Molecular Modeling 9. Protein structure prediction, part 2: Homology modeling, fold recognition & threading
|
|
- Delphia Logan
- 5 years ago
- Views:
Transcription
1 Molecular Modeling 9 Protein structure prediction, part 2: Homology modeling, fold recognition & threading
2 The project... Remember: You are smarter than the program. Inspecting the model: Are amino acids that are conserved in the binding site in the same place. That is reasonable. Are the key residues that you think will interact with your ligand placed to do so? To do the docking you need a: PDB file of the protein (the model) A file specifying the binding site, e.g. D3.32 (an ASP in the site). A smiles file for the ligand, e.g. Cc1nc[nH]c1CCN CHEMBL275443
3 Example: Dopamine D3 receptor
4 Lecture on monday... Think about questions that you would like to have answered on Tuesday: Which areas are most difficult? Do you want more specific reading instructions for some parts? On Tuesday I will give a summary of what you should know. Deadline for preliminary report!!! Hand one in...
5 The exercise yesterday... RMSD/Rank measures how well docking can (predict experimental geometry)/(identify ligand among decoys, enrichment)
6 Last lecture & This lecture Previous lecture: Molecular docking: Sampling & Scoring Lead optimization This lecture: Back to protein structure prediction Homology/comparative modeling (part II:more) Fold recognition & threading
7 The problem: Sequence to Structure
8 Why do we want to predict protein structure? Experimental effort to determine protein structure is very large and costly. Some are impossible to solve with current methods. The gap between the size of the protein sequence data and protein structure data is large and increasing. compare
9 Methods for protein structure predicton Two basic methods: 1. Homology modeling Uses evolutionary similarities, functional similarities 2. Fold recognition or threading Uses structural knowledge, fold similarity : for harder targets Today we will look at homology modeling again, how that can be improved, and to discuss point 2.
10 Steps in comparative/homology modeling Find suitable template(s) Build alignment between target and template(s) Build model(s) Replace side chains Resolve conflicts in the structure Model loops (regions without an alignment) Evaluate and select model(s)
11 Homology/Comparative modeling START TARGET SEQUENCE TEMPLATE STRUCTURE Identify related structures (templates)...acghtkildikgidywiahkalcteklftkcelsqnlydidgy... Align target sequence to template structures Build a model for the target sequence using information from template structures Evaluate the model ALIGNMENT TARGET...SCDKLLDDELDDDIACAKKILAIKGID... TEMPLATE...SCDKFLDDDITDDIMCAKKILDIKGID... TARGET MODEL NO model OK? YES QUALITY PROFILE QUALITY protein model X END RESIDUE POSITION
12 Three homology modeling approaches 1. Rigid body assembly SWISS-MODEL 2. Segment based Segmod 3. Distance restraints Modeller
13 1. Rigid body assembly Simplest approach: Transfer the backbone conformation of the template to the unknown protein. Example: SWISS-MODEL: Copy backbone Copy side chains - if they are the same Build loops Build side chains
14 2. Segment-based approach Start with a set of Calpha coordinates as an inital framework for the target protein. This framework is based on a homologous protein identified from a sequence alignment. Break down the target sequence into fragments. The initial framework is used to guide to find matching segments in a database based on known protein structures. The fragments are fitted into the growing target structure. Make many alternatives by adding segments in random order. Make an average of all models and do a short minimization. That s your final model.
15 2. Segment-based approach Inital framework Build backbone Add fragments in random order Make average of different models and minimize
16 protein model X RESIDUE POSITION 3.Distance restraints: Modeller Generate many constraints: Homology derived constraints Distances and angles between aligned positions should be similar Stereochemical constraints Bond lengths, bond angles, dihedral angles, non-bonded atom-atom contacts Model derived by optimizing constraints. Models can further be evaluated using Ramachandran plot and/or DOPE score (statistical pair-potential for protein structures) START Identify related structures (templates) Align target sequence to template structures Build a model for the target sequence using information from template structures Evaluate the model NO model OK? YES END TARGET SEQUENCE...ACGHTKILDIKGIDYWIAHKALCTEKLFTKCELSQNLYDIDGY... QUALITY ALIGNMENT TEMPLATE STRUCTURE TARGET...SCDKLLDDELDDDIACAKKILAIKGID... TEMPLATE...SCDKFLDDDITDDIMCAKKILDIKGID... QUALITY PROFILE TARGET MODEL
17 Model evaluation (when you don t know the answer) Check of stereochemistry bond lengths & angles, peptide bond planarity, side-chain ring planarity, chirality, torsion angles, clashes Check of spatial features hydrophobic core, solvent accessibility, distribution of charged groups, atomatom-distances, atomic volumes, mainchain hydrogen bonding What do you know about the protein?
18 Benchmarking of the three approaches All are not equal: A benchmark of different homology modeling programs BJÖRN WALLNER AND ARNE ELOFSSON Stockholm Bioinformatics Center, Albanova University Center, Stockholm University, Stockholm, Sweden (RECEIVED November 22, 2004; FINAL REVISION February 18, 2005; ACCEPTED February 18, 2005) Distance restraints MODELLER Classical mechanics SWISS-MODEL Segment based SegMod/ENCAD
19 Which method is best? RMSD
20 Which method is best? Backbone phi/psi Caused by minimization step
21 Which method is best? Side chains
22 Benchmark: improvements The model is rarely closer to the target than the template was...
23 Example of improvements Template - red Model - green Target - blue Shows the scale of improvements
24 Where can you find/get homology models? Manual - do it yourself! Great if you know what you re doing Automated modeling servers Good tool for easy generation of models. Swiss-Model: Pre-calculated models Never up to date and often bad. Modeller:
25 Further improvement of homology models? Many of you have been trying several templates for your GPCR targets. Perhaps the models are good in different parts - multiple templates? But wait, why not include all at the same time?
26 Multiple templates - using more than one template Not always one template is based Modeller can use multiple templates Average model Often the best is better Experts can make this work Is it possible to make it work automatically?
27 Multiple templates Advantage to use more than one template Modeller can use multiple templates However, the best single template is often better. But there is no simple way of finding the best model! Manually it is possible to do this
28 Some models get better The combined model alternates template to get the best result Local sequence identity affects result.
29 Some models get worse... template 1 template 2 Multiple template: Completely lost!
30 Multiple templates Models get better and worse with multiple templates Better Worse Templates
31 What can be homology modeled? What do we do in the twilight zone?
32 The fold universe Why are there so few protein folds? Chotia: 1000 folds for the molecular biologist Why do most sequences fit a small number of folds?
33 Typical folds 20% of folds account for 80% of proteins Mostly true for RNA too Compare with DNA: Only a single fold Homologous sequences Functional convergence onto folds Physical restrictions
34 Folding patterns Simple permutations of helices/sheets Stable local patterns (lots of h-bonds) Hydrophobic patterns Contiguous sheets
35 Fold recognition: databases Two databases: SCOP / CATH Hierarchical classification of structures Class - / Architecture Folds / Topology Superfamily / Homology Family SCOP manual, CATH semi-manual
36 CATH
37 CATH
38 CATH
39 CATH
40 CATH
41 SCOP
42 SCOP
43 SCOP
44 SCOP
45 SCOP
46 SCOP
47 Methods for protein structure prediction Two basic methods: 1. Homology modeling A clear evolutionary relationship between target and protein of known structure, which can be detected from sequence. 2. Fold recognition or threading If the structure of the target is related to a protein of known structure, but it can not be identified from sequence. The fold can often tell us something about function.
48 Fold recognition/threading FR/Threading is used if you want to predict a general structure for the protein. You are not necessarily interested in the atomic details. Question: Based on an amino acid sequence (of unknown structure) and a set of template (protein) structures, which template represents the target best? Suggestion: Thread the amino acid sequence through every protein structure and see which one is best. Used when standard sequence methods fail. Gives a rough model. Structure is more conserved than sequence.
49 Fold recognition/threading Fold 1 Query sequence Fold 2 compatibility scores Fold 3 Fold N
50 PDB new fold growth is stabilizing! If the fold has not been observed before, threading won t find it! So, it s good that there appears to be a limited number of folds, maybe around Fold recognition relies on that proteins with very different sequences can adopt the same fold.
51 Homology vs. fold detection % seq. ID Approach Fold Detection Homology Modelling Target Sequence Any Sequence?? >= 30-50% ID with template Model Quality Fold Level Atomic Level - The best method of determining 3D structure is to base the model you make on a known structure. - If your sequence is sufficiently similar (>30-50% identity) you could generate an all atom model by homology modeling. Close to 50% of all new sequences can be homology modeled. - In the twilight zone (<20-30%), use fold recognition methods!
52 Basic principles of fold recognition 1.Construction of template library 2. Sequence-structure alignment - threading (compare: sampling in docking) 3.Design of scoring function (compare: scoring in docking) 4.Template selection and model construction Only step one is easy...
53 1. Template library A representative set of protein structures extracted from the PDB database. It satisfies the following conditions: 1.The resolution of each representative structure should be good; 2.A good X-ray structure has higher priority than a NMR structure; 3.The sequence identity between any two representatives should be no more than 30%, in order to save computing time. Examples: CATH: SCOP:
54 2. Sequence-structure alignments Sampling all observed protein folds is of course much easier than sampling all possible conformations (infinite). However, sampling the different alignments efficiently is still extremely challenging - in particular since gaps will be allowed: The score of placing a residue in a position depends on how other residues are aligned. Approximations: Frozen approximation: Assumes all other residues are identical to the templates. High penalties for gaps in secondary structure.
55 3. Scoring function Local and global measures locally - i.e. secondary structure preferences, Gly/Pro in turns. Specific amino acids more probable in secondary structure elements. globally - hydrophobic core, residue contacts, charged residues exposed sequence-structure alignment must make sense in 3D. Few gaps in core secondary structures
56 3. Scoring: Knowledge-based potentials Use knowledge-based potential: Construct a database of all 20x20 or (20*19)/2 amino acid pairs. Use one interaction site per amino acid, not atomistic. Predict a given sequence using the pairwise potentials, Pab A solvation potential reflecting the degree of burial is also included. Frequency of X-Y distance b X-Y distance a
57 3. Scoring Select the template structure with the best score - a first rough model of the protein.
58 Fold recognition methods: Many other.. Structure-based 3D-1D profiles (Bowie, 1991) Threader (Jones, 1992) Prediction and sequence based Predicted Secondary structures (Fischer, 1996; Rost, 1996) Evolutionary information PSI-BLAST (Altschul, 1997) HMMs (Karplus, 1997) Profile-Profile based (Rychlewski, 2000; von Öhsen 2001) Combinations (Fischer, 2000, Kelley, 2000) Consensus methods
Comparative Modeling Part 1. Jaroslaw Pillardy Computational Biology Service Unit Cornell Theory Center
Comparative Modeling Part 1 Jaroslaw Pillardy Computational Biology Service Unit Cornell Theory Center Function is the most important feature of a protein Function is related to structure Structure is
More informationProtein Structure Prediction
Homology Modeling Protein Structure Prediction Ingo Ruczinski M T S K G G G Y F F Y D E L Y G V V V V L I V L S D E S Department of Biostatistics, Johns Hopkins University Fold Recognition b Initio Structure
More informationProtein 3D Structure Prediction
Protein 3D Structure Prediction Michael Tress CNIO ?? MREYKLVVLGSGGVGKSALTVQFVQGIFVDE YDPTIEDSYRKQVEVDCQQCMLEILDTAGTE QFTAMRDLYMKNGQGFALVYSITAQSTFNDL QDLREQILRVKDTEDVPMILVGNKCDLEDER VVGKEQGQNLARQWCNCAFLESSAKSKINVN
More informationBioinformatics & Protein Structural Analysis. Bioinformatics & Protein Structural Analysis. Learning Objective. Proteomics
The molecular structures of proteins are complex and can be defined at various levels. These structures can also be predicted from their amino-acid sequences. Protein structure prediction is one of the
More information3D Structure Prediction with Fold Recognition/Threading. Michael Tress CNB-CSIC, Madrid
3D Structure Prediction with Fold Recognition/Threading Michael Tress CNB-CSIC, Madrid MREYKLVVLGSGGVGKSALTVQFVQGIFVDEYDPTIEDSY RKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFAL VYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDL
More informationStructural Bioinformatics (C3210) Conformational Analysis Protein Folding Protein Structure Prediction
Structural Bioinformatics (C3210) Conformational Analysis Protein Folding Protein Structure Prediction Conformational Analysis 2 Conformational Analysis Properties of molecules depend on their three-dimensional
More informationHomology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen
Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,
More informationStructure Prediction. Modelado de proteínas por homología GPSRYIV. Master Dianas Terapéuticas en Señalización Celular: Investigación y Desarrollo
Master Dianas Terapéuticas en Señalización Celular: Investigación y Desarrollo Modelado de proteínas por homología Federico Gago (federico.gago@uah.es) Departamento de Farmacología Structure Prediction
More informationStructural bioinformatics
Structural bioinformatics Why structures? The representation of the molecules in 3D is more informative New properties of the molecules are revealed, which can not be detected by sequences Eran Eyal Plant
More informationProtein Structure Prediction. christian studer , EPFL
Protein Structure Prediction christian studer 17.11.2004, EPFL Content Definition of the problem Possible approaches DSSP / PSI-BLAST Generalization Results Definition of the problem Massive amounts of
More informationCSE : Computational Issues in Molecular Biology. Lecture 19. Spring 2004
CSE 397-497: Computational Issues in Molecular Biology Lecture 19 Spring 2004-1- Protein structure Primary structure of protein is determined by number and order of amino acids within polypeptide chain.
More informationStatistical Machine Learning Methods for Bioinformatics VI. Support Vector Machine Applications in Bioinformatics
Statistical Machine Learning Methods for Bioinformatics VI. Support Vector Machine Applications in Bioinformatics Jianlin Cheng, PhD Computer Science Department and Informatics Institute University of
More informationMolecular Modeling Lecture 8. Local structure Database search Multiple alignment Automated homology modeling
Molecular Modeling 2018 -- Lecture 8 Local structure Database search Multiple alignment Automated homology modeling An exception to the no-insertions-in-helix rule Actual structures (myosin)! prolines
More informationProtein structure. Wednesday, October 4, 2006
Protein structure Wednesday, October 4, 2006 Introduction to Bioinformatics Johns Hopkins School of Public Health 260.602.01 J. Pevsner pevsner@jhmi.edu Copyright notice Many of the images in this powerpoint
More informationAb Initio SERVER PROTOTYPE FOR PREDICTION OF PHOSPHORYLATION SITES IN PROTEINS*
COMPUTATIONAL METHODS IN SCIENCE AND TECHNOLOGY 9(1-2) 93-100 (2003/2004) Ab Initio SERVER PROTOTYPE FOR PREDICTION OF PHOSPHORYLATION SITES IN PROTEINS* DARIUSZ PLEWCZYNSKI AND LESZEK RYCHLEWSKI BiolnfoBank
More informationAn Overview of Protein Structure Prediction: From Homology to Ab Initio
An Overview of Protein Structure Prediction: From Homology to Ab Initio Final Project For Bioc218, Computational Molecular Biology Zhiyong Zhang Abstract The current status of the protein prediction methods,
More informationHomology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen
Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,
More informationPrediction of Protein-Protein Binding Sites and Epitope Mapping. Copyright 2017 Chemical Computing Group ULC All Rights Reserved.
Prediction of Protein-Protein Binding Sites and Epitope Mapping Epitope Mapping Antibodies interact with antigens at epitopes Epitope is collection residues on antigen Continuous (sequence) or non-continuous
More informationWorkunit: P Title:MT
Workunit: P000003 Title:MT Model Summary: Model information: Modelled residue range: 48 to 340 Quaternary structure information: Based on template: 3aptA (1.85 A) Template (3aptA): Unknown Sequence Identity
More informationTextbook Reading Guidelines
Understanding Bioinformatics by Marketa Zvelebil and Jeremy Baum Last updated: May 1, 2009 Textbook Reading Guidelines Preface: Read the whole preface, and especially: For the students with Life Science
More informationGiri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748
CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/19/07 CAP5510 1 HMM for Sequence Alignment 2/19/07 CAP5510 2
More informationBMB/Bi/Ch 170 Fall 2017 Problem Set 1: Proteins I
BMB/Bi/Ch 170 Fall 2017 Problem Set 1: Proteins I Please use ray-tracing feature for all the images you are submitting. Use either the Ray button on the right side of the command window in PyMOL or variations
More informationCOMPARATIVE PROTEIN STRUCTURE MODELING
?Annu. Rev. Biophys. Biomol. Struct. 2000. 29:291 325 Copyright c 2000 by Annual Reviews. All rights reserved protein structure prediction, fold assignment, alignment, homology Comparative modeling predicts
More informationAn insilico Approach: Homology Modelling and Characterization of HSP90 alpha Sangeeta Supehia
259 Journal of Pharmaceutical, Chemical and Biological Sciences ISSN: 2348-7658 Impact Factor (SJIF): 2.092 December 2014-February 2015; 2(4):259-264 Available online at http://www.jpcbs.info Online published
More informationCS273: Algorithms for Structure Handout # 5 and Motion in Biology Stanford University Tuesday, 13 April 2004
CS273: Algorithms for Structure Handout # 5 and Motion in Biology Stanford University Tuesday, 13 April 2004 Lecture #5: 13 April 2004 Topics: Sequence motif identification Scribe: Samantha Chui 1 Introduction
More informationUniversità degli Studi di Roma La Sapienza
Università degli Studi di Roma La Sapienza. Tutore Prof.ssa Anna Tramontano Coordinatore Prof. Marco Tripodi Dottorando Daniel Carbajo Pedrosa Dottorato di Ricerca in Scienze Pasteuriane XXIV CICLO Docente
More informationProtein Sequence Analysis. BME 110: CompBio Tools Todd Lowe April 19, 2007 (Slide Presentation: Carol Rohl)
Protein Sequence Analysis BME 110: CompBio Tools Todd Lowe April 19, 2007 (Slide Presentation: Carol Rohl) Linear Sequence Analysis What can you learn from a (single) protein sequence? Calculate it s physical
More informationBioinformatics Tools. Stuart M. Brown, Ph.D Dept of Cell Biology NYU School of Medicine
Bioinformatics Tools Stuart M. Brown, Ph.D Dept of Cell Biology NYU School of Medicine Bioinformatics Tools Stuart M. Brown, Ph.D Dept of Cell Biology NYU School of Medicine Overview This lecture will
More informationStructural Analysis of the EGR Family of Transcription Factors: Templates for Predicting Protein DNA Interactions
Introduction Structural Analysis of the EGR Family of Transcription Factors: Templates for Predicting Protein DNA Interactions Jamie Duke, Rochester Institute of Technology Mentor: Carlos Camacho, University
More informationWhat s New in Discovery Studio 2.5.5
What s New in Discovery Studio 2.5.5 Discovery Studio takes modeling and simulations to the next level. It brings together the power of validated science on a customizable platform for drug discovery research.
More informationBioinformatics Practical Course. 80 Practical Hours
Bioinformatics Practical Course 80 Practical Hours Course Description: This course presents major ideas and techniques for auxiliary bioinformatics and the advanced applications. Points included incorporate
More informationLecture 1 - Introduction to Structural Bioinformatics
Lecture 1 - Introduction to Structural Bioinformatics Motivation and Basics of Protein Structure Prof. Haim J. Wolfson 1 Most of the Protein Structure slides courtesy of Hadar Benyaminy. Prof. Haim J.
More informationAre specialized servers better at predicting protein structures than stand alone software?
African Journal of Biotechnology Vol. 11(53), pp. 11625-11629, 3 July 2012 Available online at http://www.academicjournals.org/ajb DOI:10.5897//AJB12.849 ISSN 1684 5315 2012 Academic Journals Full Length
More informationProtein Structure Databases, cont. 11/09/05
11/9/05 Protein Structure Databases (continued) Prediction & Modeling Bioinformatics Seminars Nov 10 Thurs 3:40 Com S Seminar in 223 Atanasoff Computational Epidemiology Armin R. Mikler, Univ. North Texas
More informationPrediction of Protein Structure by Emphasizing Local Side- Chain/Backbone Interactions in Ensembles of Turn
PROTEINS: Structure, Function, and Genetics 53:486 490 (2003) Prediction of Protein Structure by Emphasizing Local Side- Chain/Backbone Interactions in Ensembles of Turn Fragments Qiaojun Fang and David
More informationHomework Project Protein Structure Prediction Contact me if you have any questions/problems with the assignment:
Homework Project Protein Structure Prediction Contact me if you have any questions/problems with the assignment: Roland.Dunbrack@gmail.com For this homework, each of you will be assigned a particular human
More informationproteins Template-based protein structure prediction the last decade
proteins STRUCTURE O FUNCTION O BIOINFORMATICS Template-based protein structure prediction in CASP11 and retrospect of I-TASSER in the last decade Jianyi Yang, 1,2 Wenxuan Zhang, 1,2 Baoji He, 1,2 Sara
More informationSequence Analysis '17 -- lecture Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction
Sequence Analysis '17 -- lecture 16 1. Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction Alpha helix Right-handed helix. H-bond is from the oxygen at i to the nitrogen
More informationChapter 8. One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model. Sebastian Kmiecik and Andrzej Kolinski.
Chapter 8 One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model Abstract Despite the significant increase in computational power, molecular modeling of protein structure using
More information4/10/2011. Rosetta software package. Rosetta.. Conformational sampling and scoring of models in Rosetta.
Rosetta.. Ph.D. Thomas M. Frimurer Novo Nordisk Foundation Center for Potein Reseach Center for Basic Metabilic Research Breif introduction to Rosetta Rosetta docking example Rosetta software package Breif
More informationComputational methods in bioinformatics: Lecture 1
Computational methods in bioinformatics: Lecture 1 Graham J.L. Kemp 2 November 2015 What is biology? Ecosystem Rain forest, desert, fresh water lake, digestive tract of an animal Community All species
More informationMolecular Structures
Molecular Structures 1 Molecular structures 2 Why is it important? Answers to scientific questions such as: What does the structure of protein X look like? Can we predict the binding of molecule X to Y?
More informationHomology Modeling of the Chimeric Human Sweet Taste Receptors Using Multi Templates
2013 International Conference on Food and Agricultural Sciences IPCBEE vol.55 (2013) (2013) IACSIT Press, Singapore DOI: 10.7763/IPCBEE. 2013. V55. 1 Homology Modeling of the Chimeric Human Sweet Taste
More informationComputational Methods for Protein Structure Prediction and Fold Recognition... 1 I. Cymerman, M. Feder, M. PawŁowski, M.A. Kurowski, J.M.
Contents Computational Methods for Protein Structure Prediction and Fold Recognition........................... 1 I. Cymerman, M. Feder, M. PawŁowski, M.A. Kurowski, J.M. Bujnicki 1 Primary Structure Analysis...................
More informationDocking. Why? Docking : finding the binding orientation of two molecules with known structures
Docking : finding the binding orientation of two molecules with known structures Docking According to the molecules involved: Protein-Ligand docking Protein-Protein docking Specific docking algorithms
More informationMolecular Structures
Molecular Structures 1 Molecular structures 2 Why is it important? Answers to scientific questions such as: What does the structure of protein X look like? Can we predict the binding of molecule X to Y?
More informationBuilding an Antibody Homology Model
Application Guide Antibody Modeling: A quick reference guide to building Antibody homology models, and graphical identification and refinement of CDR loops in Discovery Studio. Francisco G. Hernandez-Guzman,
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature16191 SUPPLEMENTARY DISCUSSION We analyzed the current database of solved protein structures to assess the uniqueness of our designed toroids in terms of global similarity and bundle
More informationRecursive protein modeling: a divide and conquer strategy for protein structure prediction and its case study in CASP9
Recursive protein modeling: a divide and conquer strategy for protein structure prediction and its case study in CASP9 Jianlin Cheng Department of Computer Science, Informatics Institute, C.Bond Life Science
More informationComputer Aided Drug Design. Protein structure prediction. Qin Xu
Computer Aided Drug Design Protein structure prediction Qin Xu http://cbb.sjtu.edu.cn/~qinxu/cadd.htm Course Outline Introduction and Case Study Drug Targets Sequence analysis Protein structure prediction
More informationBIOLOGY 200 Molecular Biology Students registered for the 9:30AM lecture should NOT attend the 4:30PM lecture.
BIOLOGY 200 Molecular Biology Students registered for the 9:30AM lecture should NOT attend the 4:30PM lecture. Midterm date change! The midterm will be held on October 19th (likely 6-8PM). Contact Kathy
More informationProtein Tertiary Model Assessment Using Granular Machine Learning Techniques
Georgia State University ScholarWorks @ Georgia State University Computer Science Dissertations Department of Computer Science 3-21-2012 Protein Tertiary Model Assessment Using Granular Machine Learning
More informationRosettainCASP4:ProgressinAbInitioProteinStructure Prediction
PROTEINS: Structure, Function, and Genetics Suppl 5:119 126 (2001) DOI 10.1002/prot.1170 RosettainCASP4:ProgressinAbInitioProteinStructure Prediction RichardBonneau, 1 JerryTsai, 1 IngoRuczinski, 1 DylanChivian,
More informationBIRKBECK COLLEGE (University of London)
BIRKBECK COLLEGE (University of London) SCHOOL OF BIOLOGICAL SCIENCES M.Sc. EXAMINATION FOR INTERNAL STUDENTS ON: Postgraduate Certificate in Principles of Protein Structure MSc Structural Molecular Biology
More informationVALLIAMMAI ENGINEERING COLLEGE
VALLIAMMAI ENGINEERING COLLEGE SRM Nagar, Kattankulathur 603 203 DEPARTMENT OF COMPUTER SCIENCE AND ENGINEERING QUESTION BANK VII SEMESTER BM6005 BIO INFORMATICS Regulation 2013 Academic Year 2018-19 Prepared
More informationSuppl. Figure 1: RCC1 sequence and sequence alignments. (a) Amino acid
Supplementary Figures Suppl. Figure 1: RCC1 sequence and sequence alignments. (a) Amino acid sequence of Drosophila RCC1. Same colors are for Figure 1 with sequence of β-wedge that interacts with Ran in
More informationGenetic Algorithms For Protein Threading
From: ISMB-98 Proceedings. Copyright 1998, AAAI (www.aaai.org). All rights reserved. Genetic Algorithms For Protein Threading Jacqueline Yadgari #, Amihood Amir #, Ron Unger* # Department of Mathematics
More informationProtein Folding Problem I400: Introduction to Bioinformatics
Protein Folding Problem I400: Introduction to Bioinformatics November 29, 2004 Protein biomolecule, macromolecule more than 50% of the dry weight of cells is proteins polymer of amino acids connected into
More informationIntroduction to Bioinformatics
Introduction to Bioinformatics http://1.51.212.243/bioinfo.html Dr. rer. nat. Jing Gong Cancer Research Center School of Medicine, Shandong University 2011.10.19 1 Chapter 4 Structure 2 Protein Structure
More informationHomology Modeling of Mouse orphan G-protein coupled receptors Q99MX9 and G2A
Quality in Primary Care (2016) 24 (2): 49-57 2016 Insight Medical Publishing Group Research Article Homology Modeling of Mouse orphan G-protein Research Article Open Access coupled receptors Q99MX9 and
More informationProtein structure. Predictive methods
Protein structure Predictive methods Sources for this lecture Park et al, Sequence comparisons using multiple sequences detect three times as many remote homologues as pairwise methods. JMB 1998 David
More informationThe RNA tools registry
university of copenhagen f a c u lt y o f h e a lt h a n d m e d i c a l s c i e n c e s The RNA tools registry A community effort to catalog RNA bioinformatics resources and their relationships Anne Wenzel
More informationProtein Bioinformatics PH Final Exam
Name (please print) Protein Bioinformatics PH260.655 Final Exam => take-home questions => open-note => please use either * the Word-file to type your answers or * print out the PDF and hand-write your
More informationBiochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur. Lecture - 5 Protein Structure - III
Biochemistry Prof. S. DasGupta Department of Chemistry Indian Institute of Technology Kharagpur Lecture - 5 Protein Structure - III This is lecture number three on protein structure. (Refer Slide Time:
More informationThe Double Helix. DNA and RNA, part 2. Part A. Hint 1. The difference between purines and pyrimidines. Hint 2. Distinguish purines from pyrimidines
DNA and RNA, part 2 Due: 3:00pm on Wednesday, September 24, 2014 You will receive no credit for items you complete after the assignment is due. Grading Policy The Double Helix DNA, or deoxyribonucleic
More informationProtein structure prediction in 2002 Jack Schonbrun, William J Wedemeyer and David Baker*
sb120317.qxd 24/05/02 16:00 Page 348 348 Protein structure prediction in 2002 Jack Schonbrun, William J Wedemeyer and David Baker* Central issues concerning protein structure prediction have been highlighted
More informationIntroduction. CS482/682 Computational Techniques in Biological Sequence Analysis
Introduction CS482/682 Computational Techniques in Biological Sequence Analysis Outline Course logistics A few example problems Course staff Instructor: Bin Ma (DC 3345, http://www.cs.uwaterloo.ca/~binma)
More informationHomology modeling and structural validation of tissue factor pathway inhibitor
www.bioinformation.net Hypothesis Volume 9(16) Homology modeling and structural validation of tissue factor pathway inhibitor Piyush Agrawal, Zoozeal Thakur & Mahesh Kulharia* Centre for Bioinformatics,
More informationECS 129: Structural Bioinformatics March 15, 2016
Notes: ES 129: Structural Bioinformatics March 15, 2016 1) The final exam is open book, open notes. 2) The final is divided into 2 parts, and graded over 100 points (with 8 points extra credit) 3) You
More informationComputational Methods for Protein Structure Prediction
Computational Methods for Protein Structure Prediction Ying Xu 2017/12/6 1 Outline introduction to protein structures the problem of protein structure prediction why it is possible to predict protein structures
More informationProtein Structure Prediction
Protein Structure Prediction 1 Protein Structure Prediction Primary Structure Secondary Structure Prediction Tertiary Structure Prediction Prediction of Coiled Coil Domains Prediction of Transmembrane
More informationTutorial. Visualize Variants on Protein Structure. Sample to Insight. November 21, 2017
Visualize Variants on Protein Structure November 21, 2017 Sample to Insight QIAGEN Aarhus Silkeborgvej 2 Prismet 8000 Aarhus C Denmark Telephone: +45 70 22 32 44 www.qiagenbioinformatics.com AdvancedGenomicsSupport@qiagen.com
More informationRecapitulation of Protein Family Divergence using Flexible Backbone Protein Design
doi:10.1016/j.jmb.2004.11.062 J. Mol. Biol. (2005) 346, 631 644 Recapitulation of Protein Family Divergence using Flexible Backbone Protein Design Christopher T. Saunders 1 and David Baker 2 * 1 Department
More informationModel based design of inhibitors for c-jun
Model based design of inhibitors for c-jun Pallavi Chauhan 1, *, Madhvi Shakya 2 1 Department of Bioinformatics, 2 Department of Mathematics, MANIT, Bhopal, MP, India; Pallavi Chauhan - Email: pallavi.chauhan2006@gmail.com;
More informationDesigning and benchmarking the MULTICOM protein structure prediction system
Li et al. BMC Structural Biology 2013, 13:2 RESEARCH ARTICLE Open Access Designing and benchmarking the MULTICOM protein structure prediction system Jilong Li 1, Xin Deng 1, Jesse Eickholt 1 and Jianlin
More informationPermutation Clustering of the DNA Sequence Facilitates Understanding of the Nonlinearly Organized Genome
RESEARCH PROPOSAL Permutation Clustering of the DNA Sequence Facilitates Understanding of the Nonlinearly Organized Genome Qiao JIN School of Medicine, Tsinghua University Advisor: Prof. Xuegong ZHANG
More informationAmino Acids. Amino Acid Structure
Amino Acids Pratt & Cornely Chapter 4 Alpha carbon Sidechain Proteins peptides Amino Acid Structure 1 L amino acids Glycine R/S vs D/L L isoleucine racemization Stereochemisty Common Amino Acids 2 Which
More informationA REVIEW OF ARTIFICIAL INTELLIGENCE TECHNIQUES APPLIED TO PROTEIN STRUCTURE PREDICTION
A REVIEW OF ARTIFICIAL INTELLIGENCE TECHNIQUES APPLIED TO PROTEIN STRUCTURE PREDICTION Jiang Ye B.Sc., University of Ottawa, 2003 A PROJECT SUBMITTED IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE
More informationProfile-Profile Alignment: A Powerful Tool for Protein Structure Prediction. N. von Öhsen, I. Sommer, R. Zimmer
Profile-Profile Alignment: A Powerful Tool for Protein Structure Prediction N. von Öhsen, I. Sommer, R. Zimmer Pacific Symposium on Biocomputing 8:252-263(2003) PROFILE-PROFILE ALIGNMENT: A POWERFUL TOOL
More informationBIOINFORMATICS Introduction
BIOINFORMATICS Introduction Mark Gerstein, Yale University bioinfo.mbb.yale.edu/mbb452a 1 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu What is Bioinformatics? (Molecular) Bio -informatics One idea
More informationMATH 5610, Computational Biology
MATH 5610, Computational Biology Lecture 2 Intro to Molecular Biology (cont) Stephen Billups University of Colorado at Denver MATH 5610, Computational Biology p.1/24 Announcements Error on syllabus Class
More informationTemplate Based Modeling and Structural Refinement of Protein-Protein Interactions:
Template Based Modeling and Structural Refinement of Protein-Protein Interactions: by Brandon Govindarajoo A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of
More informationCABIOS. Objectively judging the quality of a protein structure from a Ramachandran plot. Rob W.W.Hooft, Chris Sander and Gerrit Vriend
CABIOS Vol. 13 no. 4 1997 Pages 425-430 Objectively judging the quality of a protein structure from a Ramachandran plot Rob W.W.Hooft, Chris Sander and Gerrit Vriend Abstract Motivation: Statistical methods
More informationCHEM 436 / 630. Molecular modelling of proteins. Winter 2018 Term. Instructor: Guillaume Lamoureux Concordia University, Montréal, Canada
CHEM 436 / 630 Molecular modelling of proteins Winter 2018 Term Instructor: Guillaume Lamoureux Concordia University, Montréal, Canada Syllabus: http://faculty.concordia.ca/glamoure/pdfs/chem436_630_syllabus_2018.pdf
More informationGrundlagen der Bioinformatik Summer Lecturer: Prof. Daniel Huson
Grundlagen der Bioinformatik, SoSe 11, D. Huson, April 11, 2011 1 1 Introduction Grundlagen der Bioinformatik Summer 2011 Lecturer: Prof. Daniel Huson Office hours: Thursdays 17-18h (Sand 14, C310a) 1.1
More informationStructure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München
Structure formation and association of biomolecules Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Motivation Many biomolecules are chemically synthesized
More informationCMSE 520 BIOMOLECULAR STRUCTURE, FUNCTION AND DYNAMICS
CMSE 520 BIOMOLECULAR STRUCTURE, FUNCTION AND DYNAMICS (Computational Structural Biology) OUTLINE Review: Molecular biology Proteins: structure, conformation and function(5 lectures) Generalized coordinates,
More informationThis practical aims to walk you through the process of text searching DNA and protein databases for sequence entries.
PRACTICAL 1: BLAST and Sequence Alignment The EBI and NCBI websites, two of the most widely used life science web portals are introduced along with some of the principal databases: the NCBI Protein database,
More informationStructural Bioinformatics GENOME 541 Spring 2018
Molecular composition of a rapidly dividing Escherichia coli cell Structural Bioinformatics GENOME 541 Spring 2018 Lecture 4: Nucleic Acids Frank DiMaio (dimaio@uw.edu) The major biopolymers DNA structure
More informationFunctional profiling of metagenomic short reads: How complex are complex microbial communities?
Functional profiling of metagenomic short reads: How complex are complex microbial communities? Rohita Sinha Senior Scientist (Bioinformatics), Viracor-Eurofins, Lee s summit, MO Understanding reality,
More informationIntroduction to Cellular Biology and Bioinformatics. Farzaneh Salari
Introduction to Cellular Biology and Bioinformatics Farzaneh Salari Outline Bioinformatics Cellular Biology A Bioinformatics Problem What is bioinformatics? Computer Science Statistics Bioinformatics Mathematics...
More informationproteins Interplay of I-TASSER and QUARK for template-based and ab initio protein structure prediction in CASP10 Yang Zhang 1,2 * INTRODUCTION
proteins STRUCTURE O FUNCTION O BIOINFORMATICS Interplay of I-TASSER and QUARK for template-based and ab initio protein structure prediction in CASP10 Yang Zhang 1,2 * 1 Department of Computational Medicine
More informationproteins Interplay of I-TASSER and QUARK for template-based and ab initio protein structure prediction in CASP10 Yang Zhang 1,2 * INTRODUCTION
proteins STRUCTURE O FUNCTION O BIOINFORMATICS Interplay of I-TASSER and QUARK for template-based and ab initio protein structure prediction in CASP10 Yang Zhang 1,2 * 1 Department of Computational Medicine
More informationProtein Structure. Protein Structure Tertiary & Quaternary
Lecture 4 Protein Structure Protein Structure Tertiary & Quaternary Dr. Sameh Sarray Hlaoui Primary structure: The linear sequence of amino acids held together by peptide bonds. Secondary structure: The
More informationLigand docking. CS/CME/Biophys/BMI 279 Oct. 22 and 27, 2015 Ron Dror
Ligand docking CS/CME/Biophys/BMI 279 Oct. 22 and 27, 2015 Ron Dror 1 Outline Goals of ligand docking Defining binding affinity (strength) Computing binding affinity: Simplifying the problem Ligand docking
More informationBIMM 143: Introduction to Bioinformatics (Winter 2018)
BIMM 143: Introduction to Bioinformatics (Winter 2018) Course Instructor: Dr. Barry J. Grant ( bjgrant@ucsd.edu ) Course Website: https://bioboot.github.io/bimm143_w18/ DRAFT: 2017-12-02 (20:48:10 PST
More informationPacific Symposium on Biocomputing 5: (2000)
HOW UNIVERSAL ARE FOLD RECOGNITION PARAMETERS. A COMPREHENSIVE STUDY OF ALIGNMENT AND SCORING FUNCTION PARAMETERS INFLUENCE ON RECOGNITION OF DISTANT FOLDS. KRZYSZTOF A. OLSZEWSKI Molecular Simulations
More informationEvery thing you always wanted to know about ARP/wARP(and were probably afraid to ask...) Tim Wiegels Lamzin Group (ARP/wARP), EMBL Hamburg
Every thing you always wanted to know about ARP/wARP(and were probably afraid to ask...) Tim Wiegels Lamzin Group (ARP/wARP), EMBL Hamburg About EMBL Established in 1974 to reflect the need for a European
More informationMOL204 Exam Fall 2015
MOL204 Exam Fall 2015 Exercise 1 15 pts 1. 1A. Define primary and secondary bioinformatical databases and mention two examples of primary bioinformatical databases and one example of a secondary bioinformatical
More informationProtein structure and evolution in the light of flexibility
Protein structure and evolution in the light of flexibility - Doctoral Thesis Statements - Annamária Franciska Ángyán Doctoral School of Chemistry Head of Doctoral School: Dr. György Inzelt, D.Sc. Synthetic
More information