics and Modeling Group, Department of Physics Huazhong
More informationMultiple choice questions (numbers in brackets indicate the number of correct answers)
1 Multiple choice questions (numbers in brackets indicate the number of correct answers) February 1, 2013 1. Ribose is found in Nucleic acids Proteins Lipids RNA DNA (2) 2. Most RNA in cells is transfer
More informationBIOCHEMISTRY Nucleic Acids
BIOCHEMISTRY Nucleic Acids BIOB111 CHEMISTRY & BIOCHEMISTRY Session 17 Session Plan Types of Nucleic Acids Nucleosides Nucleotides Primary Structure of Nucleic Acids DNA Double Helix DNA Replication Types
More information24.5. Lesson 24.5 Nucleic Acids. Overview. In this lesson, you will cover the topics of DNA replication, gene mutation, and DNA technologies.
24.5 Lesson 24.5 Nucleic Acids Objectives 24.5.1 Identify the functions of DNA and RNA. 24.5.2 Identify the number of bases of DNA required to specify one amino acid in a peptide chain. 24.5.3 Explain
More informationWrite down your name and the last 4 digits of your SID on all the pages (1)
* MIDTERM EXAMINATION (Oct 20, 2015) BIOE150. Introduction to Bio-Nanoscience & Bio- Nanotechnology Fall Semester, 2015 Write down your name and the last 4 digits of your SID on all the pages (1) 1. Define
More informationEvalS. Performance Evaluation Management System. Professional Faculty Supervisor Guide to EvalS
EvalS Performance Evaluation Management System Professional Faculty Supervisor Guide to EvalS Professional Faculty Supervisor User s Guide to EvalS Logging on to the EvalS System You will receive an email
More informationRNA Structure Prediction and Comparison. RNA Biology Background
RN Structure Prediction and omparison Session 1 RN Biology Background Robert iegerich Faculty of Technology robert@techfak.ni-bielefeld.de October 13, 2013 Robert iegerich Overview of lecture topics The
More informationWhat Is the Role of Motif D in the Nucleotide Incorporation Catalyzed by the RNA-dependent RNA Polymerase from Poliovirus?
What Is the Role of Motif D in the Nucleotide Incorporation Catalyzed by the RNA-dependent RNA Polymerase from Poliovirus? Hujun Shen., Hui Sun., Guohui Li* Laboratory of Molecular Modeling and Design,
More informationFinal exam. Please write your name on the exam and keep an ID card ready.
Biophysics of Macromolecules Prof. R. Jungmann and Prof. J. Lipfert SS 2017 Final exam Final exam First name: Last name: Student number ( Matrikelnummer ): Please write your name on the exam and keep an
More informationUV Fluorescence Polarization as a Means to Investigate Protein Conformational and Mass Change
A p p l i c a t i o n N o t e UV Fluorescence Polarization as a Means to Investigate Protein Conformational and Mass Change Using Intrinsic Tryptophan Fluorescence in Conjunction with UV-capable Polarizers
More informationChapter 8 DNA Recognition in Prokaryotes by Helix-Turn-Helix Motifs
Chapter 8 DNA Recognition in Prokaryotes by Helix-Turn-Helix Motifs 1. Helix-turn-helix proteins 2. Zinc finger proteins 3. Leucine zipper proteins 4. Beta-scaffold factors 5. Others λ-repressor AND CRO
More informationMechanical Design of the Third FnIII Domain of Tenascin-C
doi:10.1016/j.jmb.2009.01.019 J. Mol. Biol. (2009) 386, 1327 1342 Available online at www.sciencedirect.com Mechanical Design of the Third FnIII Domain of Tenascin-C Qing Peng, Shulin Zhuang, Meijia Wang,
More informationTable S1. Crystallographic Data and Refinement Statistics, Related to Experimental Procedures hsddb1-drddb2 CPD
Data collection Table S1. Crystallographic Data and Refinement Statistics, Related to Experimental Procedures hsddb1-drddb2 CPD #1 hsddb1-drddb2 CPD #2 Values in parentheses are for the highest resolution
More informationDNA & Protein Synthesis UNIT D & E
DNA & Protein Synthesis UNIT D & E How this Unit is broken down Chapter 10.1 10.3 The structure of the genetic material Chapter 10.4 & 10.5 DNA replication Chapter 10.6 10.15 The flow of genetic information
More informationHighly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs
Technical Overview Highly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs Authors Stephen Madden, Crystal Cody, and Jungkap Park Agilent Technologies, Inc. Santa Clara, California,
More informationLearning to Use PyMOL (includes instructions for PS #2)
Learning to Use PyMOL (includes instructions for PS #2) To begin, download the saved PyMOL session file, 4kyz.pse from the Chem 391 Assignments web page: http://people.reed.edu/~glasfeld/chem391/assign.html
More informationPlant Proteomics Tutorial and Online Resources. Manish Raizada University of Guelph
Plant Proteomics Tutorial and Online Resources Manish Raizada University of Guelph A Brief Introduction to Proteins -A. Structural proteins make large structures (eg. microtubule cables to pull chromosomes
More informationMANAGE WORKFLOWS JOB AID
LAST UPDATED / March 13, 2014 MANAGE WORKFLOWS JOB AID TABLE OF CONTENTS Overview 2 1 Access Workflow Reporting Screens 3 2 View Initiated Workflow Segments: All, Completed 6 & Running (In-Progress) 3
More informationproteins Characterization of local geometry of protein surfaces with the visibility criterion
proteins STRUCTURE O FUNCTION O BIOINFORMATICS Characterization of local geometry of protein surfaces with the visibility criterion Bin Li, 1 Srinivasan Turuvekere, 2 Manish Agrawal, 2 David La, 3 Karthik
More informationCorrespondence and requests for materials should be addressed to D.M.
Correspondence and requests for materials should be addressed to D.M. (davide.maggi@unige.it) Metformin Impairs Glucose Consumption and Survival in Calu-1 Cells by Direct Inhibition of Hexokinase-II. Barbara
More informationRetrieving and Viewing Protein Structures from the Protein Data Base
Retrieving and Viewing Protein Structures from the Protein Data Base 7.88J Protein Folding Prof. David Gossard September 15, 2003 1 PDB Acknowledgements The Protein Data Bank (PDB - http://www.pdb.org/)
More informationStretching DNA as a template for molecular construction
title Workshop " DNA-Based Molecular Electronics" Jena, May 13-15, 2004 Stretching DNA as a template for molecular construction Masao Washizu 1, Yuji Kimura 1, Takuya Kobayashi 1, Osamu Kurosawa 1,2 Sayoko
More informationFunctional analysis using EBI Metagenomics
Functional analysis using EBI Metagenomics Contents Tutorial information... 2 Tutorial learning objectives... 2 An introduction to functional analysis using EMG... 3 What are protein signatures?... 3 Assigning
More informationAipotu I: Genetics & Biochemistry
Aipotu I: Genetics & Biochemistry Objectives: To reinforce your understanding of Genetics, Biochemistry, and Molecular Biology To show the connections between these three disciplines To show how these
More informationUnderstanding DNA Structure
Understanding DNA Structure I619 Structural Bioinformatics Molecular Biology Basics + Scale total length of DNA in a human cell is about 2m DNA is compacted in length by a factor of 10000 the compaction
More informationFolding simulation: self-organization of 4-helix bundle protein. yellow = helical turns
Folding simulation: self-organization of 4-helix bundle protein yellow = helical turns Protein structure Protein: heteropolymer chain made of amino acid residues R + H 3 N - C - COO - H φ ψ Chain of amino
More information