Product Datasheet. Caspase-3 Antibody NBP Unit Size: 0.1 ml
|
|
- Julius Nash
- 5 years ago
- Views:
Transcription
1 Product Datasheet Caspase-3 Antibody NBP Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Publications: 1 Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 6/17/2018 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at
2 NBP Caspase-3 Antibody Product Information Unit Size Concentration Storage Clonality Preservative Isotype Purity Buffer 0.1 ml Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Polyclonal 0.02% Sodium Azide IgG Immunogen affinity purified PBS (ph 7.2) and 40% Glycerol Page 1 of 5 v.20.1 Updated 6/17/2018 Product Description Host Rabbit Gene ID 836 Gene Symbol Species CASP3 Human, Rat Reactivity Notes Rat reactivity reported in scientific literature (PMID: ). Mouse (84%). Specificity/Sensitivity Immunogen Product Application Details Applications Specificity of human Caspase-3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. This antibody was developed against Recombinant Protein corresponding to amino acids: HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANL RETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIF GTNGPVDL Western Blot, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin Recommended Dilutions Western Blot 0.4 ug/ml, Immunohistochemistry 1:500-1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry- Paraffin 1:500-1:1000 Application Notes For IHC-Paraffin, HIER ph 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
3 Images Western Blot: Caspase-3 Antibody [NBP ] - Analysis in human cell line HDLM-2. Page 2 of 5 v.20.1 Updated 6/17/2018 Immunocytochemistry/Immunofluorescence: Caspase-3 Antibody [NBP ] - Staining of human cell line U-251 MG shows localization to nucleoplasm and mitochondria. Antibody staining is shown in green. Immunohistochemistry-Paraffin: Caspase-3 Antibody [NBP ] - Staining in human duodenum and kidney tissues using anti-casp3 antibody. Corresponding CASP3 RNA-seq data are presented for the same tissues. Immunohistochemistry-Paraffin: Caspase-3 Antibody [NBP ] - Staining of human duodenum shows high expression.
4 Immunohistochemistry-Paraffin: Caspase-3 Antibody [NBP ] - Staining of human kidney shows low expression as expected. Page 3 of 5 v.20.1 Updated 6/17/2018 Publications Contin MA, Arietti MM, Benedetto MM et al. Photoreceptor damage induced by low-intensity light: model of retinal degeneration in mammals. Mol Vis 2013 [PMID: ] (WB, Rat)
5 Novus Biologicals USA 8100 Southpark Way, A-8 Littleton, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Products Related to NBP NBP NBP PEP HAF008 NB7156 NBP Caspase-3 Knockout HeLa Cell Lysate Caspase-3 Recombinant Protein Antigen Goat anti-rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Goat anti-rabbit IgG (H+L) Secondary Antibody Rabbit IgG Isotype Control Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product:
6