Product Datasheet. PKC alpha Antibody (2F11) H M01. Unit Size: 0.1 mg. Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Transcription

1 Product Datasheet PKC alpha Antibody (2F11) H M01 Unit Size: 0.1 mg Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 4/5/2017 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at

2 H M01 PKC alpha Antibody (2F11) Product Information Unit Size Concentration Storage Clonality Clone Preservative Isotype Purity 0.1 mg Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. Monoclonal 2F11 No Preservative IgG1 Kappa IgG purified Buffer PBS (ph 7.4) Product Description Host Mouse Gene ID 5578 Gene Symbol Species Specificity/Sensitivity Immunogen Notes PRKCA Human PRKCA - protein kinase C, alpha Page 1 of 4 v.20.1 Updated 4/5/2017 PRKCA (NP_ a.a a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFK PKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQ SAV Quality control test: Antibody Reactive Against Recombinant Protein. This product is produced by and distributed for Abnova, a company based in Taiwan. Product Application Details Applications Recommended Dilutions Application Notes Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Proximity Ligation Assay Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Proximity Ligation Assay Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

3 Images Western Blot: PKC alpha Antibody (2F11) [H M01] - PRKCA monoclonal antibody (M01), clone 2F11 Analysis of PRKCA expression in HeLa. Page 2 of 4 v.20.1 Updated 4/5/2017 Immunocytochemistry/Immunofluorescence: PKC alpha Antibody (2F11) [H M01] - Analysis of monoclonal antibody to PRKCA on HeLa cell. Antibody concentration 10 ug/ml. Immunohistochemistry-Paraffin: PKC alpha Antibody (2F11) [H M01] - Analysis of monoclonal antibody to PRKCA on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 1 ug/ml. Proximity Ligation Assay: PKC alpha Antibody (2F11) [H M01] - Analysis of protein-protein interactions between FAS and PRKCA. HeLa cells were stained with anti-fas rabbit purified polyclonal 1:1200 and anti-prkca mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

4 ELISA: PKC alpha Antibody (2F11) [H M01] - Detection limit for recombinant GST tagged PRKCA is approximately 0.1ng/ml as a capture antibody. Page 3 of 4 v.20.1 Updated 4/5/2017

5 Novus Biologicals USA E. Briarwood Avenue Centennial, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Products Related to H M01 HAF007 NB720-B NBP mg NBP PEP Goat anti-mouse IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Rabbit anti-mouse IgG (H+L) Secondary Antibody [Biotin] Mouse, Human IgG1 Kappa Light Chain Isotype Control (P ) PKC alpha Recombinant Protein Antigen Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product: