Product Datasheet. ALDH1A2 Antibody NBP Unit Size: 0.1 ml

Transcription

1 Product Datasheet ALDH1A2 Antibody NBP Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Reviews: 1 Publications: 4 Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 9/24/2018 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at

2 NBP ALDH1A2 Antibody Product Information Unit Size Concentration Storage Clonality Preservative Isotype Purity Buffer Target Molecular Weight 0.1 ml Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Polyclonal 0.02% Sodium Azide IgG Immunogen affinity purified PBS (ph 7.2) and 40% Glycerol 57 kda Page 1 of 4 v.20.1 Updated 9/24/2018 Product Description Host Rabbit Gene ID 8854 Gene Symbol Species ALDH1A2 Human Reactivity Notes Reactivity reported in scientific literature (PMID: ) Marker Specificity/Sensitivity Immunogen Product Application Details Applications Dorso-temporal Retina Marker Specificity of human ALDH1A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. This antibody was developed against Recombinant Protein corresponding to amino acids: VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEP TVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINK ALTVSSAMQAGTV Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry- Paraffin Recommended Dilutions Western Blot 0.4 ug/ml, Simple Western, Immunohistochemistry 1:500-1:1000, Immunohistochemistry-Paraffin 1:500-1:1000 Application Notes For IHC-Paraffin, HIER ph 6 retrieval is recommended.

3 Images Western Blot: ALDH1A2 Antibody [NBP ] - Analysis in human cell line K562. Page 2 of 4 v.20.1 Updated 9/24/2018 Staining in human endometrium and skin tissues. Corresponding ALDH1A2 RNA-seq data are presented for the same tissues. Staining of human endometrium shows moderate to strong cytoplasmic positivity in cells in endometrial stroma. Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

4 Staining of human skin shows weak cytoplasmic positivity in a subset of keratinocytes. Page 3 of 4 v.20.1 Updated 9/24/2018 Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts. Simple Western: ALDH1A2 Antibody [NBP ] - Detection of ALDH1A2 in K562 cells using ALDH1A2 antibody at a dilution of 1:50. K (lane 1) = Wild Type K562, I (lane 2) = Imatinib Resistant K562, N (lane 3) = Nilotinib Resistant K562 and D (lane 4) = Dasatinib Resistant K562. Image from verified customer review. Publications Seidensaal K, Nollert A, Feige AH et al. Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma. Mol Cancer 2015 Dec 03 [PMID: ] (IHC, Human) Harper AR, Wiechmann AF, Moiseyev G et al. Identification of Active Retinaldehyde Dehydrogenase Isoforms in the Postnatal Human Eye. PLoS One 2015 [PMID: ] (IHC, WB, Human) Rizzardi AE, Rosener NK, Koopmeiners JS et al. Evaluation of protein biomarkers of prostate cancer aggressiveness. BMC Cancer 2014 Apr 5 [PMID: ] (IHC, Human) Kostareli E, Holzinger D, Bogatyrova O et al. HPV-related methylation signature predicts survival in oropharyngeal squamous cell carcinomas. J Clin Invest 2013 Jun [PMID: ]

5 Novus Biologicals USA E. Briarwood Avenue Centennial, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Products Related to NBP NBP PEP HAF008 NB7156 NBP ALDH1A2 Recombinant Protein Antigen Goat anti-rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Goat anti-rabbit IgG (H+L) Secondary Antibody Rabbit IgG Isotype Control Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product: