Product Datasheet. MBP Antibody NBP Unit Size: 0.1 ml. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Transcription

1 Product Datasheet MBP Antibody NBP Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 2/28/2018 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at

2 NBP MBP Antibody Product Information Unit Size Concentration Storage Clonality Preservative Isotype Purity Buffer 0.1 ml Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Polyclonal 0.02% Sodium Azide IgG Immunogen affinity purified PBS (ph 7.2) and 40% Glycerol Page 1 of 5 v.20.1 Updated 2/28/2018 Product Description Host Rabbit Gene ID 4155 Gene Symbol Species Specificity/Sensitivity Immunogen Product Application Details Applications MBP Human, Mouse Specificity of human, mouse MBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. This antibody was developed against a recombinant protein corresponding to amino acids: DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASD YKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM Western Blot, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin Recommended Dilutions Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500-1:5000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry- Paraffin 1:2500-1:5000 Application Notes Images For IHC-Paraffin, HIER ph 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. cerebellum shows immunoreactivity in granular cell layer and in white matter.

3 cerebral cortex shows labeling of neuronal processes in motor cortex and in corpus callosum. Page 2 of 5 v.20.1 Updated 2/28/2018 dorsal tenia tecta shows positivity in neuronal processes. hippocampus shows positivity in neuronal processes in the CA1 layer. olfactory bulb shows immunoreactivity in processes in external plexiform layer.

4 Western Blot: MBP Antibody [NBP ] - Analysis in mouse cerebral cortex tissue. Page 3 of 5 v.20.1 Updated 2/28/2018 Western Blot: MBP Antibody [NBP ] - Analysis in human cerebral cortex tissue. Immunohistochemistry-Paraffin: MBP Antibody [NBP ] - Staining of human cerebellum shows moderate nuclear and cytoplasmic positivity in cells in granular layer. Immunohistochemistry-Paraffin: MBP Antibody [NBP ] - Staining of human cerebral cortex shows positivity in oligodendrocytes.

5 Immunohistochemistry-Paraffin: MBP Antibody [NBP ] - Staining of human hippocampus shows moderate immunoreactivity in myelinated fibers. Page 4 of 5 v.20.1 Updated 2/28/2018

6 Novus Biologicals USA E. Briarwood Avenue Centennial, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Products Related to NBP NBP PEP HAF008 NB7156 NBP MBP Recombinant Protein Antigen Goat anti-rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Goat anti-rabbit IgG (H+L) Secondary Antibody Rabbit IgG Isotype Control Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product: