Product Datasheet. CD11b Antibody (CL1719) NBP Unit Size: 0.1 ml

Transcription

1 Product Datasheet CD11b Antibody (CL1719) NBP Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 12/21/2018 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at

2 NBP CD11b Antibody (CL1719) Product Information Unit Size Concentration Storage Clonality Clone Preservative Isotype Purity Buffer Target Molecular Weight 0.1 ml Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Monoclonal CL % Sodium Azide IgG1 Protein A purified PBS (ph 7.2) and 40% Glycerol 127 kda Page 1 of 4 v.20.1 Updated 12/21/2018 Product Description Host Mouse Gene ID 3684 Gene Symbol Species Marker Specificity/Sensitivity Immunogen Product Application Details Applications ITGAM Human Microglia Marker, Macrophage Marker Specificity of human CD11b antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. This antibody was developed against a recombinant protein corresponding to amino acids: LNFTASENTSRVMQHQYQVSNLGQRSLPISLVFLVPVRLNQTVIWDRPQVTFS ENLSSTCHTKERLPSHSDFLAELRKAPVVNCSIAVCQRIQCDIPFFGIQEEFNAT LKGNLSFDWYIKTSHNHLLIVSTAEIL Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin Recommended Dilutions Western Blot 1:500-1:1000, Immunohistochemistry 1:1000-1:2500, Immunohistochemistry-Paraffin 1:1000-1:2500 Application Notes Images For IHC-Paraffin, HIER ph 6 retrieval is recommended. Western Blot: CD11b Antibody (CL1719) [NBP ] - Lane 1: Marker [kda] Lane 2: Human tonsil

3 34490] - Staining of human cerebral cortex shows moderate membranous positivity in microglia. Page 2 of 4 v.20.1 Updated 12/21/ ] - Staining of human tonsil shows strong membranous positivity in germinal center cells ] - Staining of human colon shows moderate membranous positivity in lymphoid cells ] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

4 34490] - Staining in human tonsil and skeletal muscle tissues. Corresponding ITGAM RNA-seq data are presented for the same tissues. Page 3 of 4 v.20.1 Updated 12/21/2018

5 Novus Biologicals USA E. Briarwood Avenue Centennial, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Products Related to NBP HAF007 NB720-B NBP H Q01-10ug Goat anti-mouse IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Rabbit anti-mouse IgG (H+L) Secondary Antibody [Biotin] Mouse IgG1 Isotype Control (MG1) Recombinant Human CD11b Protein Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product: