SUPPLEMENTARY INFORMATION

Size: px
Start display at page:

Download "SUPPLEMENTARY INFORMATION"

Transcription

1 DOI: /ncb3240 Supplementary Figure 1 GBM cell lines display similar levels of p100 to p52 processing but respond differentially to TWEAK-induced TERT expression according to TERT promoter mutation status. (a) GBM cell lines were treated with TNF-α (10ng/ml) for 1h and analyzed for TERT, IL-8 and IκBα expression. Plots depict relative fold change in mrna expression. Data shown represent the mean of 2 independent experiments. (b) Relative Fn14 expression in GBM cell lines carrying either C250T or C228T TERT mutation. Data shown are an average of 2 independent experiments per cell line. Plots depict relative mrna levels. All raw data are shown in Supplementary Table 2. (c) Cytoplasmic and nuclear fractions of untreated or TWEAK-stimulated C250T and C228T GBM cell lines were analyzed for p52 and RelB activation by western blotting with the indicated antibodies. Data shown is representative of two independent experiments. Unprocessed original scans of blots are found in Supplementary figure

2 Supplementary Figure 2 Canonical NF-κB activation does not induce p65 or p52 recruitment to TERT promoter in GBM cells. (a) ChIP analysis of control (Ctrl) or TWEAK treated GBM cell lines depicting enrichment of BLC promoter with indicated antibodies. n=3 independent ChIP assays performed per cell line. Error bars represent S.D. (b) Western blot analysis of untreated or TWEAK-treated C250T-mutant GBM cells transduced with shrnas targeting p52, RelB, NIK or vector control. Data shown is representative of two independent experiments. (c-d) ChIP was performed in control or TNF-α stimulated GBM cell lines. Enrichment of TERT promoter (c) and NF-κB1A promoter (d) DNA fragments in ChIP DNA were measured by quantitative real-time PCR (ChIP-qPCR) and normalized to DNA input. n=3 independent ChIP experiments performed for each cell line and error bars represent S.D. *P < 0.05; **P < 0.01; Student s t-test, two-tailed. All raw data are shown in Supplementary Table 2. Unprocessed original scans of blots are found in Supplementary figure

3 Supplementary Figure 3 Lymphotoxin β receptor (LtβR)-mediated activation of non-canonical NF-κB pathway induces recruitment of NF-κB2 p52 and Pol II to C250T TERT promoter, resulting in enhanced TERT transcription and telomerase function. (a) Cells were treated with agonistic human LTβR antibody for 24h and total cell extracts were analyzed by western blotting with indicated antibodies. Data shown is representative of three independent experiments. Unprocessed original scans of blots are found in Supplementary figure 7. (b) Relative TERT expression of control (Ctrl) or anti-ltβr-treated T98G and U251 cells. Data from one experiment are shown which is representative of 2 independent experiments. (c-d) ChIP was performed in control (Ctrl) or anti- LTβR-treated T98G and U251 cells using p52, p65 or Pol II-specific antibodies and IgG as a negative control. Enrichment of TERT promoter DNA (c) and BLC promoter DNA (d) fragments in ChIP DNA was normalized to DNA input. n=3 independent ChIP experiments per treatment group and cell line. Error bars represent S.D. (e) Proliferation assay of control (Ctrl) or anti-ltβr-treated T98G and U251 cells. Data shown are from 3 independent experiments for each cell line. Error bars represent S.E.M. (f) Relative telomerase activity of T98G and U251 cells that were untreated (Ctrl) or stimulated with LTβR antibody for 1-4 days. Plots represent mean ± S.E.M. Data shown are from 3 independent experiments for each cell line. (g) Relative TERT expression of T98G and U251 cells treated with si-control (Ctrl), si-nf-κb2 or si-relb. Data shown represent the mean of 2 independent experiments. All statistical analyses were performed using Student s t-test (two-tailed): *P < 0.05; **P < 0.01; ***P < For raw data, refer to Supplementary Table

4 Supplementary Figure 4 Purified p52 protein binds C250T TERT promoter through its Rel homology domain. (a) Recombinant GST-tagged p52 and GST proteins were analyzed for binding to HIV-κB and C250T TERT promoter DNA-labeled probes with EMSA (right panel). Coomassiestained SDS-PAGE of recombinant p52 protein (left panel). EMSA shown is representative of three independent experiments. (b) EMSA analysis of recombinant wild-type (WT) and mutant p52 (carrying mutation in 2 amino acid residues of Rel-homology domain) proteins binding to HIV-κB and C250T TERT promoter DNA-labeled probes (right panel). Data shown is representative of two independent experiments. Coomassie-stained SDS-PAGE showing amount of WT and mutant p52 proteins used for EMSA analysis (left panel). 4

5 Supplementary Figure 5 Constitutive expression of NF-κB-inducing kinase (NIK) results in transcriptional activation of C250T TERT promoter, which promotes the telomerase activity of GBM cells. (a) T98G and U251 cells were transfected with vector, human NIK wild-type (WT) or kinase-inactive mutant NIK (KK) expression plasmids and total cell lysates were analyzed by western blotting with the indicated antibodies. Data shown is representative of three independent experiments. Original scans of blots are shown in Supplementary figure 7. (b) ChIP was performed in control (Ctrl) or NIK WT-overexpressing T98G and U251 cells using p52, p65 or Pol II-specific antibodies and IgG as a negative control. Enrichment of TERT promoter DNA fragments in ChIP DNA was normalized to input. n= 3 independent ChIP experiments per cell type. Error bars represent S.D. (c) Relative telomerase activity of T98G and U251 cells transfected with vector, NIK WT or NIK KK constructs. Data from one experiment is shown which is representative of 3 and 2 independent experiments for T98G and U251 cells respectively. (d) ChIP analysis of control or NIK WT-overexpressing T98G and U251 cells depicting enrichment of BLC promoter with indicated antibodies. n= 3 independent ChIP experiments per cell type and error bars represent S.D. (e) Luciferase reporter assays were performed in 293T HEK cells that were co-transfected with empty vector or human NIK expression plasmid and the pgl3 basic reporter vector or pgl3 vector containing either the WT TERT promoter region (-340 to -55) or TERT promoter with C250T mutation (-340 to -55). Data shown represent the mean luciferase activity from 2 independent experiments. (f) Luciferase reporter assays were performed in 293T HEK cells that were transfected with pgl3 empty reporter vector or pgl3 vector containing either the WT TERT promoter region or TERT promoter with C250T mutation and subsequently untreated or stimulated with TWEAK (30ng/ml) for 1D. Luciferase assay data shown are from one of two independent experiments. (g-h) Vector- or NIK WT-expressing T98G cells were transfected with si-ctrl, si-relb or si-nf-κb2 and analyzed for relative TERT expression (average fold change ± S.D.; n=3 independent experiments) (g) and western blot analysis (h). Western blot data is representative of two independent experiments. *P < 0.05;***P < 0.001; Student s t-test, two-tailed. All raw data are shown in Supplementary Table 2. Unprocessed original scans of blots are found in Supplementary figure

6 Supplementary Figure 6 Ectopic NIK expression enhances the in vivo tumorigenicity of C250T GBM cells through p52 activation. (a) T98G cells were stably transduced with lentiviral expression constructs for vector, NIK WT and NIK WT in combination with shrna targeting p52 (NIK sh-p52) and total cell lysates were analyzed by western blotting with the indicated antibodies. Representative image from two independent experiments is shown. Unprocessed original scans of blots are found in Supplementary figure 7. (b) 5 NOD-SCID mice were injected subcutaneously with T98G cells expressing vector (red arrows), NIK WT (white arrows) or NIK WT sh-p52 (black arrows) and the tumor growth of these cells in the xenograft mouse model after 10 weeks are depicted. (c) Representative immunohistochemical staining of T98G NIK WT xeonograft tumors with the indicated antibodies. Scale bars, 100μm. (d) Relative telomerase activity of T98G cells expressing vector, NIK WT or NIK sh-p52. Data shown represent n =3 independent experiments here. Error bars represent S.E.M. *P < 0.05; Student s t-test, two-tailed. All raw data are shown in Supplementary Table

7 Vector Flag-p52 ETS1/2 Flag IP Flag ETS1/2 Input Flag Actin Figure 6a Supplementary Figure 7 Unprocessed western blot scans. 7

8 LN444 LN444 D247mg D247mg Cytoplasmic Nuclear Cytoplasmic Nuclear U251 U251 LN229 LN229 Cytoplasmic Nuclear Cytoplasmic Nuclear p100 p RelA RelB GAPDH TRF Supplementary figure 1c Supplementary Figure 7 continued 8

9 Tweak p100 p52 RelB Actin Supplementary figure 2b Supplementary Figure 7 continued 9

10 T98G U251 Ctrl Anti-LtβR 24h Ctrl Anti-LtβR 24h p100 p52 Actin Supplementary figure 3a Supplementary Figure 7 continued 10

11 Left panel NIK WT - NIK KK - T98G Right panel NIK WT NIK KK - - U NIK NIK p100 p52 Actin p100 p52 Actin 40 Supplementary figure 5a Supplementary Figure 7 continued 11

12 NIK 160 p100 p52 RelB RelA Actin Supplementary figure 5h Supplementary Figure 7 continued 12

13 T98G Vector NIK WT NIK sh-p52 NIK p100 p52 Actin Supplementary figure 6a Supplementary Figure 7 continued 13

14 qpcr primer sequences Gene Name Forward primer (5 - - > 3 ) Forward primer (5 - - > 3 ) Actin CCA TCA CGA TGC CAG TGG TA CCA TCA CGA TGC CAG TGG TA TERT CCA AGT TCC TGC ACT GGC TGA TTC CCG ATG CTG CCT GAC NFkB2 GAC AAG GTG CAG AAA GAT GAC AT TCC GGA ACA CAA TGG CAT ACT RelB AAA CAC ATC AGA GCT GCG GA CCC TGC TGA ACA CCA CTG AT IL8 GCCAACACAGAAATTATTGTAAAGCTT CCTCTGCACCCAGTTTTCCTT IkBα CGCACCTCCACTCCATCC AGCCATGGATAGAGGCTAAGTGTA ETS1 AGACCCTCTCCAGACAGACA GGCGATCACAACTATCGTAGCT ETS2 CCCAGTGGAGCAAGGCAAA AACTCCCATCCGTCTCCAGT Fn14 CCAAGCTCCTCCAACCACAA TGGGGCCTAGTGTCAAGTCT ChIP- qpcr primer sequences Gene Promoter Forward primer (5 - - > 3 ) Reverse primer (5 - - > 3 ) TERT AGGGCCTCCACATCATGGCCCC TCCCAGGGTGCAGGGACGCCAG BLC CTGCGTTGCCTTGACAGTTC GTCGAATGGGCCATCTCTCA TERT GTCGAGTGGACACGGTGAT AAGTTTATGCAAACTGGACAGGA CRISPR grna sequences grna2- top grna2-bottom grna8-top grna8-bottom 5 -CACCG AGGGGCTGGGAGGGCCCGGA-3 5 -AAACTCC GGGCCCTCCCAGCCCCT C CACCGAAACTCGCGCCGCGAGGAGA AAACTCTCCTCGCGGCGCGAGTTTC-3 Supplementary Table 1 Primer sequences for qpcr and ChIP, and CRISPR grna sequences. Supplementary Table 2 Statistics source data. 14

Hes6. PPARα. PPARγ HNF4 CD36

Hes6. PPARα. PPARγ HNF4 CD36 SUPPLEMENTARY INFORMATION Supplementary Table Positions and Sequences of ChIP primers -63 AGGTCACTGCCA -79 AGGTCTGCTGTG Hes6-0067 GGGCAaAGTTCA ACOT -395 GGGGCAgAGTTCA PPARα -309 GGCTCAaAGTTCAaGTTCA CPTa

More information

Electronic Supplementary Information

Electronic Supplementary Information Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2017 Electronic Supplementary Information Dissecting binding of a β-barrel outer membrane

More information

Supplementary Figure 1A A404 Cells +/- Retinoic Acid

Supplementary Figure 1A A404 Cells +/- Retinoic Acid Supplementary Figure 1A A44 Cells +/- Retinoic Acid 1 1 H3 Lys4 di-methylation SM-actin VEC cfos (-) RA (+) RA 14 1 1 8 6 4 H3 Lys79 di-methylation SM-actin VEC cfos (-) RA (+) RA Supplementary Figure

More information

Supplementary Figure 1. Localization of MST1 in RPE cells. Proliferating or ciliated HA- MST1 expressing RPE cells (see Fig. 5b for establishment of

Supplementary Figure 1. Localization of MST1 in RPE cells. Proliferating or ciliated HA- MST1 expressing RPE cells (see Fig. 5b for establishment of Supplementary Figure 1. Localization of MST1 in RPE cells. Proliferating or ciliated HA- MST1 expressing RPE cells (see Fig. 5b for establishment of the cell line) were immunostained for HA, acetylated

More information

PGRP negatively regulates NOD-mediated cytokine production in rainbow trout liver cells

PGRP negatively regulates NOD-mediated cytokine production in rainbow trout liver cells Supplementary Information for: PGRP negatively regulates NOD-mediated cytokine production in rainbow trout liver cells Ju Hye Jang 1, Hyun Kim 2, Mi Jung Jang 2, Ju Hyun Cho 1,2,* 1 Research Institute

More information

Overexpression Normal expression Overexpression Normal expression. 26 (21.1%) N (%) P-value a N (%)

Overexpression Normal expression Overexpression Normal expression. 26 (21.1%) N (%) P-value a N (%) SUPPLEMENTARY TABLES Table S1. Alteration of ZNF322A protein expression levels in relation to clinicopathological parameters in 123 Asian and 74 Caucasian lung cancer patients. Asian patients Caucasian

More information

Supplementary. Table 1: Oligonucleotides and Plasmids. complementary to positions from 77 of the SRα '- GCT CTA GAG AAC TTG AAG TAC AGA CTG C

Supplementary. Table 1: Oligonucleotides and Plasmids. complementary to positions from 77 of the SRα '- GCT CTA GAG AAC TTG AAG TAC AGA CTG C Supplementary Table 1: Oligonucleotides and Plasmids 913954 5'- GCT CTA GAG AAC TTG AAG TAC AGA CTG C 913955 5'- CCC AAG CTT ACA GTG TGG CCA TTC TGC TG 223396 5'- CGA CGC GTA CAG TGT GGC CAT TCT GCT G

More information

Supplemental Data Supplemental Figure 1.

Supplemental Data Supplemental Figure 1. Supplemental Data Supplemental Figure 1. Silique arrangement in the wild-type, jhs, and complemented lines. Wild-type (WT) (A), the jhs1 mutant (B,C), and the jhs1 mutant complemented with JHS1 (Com) (D)

More information

Supplemental Data. mir156-regulated SPL Transcription. Factors Define an Endogenous Flowering. Pathway in Arabidopsis thaliana

Supplemental Data. mir156-regulated SPL Transcription. Factors Define an Endogenous Flowering. Pathway in Arabidopsis thaliana Cell, Volume 138 Supplemental Data mir156-regulated SPL Transcription Factors Define an Endogenous Flowering Pathway in Arabidopsis thaliana Jia-Wei Wang, Benjamin Czech, and Detlef Weigel Table S1. Interaction

More information

Supplementary Figures

Supplementary Figures Supplementary Figures Supplementary Fig. 1 Characterization of GSCs. a. Immunostaining of primary GSC spheres from GSC lines. Nestin (neural progenitor marker, red), TLX (green). Merged images of nestin,

More information

Dierks Supplementary Fig. S1

Dierks Supplementary Fig. S1 Dierks Supplementary Fig. S1 ITK SYK PH TH K42R wt K42R (kinase deficient) R29C E42K Y323F R29C E42K Y323F (reduced phospholipid binding) (enhanced phospholipid binding) (reduced Cbl binding) E42K Y323F

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/10/494/eaan6284/dc1 Supplementary Materials for Activation of master virulence regulator PhoP in acidic ph requires the Salmonella-specific protein UgtL Jeongjoon

More information

Figure S1. Characterization of the irx9l-1 mutant. (A) Diagram of the Arabidopsis IRX9L gene drawn based on information from TAIR (the Arabidopsis

Figure S1. Characterization of the irx9l-1 mutant. (A) Diagram of the Arabidopsis IRX9L gene drawn based on information from TAIR (the Arabidopsis 1 2 3 4 5 6 7 8 9 10 11 12 Figure S1. Characterization of the irx9l-1 mutant. (A) Diagram of the Arabidopsis IRX9L gene drawn based on information from TAIR (the Arabidopsis Information Research). Exons

More information

Supplemental Table 1. Mutant ADAMTS3 alleles detected in HEK293T clone 4C2. WT CCTGTCACTTTGGTTGATAGC MVLLSLWLIAAALVEVR

Supplemental Table 1. Mutant ADAMTS3 alleles detected in HEK293T clone 4C2. WT CCTGTCACTTTGGTTGATAGC MVLLSLWLIAAALVEVR Supplemental Dataset Supplemental Table 1. Mutant ADAMTS3 alleles detected in HEK293T clone 4C2. DNA sequence Amino acid sequence WT CCTGTCACTTTGGTTGATAGC MVLLSLWLIAAALVEVR Allele 1 CCTGTC------------------GATAGC

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi: 10.1038/nature07182 SUPPLEMENTAL FIGURES AND TABLES Fig. S1. myf5-expressing cells give rise to brown fat depots and skeletal muscle (a) Perirenal BAT from control (cre negative) and myf5-cre:r26r3-yfp

More information

PCR analysis was performed to show the presence and the integrity of the var1csa and var-

PCR analysis was performed to show the presence and the integrity of the var1csa and var- Supplementary information: Methods: Table S1: Primer Name Nucleotide sequence (5-3 ) DBL3-F tcc ccg cgg agt gaa aca tca tgt gac tg DBL3-R gac tag ttt ctt tca ata aat cac tcg c DBL5-F cgc cct agg tgc ttc

More information

Anti-Pim-1 (Cat#3247), anti-met (Cat#3127), anti-ron (Cat#2654), Anti-EGFR

Anti-Pim-1 (Cat#3247), anti-met (Cat#3127), anti-ron (Cat#2654), Anti-EGFR Supplementary Methods Antibodies Anti-Pim-1 (Cat#3247), anti-met (Cat#3127), anti-ron (Cat#2654), Anti-EGFR (Cat#2646), anti-igf1r (Cat#3018), anti-insr (Cat#3020), anti-akt (pan, Cat#4691), anti-phospho-akt

More information

Lacombe et al. Supplemental material ms INS-BR-TR-2

Lacombe et al. Supplemental material ms INS-BR-TR-2 Supplemental Figure 1: Rabbit α-gla antibodies specifically recognize carboxylated VKD proteins. (A) HEK293 cells were transfected with plasmids encoding GGCX-FLAG, PT- FLAG or tagged proline rich Gla

More information

ΔPDD1 x ΔPDD1. ΔPDD1 x wild type. 70 kd Pdd1. Pdd3

ΔPDD1 x ΔPDD1. ΔPDD1 x wild type. 70 kd Pdd1. Pdd3 Supplemental Fig. S1 ΔPDD1 x wild type ΔPDD1 x ΔPDD1 70 kd Pdd1 50 kd 37 kd Pdd3 Supplemental Fig. S1. ΔPDD1 strains express no detectable Pdd1 protein. Western blot analysis of whole-protein extracts

More information

RPA-AB RPA-C Supplemental Figure S1: SDS-PAGE stained with Coomassie Blue after protein purification.

RPA-AB RPA-C Supplemental Figure S1: SDS-PAGE stained with Coomassie Blue after protein purification. RPA-AB RPA-C (a) (b) (c) (d) (e) (f) Supplemental Figure S: SDS-PAGE stained with Coomassie Blue after protein purification. (a) RPA; (b) RPA-AB; (c) RPA-CDE; (d) RPA-CDE core; (e) RPA-DE; and (f) RPA-C

More information

Supplement 1: Sequences of Capture Probes. Capture probes were /5AmMC6/CTG TAG GTG CGG GTG GAC GTA GTC

Supplement 1: Sequences of Capture Probes. Capture probes were /5AmMC6/CTG TAG GTG CGG GTG GAC GTA GTC Supplementary Appendixes Supplement 1: Sequences of Capture Probes. Capture probes were /5AmMC6/CTG TAG GTG CGG GTG GAC GTA GTC ACG TAG CTC CGG CTG GA-3 for vimentin, /5AmMC6/TCC CTC GCG CGT GGC TTC CGC

More information

Arabidopsis actin depolymerizing factor AtADF4 mediates defense signal transduction triggered by the Pseudomonas syringae effector AvrPphB

Arabidopsis actin depolymerizing factor AtADF4 mediates defense signal transduction triggered by the Pseudomonas syringae effector AvrPphB Arabidopsis actin depolymerizing factor mediates defense signal transduction triggered by the Pseudomonas syringae effector AvrPphB Files in this Data Supplement: Supplemental Table S1 Supplemental Table

More information

Supplemental Information. Human Senataxin Resolves RNA/DNA Hybrids. Formed at Transcriptional Pause Sites. to Promote Xrn2-Dependent Termination

Supplemental Information. Human Senataxin Resolves RNA/DNA Hybrids. Formed at Transcriptional Pause Sites. to Promote Xrn2-Dependent Termination Supplemental Information Molecular Cell, Volume 42 Human Senataxin Resolves RNA/DNA Hybrids Formed at Transcriptional Pause Sites to Promote Xrn2-Dependent Termination Konstantina Skourti-Stathaki, Nicholas

More information

hcd1tg/hj1tg/ ApoE-/- hcd1tg/hj1tg/ ApoE+/+

hcd1tg/hj1tg/ ApoE-/- hcd1tg/hj1tg/ ApoE+/+ ApoE+/+ ApoE-/- ApoE-/- H&E (1x) Supplementary Figure 1. No obvious pathology is observed in the colon of diseased ApoE-/me. Colon samples were fixed in 1% formalin and laid out in Swiss rolls for paraffin

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 PTEN promotes virus-induced expression of IFNB1 and its downstream genes. (a) Quantitative RT-PCR analysis of IFNB1 mrna (left) and ELISA of IFN-β (right) in HEK 293 cells (2 10

More information

Supporting Information

Supporting Information Supporting Information Barderas et al. 10.1073/pnas.0801221105 SI Text: Docking of gastrin to Constructed scfv Models Interactive predocking of the 4-WL-5 motif into the central pocket observed in the

More information

Lecture 10, 20/2/2002: The process of solution development - The CODEHOP strategy for automatic design of consensus-degenerate primers for PCR

Lecture 10, 20/2/2002: The process of solution development - The CODEHOP strategy for automatic design of consensus-degenerate primers for PCR Lecture 10, 20/2/2002: The process of solution development - The CODEHOP strategy for automatic design of consensus-degenerate primers for PCR 1 The problem We wish to clone a yet unknown gene from a known

More information

Table S1. Alteration of ZNF322A and FBXW7 protein expression levels in relation to clinicopathological parameters in 135 lung cancer patients.

Table S1. Alteration of ZNF322A and FBXW7 protein expression levels in relation to clinicopathological parameters in 135 lung cancer patients. SUPPLEMENTARY TABLES Table S1. Alteration of ZNF322A and FBXW7 protein expression levels in relation to clinicopathological parameters in 135 lung cancer patients. ZNF322A Normal Overexpression expression

More information

Table S1. Sequences of mutagenesis primers used to create altered rdpa- and sdpa genes

Table S1. Sequences of mutagenesis primers used to create altered rdpa- and sdpa genes Supplementary Table and Figures for Structural Basis for the Enantiospecificities of R- and S-Specific Phenoxypropionate/α-Ketoglutarate Dioxygenases by Tina A. Müller, Maria I. Zavodszky, Michael Feig,

More information

Fig. S1. eif6 expression in HEK293 transfected with shrna against eif6 or pcmv-eif6 vector.

Fig. S1. eif6 expression in HEK293 transfected with shrna against eif6 or pcmv-eif6 vector. Fig. S1. eif6 expression in HEK293 transfected with shrna against eif6 or pcmv-eif6 vector. (a) Western blotting analysis and (b) qpcr analysis of eif6 expression in HEK293 T cells transfected with either

More information

Quantitative reverse-transcription PCR. Transcript levels of flgs, flgr, flia and flha were

Quantitative reverse-transcription PCR. Transcript levels of flgs, flgr, flia and flha were 1 Supplemental methods 2 3 4 5 6 7 8 9 1 11 12 13 14 15 16 17 18 19 21 22 23 Quantitative reverse-transcription PCR. Transcript levels of flgs, flgr, flia and flha were monitored by quantitative reverse-transcription

More information

Disease and selection in the human genome 3

Disease and selection in the human genome 3 Disease and selection in the human genome 3 Ka/Ks revisited Please sit in row K or forward RBFD: human populations, adaptation and immunity Neandertal Museum, Mettman Germany Sequence genome Measure expression

More information

Fig. S1: Nkx2.2 is specifically deleted in the intestinal epithelium.

Fig. S1: Nkx2.2 is specifically deleted in the intestinal epithelium. Fig. S1: Nkx2.2 is specifically deleted in the intestinal epithelium. PCR of representative tissues with oligonucleotides to identify recombination of the Nkx2.2flox allele. Nkx2.2 is specifically deleted

More information

The Acute Phase Protein Orosomucoid Regulates Food Intake and Energy Homeostasis via Leptin Receptor Signaling Pathway. Shanghai , China

The Acute Phase Protein Orosomucoid Regulates Food Intake and Energy Homeostasis via Leptin Receptor Signaling Pathway. Shanghai , China The Acute Phase Protein Orosomucoid Regulates Food Intake and Energy Homeostasis via Leptin Receptor Signaling Pathway Yang Sun, 1 Yili Yang, 2 Zhen Qin, 1 Jinya Cai, 3 Xiuming Guo, 1 Yun Tang, 3 Jingjing

More information

Supplementary Fig. 1. Isolation and in vitro expansion of EpCAM + cholangiocytes. For collagenase perfusion, enzyme solution was injected from the

Supplementary Fig. 1. Isolation and in vitro expansion of EpCAM + cholangiocytes. For collagenase perfusion, enzyme solution was injected from the Supplementary Fig. 1. Isolation and in vitro expansion of EpCAM + cholangiocytes. For collagenase perfusion, enzyme solution was injected from the portal vein for digesting adult livers, whereas it was

More information

Supporting Online Information

Supporting Online Information Supporting Online Information Isolation of Human Genomic DNA Sequences with Expanded Nucleobase Selectivity Preeti Rathi, Sara Maurer, Grzegorz Kubik and Daniel Summerer* Department of Chemistry and Chemical

More information

Supplementary data 1. Prmers and probes used in Taqman real-time PCR.

Supplementary data 1. Prmers and probes used in Taqman real-time PCR. Supplementary data 1. Prmers and probes used in Taqman real-time PCR. PIG-T Forward Primer: gatctgcctcacgtgcactgt Reverse Primer: aggttcgggtgaggagattgt Probe: 6FAMTGG CCG TGT GCT ATG GCT CCT TCTAMRA PIG-U

More information

Supplementary Information. Construction of Lasso Peptide Fusion Proteins

Supplementary Information. Construction of Lasso Peptide Fusion Proteins Supplementary Information Construction of Lasso Peptide Fusion Proteins Chuhan Zong 1, Mikhail O. Maksimov 2, A. James Link 2,3 * Departments of 1 Chemistry, 2 Chemical and Biological Engineering, and

More information

supplementary information

supplementary information DOI: 10.1038/ncb2172 Figure S1 p53 regulates cellular NADPH and lipid levels via inhibition of G6PD. (a) U2OS cells stably expressing p53 shrna or a control shrna were transfected with control sirna or

More information

PILRα Is a Herpes Simplex Virus-1 Entry Coreceptor That Associates with Glycoprotein B

PILRα Is a Herpes Simplex Virus-1 Entry Coreceptor That Associates with Glycoprotein B Satoh et al. Page S1 Cell, Volume 132 PILRα Is a Herpes Simplex Virus-1 Entry Coreceptor That Associates with Glycoprotein B Takeshi Satoh, Jun Arii, Tadahiro Suenaga, Jing Wang, Amane Kogure, Junji Uehori,

More information

Supporting Information

Supporting Information Supporting Information Table S1. Oligonucleotide sequences used in this work Oligo DNA A B C D CpG-A CpG-B CpG-C CpG-D Sequence 5 ACA TTC CTA AGT CTG AAA CAT TAC AGC TTG CTA CAC GAG AAG AGC CGC CAT AGT

More information

Supplementary Materials for

Supplementary Materials for advances.sciencemag.org/cgi/content/full/4/9/eaat5401/dc1 Supplementary Materials for GLK-IKKβ signaling induces dimerization and translocation of the AhR-RORγt complex in IL-17A induction and autoimmune

More information

Supplementary Fig. 1 Proteomic analysis of ATR-interacting proteins. ATR, ARID1A and

Supplementary Fig. 1 Proteomic analysis of ATR-interacting proteins. ATR, ARID1A and Supplementary Figure Legend: Supplementary Fig. 1 Proteomic analysis of ATR-interacting proteins. ATR, ARID1A and ATRIP protein peptides identified from our mass spectrum analysis were shown. Supplementary

More information

Site-Directed Mutagenesis. Mutations in four Smad4 sites of mouse Gat1 promoter

Site-Directed Mutagenesis. Mutations in four Smad4 sites of mouse Gat1 promoter Supplement Supporting Materials and Methods Site-Directed Mutagenesis. Mutations in four Smad4 sites of mouse Gat1 promoter were independently generated using a two-step PCR method. The Smad4 binding site

More information

An evolutionarily conserved negative feedback mechanism in the hippo pathway reflects functional difference between LATS1 and LATS2

An evolutionarily conserved negative feedback mechanism in the hippo pathway reflects functional difference between LATS1 and LATS2 /, Supplementary Advance Publications Materials 2015 2016 An evolutionarily conserved negative feedback mechanism in the hippo pathway reflects functional difference between LATS1 and LATS2 Supplementary

More information

SUPPORTING INFORMATION FILE

SUPPORTING INFORMATION FILE Intrinsic and extrinsic connections of Tet3 dioxygenase with CXXC zinc finger modules Nan Liu, Mengxi Wang, Wen Deng, Christine S. Schmidt, Weihua Qin, Heinrich Leonhardt and Fabio Spada Department of

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2271 Supplementary Figure a! WM266.4 mock WM266.4 #7 sirna WM266.4 #10 sirna SKMEL28 mock SKMEL28 #7 sirna SKMEL28 #10 sirna WM1361 mock WM1361 #7 sirna WM1361 #10 sirna 9 WM266. WM136

More information

Supplemental material

Supplemental material Supplemental material Diversity of O-antigen repeat-unit structures can account for the substantial sequence variation of Wzx translocases Yaoqin Hong and Peter R. Reeves School of Molecular Bioscience,

More information

Supporting information for Biochemistry, 1995, 34(34), , DOI: /bi00034a013

Supporting information for Biochemistry, 1995, 34(34), , DOI: /bi00034a013 Supporting information for Biochemistry, 1995, 34(34), 10807 10815, DOI: 10.1021/bi00034a013 LESNIK 10807-1081 Terms & Conditions Electronic Supporting Information files are available without a subscription

More information

Multiplexing Genome-scale Engineering

Multiplexing Genome-scale Engineering Multiplexing Genome-scale Engineering Harris Wang, Ph.D. Department of Systems Biology Department of Pathology & Cell Biology http://wanglab.c2b2.columbia.edu Rise of Genomics An Expanding Toolbox Esvelt

More information

Table S1. Bacterial strains (Related to Results and Experimental Procedures)

Table S1. Bacterial strains (Related to Results and Experimental Procedures) Table S1. Bacterial strains (Related to Results and Experimental Procedures) Strain number Relevant genotype Source or reference 1045 AB1157 Graham Walker (Donnelly and Walker, 1989) 2458 3084 (MG1655)

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb3562 In the format provided by the authors and unedited. Supplementary Figure 1 Glucose deficiency induced FH-ATF2 interaction. In b-m, immunoblotting or immunoprecipitation analyses were

More information

Supplementary Figure 1. The level of pri-mir-8 gradually decreases while those of BR-C and E74 increase during 3rd instar larval development.

Supplementary Figure 1. The level of pri-mir-8 gradually decreases while those of BR-C and E74 increase during 3rd instar larval development. qrt-pcr RT-PCR Relative pri-mir-8 level 1.2 1.0 0.8 0.6 0.4 0.2 0.0 Early 3rd (72h) Mid 3rd (96h) Late 3rd (119h) BR-C E74 mtl rrna Early 3rd (72h) Mid 3rd (96h) Late 3rd (119h) Supplementary Figure 1.

More information

Materials Protein synthesis kit. This kit consists of 24 amino acids, 24 transfer RNAs, four messenger RNAs and one ribosome (see below).

Materials Protein synthesis kit. This kit consists of 24 amino acids, 24 transfer RNAs, four messenger RNAs and one ribosome (see below). Protein Synthesis Instructions The purpose of today s lab is to: Understand how a cell manufactures proteins from amino acids, using information stored in the genetic code. Assemble models of four very

More information

SUPPLEMENTAL DATA SUPPLEMENTAL FIGURE LEGENDS

SUPPLEMENTAL DATA SUPPLEMENTAL FIGURE LEGENDS SUPPLEMENTAL DATA SUPPLEMENTAL FIGURE LEGENDS SUPPLEMENTAL FIGURE S1. Identification of BmCREC. (A) Amino acid sequences of BmCREC show the peptides identified in LC-MS/MS analysis (marked by red letters

More information

Cell proliferation was measured with Cell Counting Kit-8 (Dojindo Laboratories, Kumamoto, Japan).

Cell proliferation was measured with Cell Counting Kit-8 (Dojindo Laboratories, Kumamoto, Japan). 1 2 3 4 5 6 7 8 Supplemental Materials and Methods Cell proliferation assay Cell proliferation was measured with Cell Counting Kit-8 (Dojindo Laboratories, Kumamoto, Japan). GCs were plated at 96-well

More information

HEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHYNTSWDWARFEVWAHRWMDLSEHGFG Sbjct: 805 HEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHYNTSWDWARFEVWAHRWMDLSEHGFG 864

HEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHYNTSWDWARFEVWAHRWMDLSEHGFG Sbjct: 805 HEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHYNTSWDWARFEVWAHRWMDLSEHGFG 864 Supplementary Fig S1 a gi 27923805 sp Q9NTJ4 MAN2C1HUMAN Alpha-mannosidase 2C1 (Alpha-D-mannoside mannohydrolase) (Mannosidase alpha class 2C member 1) (Alpha mannosidase 6A8B) Query: 1 HEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHYNTSWDWARFEVWAHRWMDLSEHGFG

More information

Supporting Information. Copyright Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim, 2006

Supporting Information. Copyright Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim, 2006 Supporting Information Copyright Wiley-VCH Verlag GmbH & Co. KGaA, 69451 Weinheim, 2006 Copyright Wiley-VCH Verlag GmbH & Co. KGaA, 69451 Weinheim, 2006 Supporting Information for Expanding the Genetic

More information

Supplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53

Supplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53 Supplementary data Supplemental Figure 1 A sienigma #2 sienigma sicontrol a-enigma - + ++ - - - - - - + ++ - - - - - - ++ B sienigma F-Enigma F-EnigmaSM a-flag HLK3 cells - - - + ++ + ++ - + - + + - -

More information

(a) Immunoblotting to show the migration position of Flag-tagged MAVS

(a) Immunoblotting to show the migration position of Flag-tagged MAVS Supplementary Figure 1 Characterization of six MAVS isoforms. (a) Immunoblotting to show the migration position of Flag-tagged MAVS isoforms. HEK293T Mavs -/- cells were transfected with constructs expressing

More information

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table.

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of

More information

supplementary information

supplementary information DOI: 10.1038/ncb2116 Figure S1 CDK phosphorylation of EZH2 in cells. (a) Comparison of candidate CDK phosphorylation sites on EZH2 with known CDK substrates by multiple sequence alignments. (b) CDK1 and

More information

Supplemental Data. Bennett et al. (2010). Plant Cell /tpc

Supplemental Data. Bennett et al. (2010). Plant Cell /tpc BRN1 ---------MSSSNGGVPPGFRFHPTDEELLHYYLKKKISYEKFEMEVIKEVDLNKIEPWDLQDRCKIGSTPQNEWYFFSHKDRKYPTGS 81 BRN2 --------MGSSSNGGVPPGFRFHPTDEELLHYYLKKKISYQKFEMEVIREVDLNKLEPWDLQERCKIGSTPQNEWYFFSHKDRKYPTGS 82 SMB

More information

SUPPLEMENTAL FIGURES AND TABLES

SUPPLEMENTAL FIGURES AND TABLES SUPPLEMENTAL FIGURES AND TABLES A B Flag-ALDH1A1 IP: α-ac HEK293T WT 91R 128R 252Q 367R 41/ 419R 435R 495R 412R C Flag-ALDH1A1 NAM IP: HEK293T + + - + D NAM - + + E Relative ALDH1A1 activity 1..8.6.4.2

More information

SUPPLEMENTARY EXPEMENTAL PROCEDURES

SUPPLEMENTARY EXPEMENTAL PROCEDURES SUPPLEMENTARY EXPEMENTAL PROCEDURES Plasmids- Total RNAs were extracted from HeLaS3 cells and reverse-transcribed using Superscript III Reverse Transcriptase (Invitrogen) to obtain DNA template for the

More information

Supplementary Figure 1. TRIM9 does not affect AP-1, NF-AT or ISRE activity. (a,b) At 24h post-transfection with TRIM9 or vector and indicated

Supplementary Figure 1. TRIM9 does not affect AP-1, NF-AT or ISRE activity. (a,b) At 24h post-transfection with TRIM9 or vector and indicated Supplementary Figure 1. TRIM9 does not affect AP-1, NF-AT or ISRE activity. (a,b) At 24h post-transfection with TRIM9 or vector and indicated reporter luciferase constructs, HEK293T cells were stimulated

More information

Regulation of transcription by the MLL2 complex and MLL complex-associated AKAP95

Regulation of transcription by the MLL2 complex and MLL complex-associated AKAP95 Supplementary Information Regulation of transcription by the complex and MLL complex-associated Hao Jiang, Xiangdong Lu, Miho Shimada, Yali Dou, Zhanyun Tang, and Robert G. Roeder Input HeLa NE IP lot:

More information

Supplementary Fig. 1 Kinetics of appearence of the faster migrating form of Bcl-10.

Supplementary Fig. 1 Kinetics of appearence of the faster migrating form of Bcl-10. α-cd3 + α-cd28: Time (min): + + + + + + + + + 0 5 15 30 60 120 180 240 300 360 360 n.s. Supplementary Fig. 1 Kinetics of appearence of the faster migrating form of. Immunoblot of lysates from Jurkat cells

More information

Supplementary Figure 1. GST pull-down analysis of the interaction of GST-cIAP1 (A, B), GSTcIAP1

Supplementary Figure 1. GST pull-down analysis of the interaction of GST-cIAP1 (A, B), GSTcIAP1 Legends Supplementary Figure 1. GST pull-down analysis of the interaction of GST- (A, B), GST mutants (B) or GST- (C) with indicated proteins. A, B, Cell lysate from untransfected HeLa cells were loaded

More information

-15 diopter negative lenses in wild-type and homozygous CHRM2-deleted mice, and

-15 diopter negative lenses in wild-type and homozygous CHRM2-deleted mice, and Supplementary Materials Supplementary Figure 1: Myopia induction was performed using uniocular -10 and -15 diopter negative lenses in wild-type and homozygous CHRM2-deleted mice, and results at 2, 4 and

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:1.138/nature11496 Cl. 8 Cl. E93 Rag1 -/- 3H9 + BM Rag1 -/- BM CD CD c-kit c-kit c-kit wt Spleen c-kit B22 B22 IgM IgM IgM Supplementary Figure 1. FACS analysis of single-cell-derived pre-b cell clones.

More information

Converting rabbit hybridoma into recombinant antibodies with effective transient production in an optimized human expression system

Converting rabbit hybridoma into recombinant antibodies with effective transient production in an optimized human expression system Converting rabbit hybridoma into recombinant antibodies with effective transient production in an optimized human expression system Dr. Tim Welsink Molecular Biology Transient Gene Expression OUTLINE Short

More information

Chapter 13 Chromatin Structure and its Effects on Transcription

Chapter 13 Chromatin Structure and its Effects on Transcription Chapter 13 Chromatin Structure and its Effects on Transcription Students must be positive that they understand standard PCR. There is a resource on the web for this purpose. Warn them before this class.

More information

Y-chromosomal haplogroup typing Using SBE reaction

Y-chromosomal haplogroup typing Using SBE reaction Schematic of multiplex PCR followed by SBE reaction Multiplex PCR Exo SAP purification SBE reaction 5 A 3 ddatp ddgtp 3 T 5 A G 3 T 5 3 5 G C 5 3 3 C 5 ddttp ddctp 5 T 3 T C 3 A 5 3 A 5 5 C 3 3 G 5 3 G

More information

Supplementary Figure 1, related to Figure 1. GAS5 is highly expressed in the cytoplasm of hescs, and positively correlates with pluripotency.

Supplementary Figure 1, related to Figure 1. GAS5 is highly expressed in the cytoplasm of hescs, and positively correlates with pluripotency. Supplementary Figure 1, related to Figure 1. GAS5 is highly expressed in the cytoplasm of hescs, and positively correlates with pluripotency. (a) Transfection of different concentration of GAS5-overexpressing

More information

Legends for supplementary figures 1-3

Legends for supplementary figures 1-3 High throughput resistance profiling of Plasmodium falciparum infections based on custom dual indexing and Illumina next generation sequencing-technology Sidsel Nag 1,2 *, Marlene D. Dalgaard 3, Poul-Erik

More information

Project 07/111 Final Report October 31, Project Title: Cloning and expression of porcine complement C3d for enhanced vaccines

Project 07/111 Final Report October 31, Project Title: Cloning and expression of porcine complement C3d for enhanced vaccines Project 07/111 Final Report October 31, 2007. Project Title: Cloning and expression of porcine complement C3d for enhanced vaccines Project Leader: Dr Douglas C. Hodgins (519-824-4120 Ex 54758, fax 519-824-5930)

More information

Lecture 11: Gene Prediction

Lecture 11: Gene Prediction Lecture 11: Gene Prediction Study Chapter 6.11-6.14 1 Gene: A sequence of nucleotides coding for protein Gene Prediction Problem: Determine the beginning and end positions of genes in a genome Where are

More information

Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.

Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG. Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.SCUBE2, E-cadherin.Myc, or HA.p120-catenin was transfected in a combination

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature09732 Supplementary Figure 1: Depletion of Fbw7 results in elevated Mcl-1 abundance. a, Total thymocytes from 8-wk-old Lck-Cre/Fbw7 +/fl (Control) or Lck-Cre/Fbw7 fl/fl (Fbw7 KO) mice

More information

Cat. # Product Size DS130 DynaExpress TA PCR Cloning Kit (ptakn-2) 20 reactions Box 1 (-20 ) ptakn-2 Vector, linearized 20 µl (50 ng/µl) 1

Cat. # Product Size DS130 DynaExpress TA PCR Cloning Kit (ptakn-2) 20 reactions Box 1 (-20 ) ptakn-2 Vector, linearized 20 µl (50 ng/µl) 1 Product Name: Kit Component TA PCR Cloning Kit (ptakn-2) Cat. # Product Size DS130 TA PCR Cloning Kit (ptakn-2) 20 reactions Box 1 (-20 ) ptakn-2 Vector, linearized 20 µl (50 ng/µl) 1 2 Ligation Buffer

More information

NAME:... MODEL ANSWER... STUDENT NUMBER:... Maximum marks: 50. Internal Examiner: Hugh Murrell, Computer Science, UKZN

NAME:... MODEL ANSWER... STUDENT NUMBER:... Maximum marks: 50. Internal Examiner: Hugh Murrell, Computer Science, UKZN COMP710, Bioinformatics with Julia, Test One, Thursday the 20 th of April, 2017, 09h30-11h30 1 NAME:...... MODEL ANSWER... STUDENT NUMBER:...... Maximum marks: 50 Internal Examiner: Hugh Murrell, Computer

More information

monoclonal antibody. (a) The specificity of the anti-rhbdd1 monoclonal antibody was examined in

monoclonal antibody. (a) The specificity of the anti-rhbdd1 monoclonal antibody was examined in Supplementary information Supplementary figures Supplementary Figure 1 Determination of the s pecificity of in-house anti-rhbdd1 mouse monoclonal antibody. (a) The specificity of the anti-rhbdd1 monoclonal

More information

Supplementary Figure 1 PARP1 is involved in regulating the stability of mrnas from pro-inflammatory cytokine/chemokine mediators.

Supplementary Figure 1 PARP1 is involved in regulating the stability of mrnas from pro-inflammatory cytokine/chemokine mediators. Supplementary Figure 1 PARP1 is involved in regulating the stability of mrnas from pro-inflammatory cytokine/chemokine mediators. (a) A graphic depiction of the approach to determining the stability of

More information

Nature Immunology: doi: /ni Supplementary Figure 1. Zranb1 gene targeting.

Nature Immunology: doi: /ni Supplementary Figure 1. Zranb1 gene targeting. Supplementary Figure 1 Zranb1 gene targeting. (a) Schematic picture of Zranb1 gene targeting using an FRT-LoxP vector, showing the first 6 exons of Zranb1 gene (exons 7-9 are not shown). Targeted mice

More information

WB: anti-flag (Orai1) WB: anti-stim1

WB: anti-flag (Orai1) WB: anti-stim1 [Ca 2+ ] i (µm) 1.5 1..5 2Ca Ca 2 mm Ca 1 µm TG HeLa µm 2-APB HeLa O+S KDa DSP (mm).12..5 1. 2.5 3 6 9 12 2 Complex Monomer KDa 2 1 DSP (mm).12..5 1. 2.5 Complex Monomer (Orai1) WB: anti-stim1 Figure S1

More information

Partial list of differentially expressed genes from cdna microarray, comparing MUC18-

Partial list of differentially expressed genes from cdna microarray, comparing MUC18- Supplemental Figure legends Table-1 Partial list of differentially expressed genes from cdna microarray, comparing MUC18- silenced and NT-transduced A375SM cells. Supplemental Figure 1 Effect of MUC-18

More information

Supplementary Methods Quantitative RT-PCR. For mrna, total RNA was prepared using TRIzol reagent (Invitrogen) and genomic DNA was eliminated with TURB

Supplementary Methods Quantitative RT-PCR. For mrna, total RNA was prepared using TRIzol reagent (Invitrogen) and genomic DNA was eliminated with TURB Supplementary Methods Quantitative RT-PCR. For mrna, total RNA was prepared using TRIzol reagent (Invitrogen) and genomic DNA was eliminated with TURBO DNA-free Kit (Ambion). One µg of total RNA was reverse

More information

An engineered tryptophan zipper-type peptide as a molecular recognition scaffold

An engineered tryptophan zipper-type peptide as a molecular recognition scaffold SUPPLEMENTARY MATERIAL An engineered tryptophan zipper-type peptide as a molecular recognition scaffold Zihao Cheng and Robert E. Campbell* Supplementary Methods Library construction for FRET-based screening

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb2743 Figure S1 stabilizes cellular protein level, post-transcriptionally. (a, b) and DDR1 were RNAi-depleted from HEK.293.-CBG cells. Western blots with indicated antibodies (a). RT-PCRs

More information

Supplemental Information. Target-Mediated Protection of Endogenous. MicroRNAs in C. elegans. Inventory of Supplementary Information

Supplemental Information. Target-Mediated Protection of Endogenous. MicroRNAs in C. elegans. Inventory of Supplementary Information Developmental Cell, Volume 20 Supplemental Information Target-Mediated Protection of Endogenous MicroRNAs in C. elegans Saibal Chatterjee, Monika Fasler, Ingo Büssing, and Helge Großhans Inventory of Supplementary

More information

mir-155 regulates differentiation of brown and beige adipocytes via a bistable circuit

mir-155 regulates differentiation of brown and beige adipocytes via a bistable circuit SUPPLEMENTARY INFORMATION mir-155 regulates differentiation of brown and beige adipocytes via a bistable circuit Yong Chen 1,2,, Franziska Siegel 1,, Stefanie Kipschull 1, Bodo Haas 1,3, Holger Fröhlich

More information

Supporting Information

Supporting Information Supporting Information AbuOdeh et al. 10.1073/pnas.1409252111 SI Materials and Methods List of Antibodies. Antibodies are listed: polyclonal anti antibody (1:500; gift from Kay Huebner, Ohio State University,

More information

supplementary information

supplementary information DOI: 1.138/ncb1839 a b Control 1 2 3 Control 1 2 3 Fbw7 Smad3 1 2 3 4 1 2 3 4 c d IGF-1 IGF-1Rβ IGF-1Rβ-P Control / 1 2 3 4 Real-time RT-PCR Relative quantity (IGF-1/ mrna) 2 1 IGF-1 1 2 3 4 Control /

More information

A Genetically Encoded Toolbox for Glycocalyx Engineering: Tunable Control of Cell Adhesion,

A Genetically Encoded Toolbox for Glycocalyx Engineering: Tunable Control of Cell Adhesion, TITLE A Genetically Encoded Toolbox for Glycocalyx Engineering: Tunable Control of Cell Adhesion, Survival, and Cancer Cell Behaviors AUTHORS Carolyn R. Shurer *, Marshall J. Colville *, Vivek K. Gupta,

More information

Estradiol-Estrogen Receptor α Mediates the Expression of the CXXC5 Gene through the Estrogen Response Element-Dependent Signaling Pathway

Estradiol-Estrogen Receptor α Mediates the Expression of the CXXC5 Gene through the Estrogen Response Element-Dependent Signaling Pathway Estradiol-Estrogen Receptor α Mediates the Expression of the CXXC5 Gene through the Estrogen Response Element-Dependent Signaling Pathway Pelin Yaşar, Gamze Ayaz and Mesut Muyan SUPPLEMENTARY INFORMATION

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:.38/nature899 Supplementary Figure Suzuki et al. a c p7 -/- / WT ratio (+)/(-) p7 -/- / WT ratio Log X 3. Fold change by treatment ( (+)/(-)) Log X.5 3-3. -. b Fold change by treatment ( (+)/(-)) 8

More information

Supplemental Figure 1

Supplemental Figure 1 mrna level (fold induction) Supplemental Figure 1 a-flag pmx-rank WT pmx-rank Mt 0 1 3 6 0 1 3 6 (h) c-fos b-actin 5 4 3 2 1 0 0 1 3 6 0 1 3 6 (h) pmx-rank WT pmx-rank Mt TRAP+ Mononuclear pre-ocs/well

More information

b alternative classical none

b alternative classical none Supplementary Figure. 1: Related to Figure.1 a d e b alternative classical none NIK P-IkBa Total IkBa Tubulin P52 (Lighter) P52 (Darker) RelB (Lighter) RelB (Darker) HDAC1 Control-Sh RelB-Sh NF-kB2-Sh

More information

Nature Genetics: doi: /ng Supplementary Figure 1

Nature Genetics: doi: /ng Supplementary Figure 1 Supplementary Figure 1 Coding and noncoding transcription at the vg locus. (a,b) qpcr analysis of developmental and tissue-specific vg mrna (a) and PRE/TRE (b) transcription, shown as percentage of TBP

More information