Research Biochemicals. ANTIBODIES TO PRION PROTEINS
|
|
- Benedict Patterson
- 6 years ago
- Views:
Transcription
1 Research Biochemicals. ANTIBODIES TO PRION PROTEINS 2005_03
2 Research Biochemicals. TABLE OF CONTENTS MONOCLONAL AB 6H4 3 MONOCLONAL AB 34C9 4 RECOMBINANT BOVINE PRP 5 PRICE LIST 7 ORDER INFORMATION 8 2
3 Antibodies. MONOCLONAL ANTIBODY 6H4 Product No µg monoclonal anti-prp antibody 6H4 (mab 6H4) mg monoclonal anti-prp antibody 6H4 (mab 6H4) monoclonal antibody to prion protein Product description Monoclonal antibody (mab) 6H4 is a mouse IgG1 subtype antibody. Light chain: κ subtype Concentration Culture supernatant; approx mg/ml, see vial label. > 95% pure antibody Specificity mab 6H4 recognizes the sequence DYEDRYYRE in the prion protein (human PrP: amino acids ). This sequence is conserved in most known mammalian PrP sequences (human, cattle, sheep, rabbit, mink, and a variety of primates). In mouse, hamster and rat, the tyrosine at position 145 is replaced by a tryptophan. However, mab 6H4 reacts on Western blots with mouse and hamster PrP indicating that the substitution at position 145 does not prevent binding of 6H4. Stability and storage mab 6H4 was produced in serum-free medium. There are essentially no other proteins present. In the TM medium, phenol red and basic nutrients like amino acids are still present. The antibody is supplied with 10 mm sodium azide as preservative. For long term storage, the antibody can be kept frozen at -20 C. Repeated freezing/thawing cycles should be avoided. Applications mab 6H4 can be used for Western blotting and ELISA at a dilution of 1: : Immunohistochemical staining of PrP is currently performed in various laboratories. (see application literature 3
4 Antibodies. MONOCLONAL ANTIBODY 34C9 Product No µg monoclonal anti-prp antibody 34C9 (mab 34C9) mg monoclonal anti-prp antibody 34C9 (mab 34C9) monoclonal antibody to prion protein Product description Monoclonal antibody (mab) 34C9 is a mouse IgG2b subtype antibody. Light chain: κ subtype Concentration Culture supernatant; approx mg/ml, see vial label. > 95% pure antibody Specificity mab 34C9 recognizes the sequence LIHFG in the bovine prion protein (corresponding to position with numbering according to the human PrP). This sequence is conserved in bovine, rabbit, pig, and mule deer PrP sequences but not in human, mouse or hamster PrP. Stability and storage mab 34C9 was produced in serum-free medium. There are essentially no other proteins present. In the TM medium, phenol red and basic nutrients like amino acids are still present. The antibody is supplied with 10 mm sodium azide as preservative. For long term storage, the antibody can be kept frozen at -20 C. Repeated freezing/thawing cycles should be avoided. Applications mab 34C9 can be used for Western blotting at a dilution of 1: :
5 Recombinant Proteins. RECOMBINANT BOVINE PrP Product No µg lyophilized recombinant bovine PrP (rec bovprp) recombinant bovine prion protein Product description Highly purified recombinant bovine prion protein (rec bovprp) (Ref. 1). The nucleotide sequence corresponding to the mature primary structure of bovine PrP (amino acids ) was amplified by PCR from genomic DNA. The PCR product was cloned into pprio and expressed in an E. coli K12 strain. Expressed rec bovprp was solubilized in 6 M Guanidine Hydrochloride from inclusion bodies, oxidized, and purified by various chromatographic steps. The MW is Da. The extinction coefficient in aqueous solution at 280 nm is M -1 xcm -1. Sequence MKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHG 50 GGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHGQWNKPSKPKTNMKHV 100 AGAAAAGAVVGGLGGYMLGSAMSRPLIHFGSDYEDRYYRENMHRYPNQVY 150 YRPVDQYSNQNNFVHDCVNITVKEHTVTTTTKGENFTETDIKMMERVVEQ 200 MCITQYQRESQAYYQRGAS 219 Stabilizer & Preservatives None Stability and storage Lyophilized: Stable at -20 C if not opened. Lyophilized protein is dissolved best in H 2 O. Dissolving in a buffer might lead to precipitation. Applications Recombinant bovine PrP is ideal as standard and positive control for Western Blot and ELISA. Hazard Data Recombinant PrP of any species has to date not been shown to contain infectivity (Ref. 2-4). However, it should be noted that this does not conclusively exclude possible hazardous effects under all circumstances, particularly since the details of the molecular mechanism underlying the propagation of the TSE infectious agent have not yet been resolved (Ref. 5-7). 5
6 Handling and Safety Guidelines Handle according to local legal guidelines. Avoid contact with eyes, skin, and clothing. Avoid aerosol forming procedures. Do not ingest. References 1 Korth C, Stierli B, Streit P, Moser M, Schaller O, Fischer R, Schulzschaeffer W, Kretzschmar H, Raeber A, Braun U, Ehrensperger F, Hornemann S, Glockshuber R, Riek R, Billeter M, Wuthrich K, Oesch B (1997). Prion (PrP Sc )-specific epitope defined by a monoclonal antibody. Nature 390 (6655), Hill AF, Antoniou M, Collinge J (1999). Protease-resistant prion protein produced in vitro lacks detectable infectivity. J Gen Virol 80, Post K, Brown DR, Groschup M, Kretzschmar HA, Riesner D (2000). Neurotoxicity but not infectivity of prion proteins can be induced reversibly in vitro. Arch Virol Suppl 2000 (16), Volkel D, Blankenfeldt W, Schomburg D (1998). Large-scale production, purification and refolding of the full-length cellular prion protein from Syrian golden hamster in Escherichia coli using the glutathione S-transferase-fusion system. Eur J Biochem 251(1-2), Kaneko K, Petetz D, Pan KM, Blochberger TC, Wille H, Gabizon R, Griffith OH, Cohen FE, Baldwin MA, Prusiner SB (1995). Prion Protein (PrP) synthetic peptides induce cellular PrP to acquire properties of the scrapie isoform. Proc Natl Acad Sci USA 92, Weissmann C (1999). Molecular genetics of transmissible spongiform encephalopathies. J Biol Chem 274(1), Prusiner SB (1998). Prions. Proc Natl Acad Sci U S A 95(23),
7 Research Biochemicals. TRANSFER PRICE LIST 2005 Product Number Product Name Pack Size Quantity Price (in CHF) Price (in ) Price (in USD) Antibodies µ mab 6H4 100 g 1 1' mab 6H4 1 mg 1 8' ' '800.- µ mab 34C9 100 g 1 1' mab 34C9 1 mg 1 8' ' '800.- rec PrP µ rec PrP bovine 100 g
8 Research Biochemicals. ORDER INFORMATION On request we will be pleased to send you the general terms and conditions Price Rebate Order Address DDU (transport costs will be charged separately) 10% for Universities (for Antibodies and/or rec PrP) Prionics AG Order Intake Wagistrasse 27a CH-8952 Schlieren-Zurich Switzerland PHONE: FAX:
9 8952 SCHLIEREN
The Expression of Recombinant Sheep Prion Protein (RecShPrPC) and its Detection Using Western Blot and Immuno-PCR
The Expression of Recombinant Sheep Prion Protein (RecShPrPC) and its Detection Using Western Blot and Immuno-PCR S. Thomas, C. S. Fernando, J. Roach, U. DeSilva and C. A. Mireles DeWitt The objective
More informationMethod for Folding of Recombinant Prion Protein to Soluble β-sheet Secondary Structure
Chapter 2 Method for Folding of Recombinant Prion Protein to Soluble β-sheet Secondary Structure Laura J. Ellett Abstract A key event in the pathogenesis of prion diseases is the change in structure of
More informationAnaTag HiLyte Fluor 647 Protein Labeling Kit
AnaTag HiLyte Fluor 647 Protein Labeling Kit Catalog # 72049 Kit Size 3 Conjugation Reactions This kit is optimized to conjugate HiLyte Fluor 647 SE to proteins (e.g., IgG). It provides ample materials
More informationDetection of Bovine Spongiform Encephalopathy-Specific PrP Sc by Treatment with Heat and Guanidine Thiocyanate
JOURNAL OF VIROLOGY, Nov. 1999, p. 9386 9392 Vol. 73, No. 11 0022-538X/99/$04.00 0 Copyright 1999, American Society for Microbiology. All Rights Reserved. Detection of Bovine Spongiform Encephalopathy-Specific
More informationWestern-GUARANTEED Antibody Service FAQ
Western-GUARANTEED Antibody Service FAQ Content Q 1: When do I need a Western GUARANTEED Peptide Antibody Package?...2 Q 2: Can GenScript provide a Western blot guaranteed antibody?...2 Q 3: Does GenScript
More informationMATF Antigen Submission Details and Standard Project Deliverables
MATF Antigen Submission Details and Standard Project Deliverables What we require when you submit your antigen: Proteins For a recombinant protein target, we require a minimum of 400µg soluble recombinant
More informationGeneric DELFIA Reagents
AD0005P-12 (en) 1 Generic DELFIA Reagents For Research Use Only These instructions for use apply to the following reagents: AD0038 DELFIA Eu-N1 PY20 antibody 50 µg vial AD0039 DELFIA Eu-N1 PY20 antibody
More informationMouse Monoclonal Antibody Isotyping Reagents
Mouse Monoclonal Antibody Isotyping Reagents Catalog Number: SEK003 Storage Temperature: 2-8 C Fax : +86-10-58628220 Tel : +86-400-890-9989 http://www.sinobiological.com Description Mouse Monoclonal Antibody
More informationSpecies predicted to react based on 100% sequence homology: Chicken, Bovine, Dog.
1 of 5 11/1/2013 10:25 PM Product Pathways - Jak/Stat Pathway Phospho-Stat3 (Tyr705) Antibody #9131 Have you tried your application using our XP monoclonal antibodies? Try products: 9145 PhosphoSitePlus
More information1. Cross-linking and cell harvesting
ChIP is a powerful tool that allows the specific matching of proteins or histone modifications to regions of the genome. Chromatin is isolated and antibodies to the antigen of interest are used to determine
More informationPurification Kits. Fast and Convenient PROSEP -A and PROSEP-G Spin Column Kits for Antibody Purification DATA SHEET
 Montage Antibody Purification Kits Fast and Convenient PROSEP -A and PROSEP-G Spin Column Kits for Antibody Purification DATA SHEET Available with immobilized Protein A or Protein G Easy-to-use Antibody
More informationWesternMAX Alkaline Phosphatase Chemiluminescent Detection Kits
WesternMAX Alkaline Phosphatase Chemiluminescent Detection Kits Code N221-KIT N220-KIT Description WesternMAX Chemiluminescent AP Kit, Anti-Mouse Includes: Alkaline Phosphatase (AP) Conjugated Anti-Mouse
More informationCERTIFICATE OF ANALYSIS
5171 Wilfong Road Memphis, TN 38134 Telephone: 901-382-8716 Fax: 901-333-8223 Email: info@meridianlifescience.com www.meridianlifescience.com CERTIFICATE OF ANALYSIS Important Note: Centrifuge before opening
More informationCustom Antibodies Services. GeneCust Europe. GeneCust Europe
GeneCust Europe Laboratoire de Biotechnologie du Luxembourg S.A. 2 route de Remich L-5690 Ellange Luxembourg Tél. : +352 27620411 Fax : +352 27620412 Email : info@genecust.com Web : www.genecust.com Custom
More informationChapter 17: Immunization & Immune Testing. 1. Immunization 2. Diagnostic Immunology
Chapter 17: Immunization & Immune Testing 1. Immunization 2. Diagnostic Immunology 1. Immunization Chapter Reading pp. 505-511 What is Immunization? A method of inducing artificial immunity by exposing
More informationEfficient Conversion of Normal Prion Protein (PrP) by Abnormal Hamster PrP Is Determined by Homology at Amino Acid Residue 155
JOURNAL OF VIROLOGY, May 2001, p. 4673 4680 Vol. 75, No. 10 0022-538X/01/$04.00 0 DOI: 10.1128/JVI.75.10.4673 4680.2001 Copyright 2001, American Society for Microbiology. All Rights Reserved. Efficient
More informationrprotein A GraviTrap Protein G GraviTrap rprotein A/Protein G GraviTrap
GE Healthcare Life Sciences Data file 28-9921-04 AA rprotein A GraviTrap Protein G GraviTrap rprotein A/Protein G GraviTrap Protein sample preparation rprotein A GraviTrap, Protein G GraviTrap, and rprotein
More informationRayBio Phospho- Stat 3 (Tyr705) ELISA Kit
RayBio Phospho- Stat 3 (Tyr705) ELISA Kit For Measuring Phosphorylated Stat3 (Tyr705) in Human, Mouse and Rat Cell Lysates User Manual (Revised Mar 1, 2012) RayBio Stat3 (Tyr705) ELISA Kit Protocol (Cat#:
More informationProtein Purification Products. Complete Solutions for All of Your Protein Purification Applications
Protein Purification Products Complete Solutions for All of Your Protein Purification Applications FLAG-Tagged Protein Products EXPRESS with the pcmv-dykddddk Vector Set Fuse your protein of interest to
More informationINOS. Colorimetric Cell-Based ELISA Kit. Catalog #: OKAG00807
INOS Colorimetric Cell-Based ELISA Kit Catalog #: OKAG00807 Please read the provided manual entirely prior to use as suggested experimental protocols may have changed. Research Purposes Only. Not Intended
More informationHow to run Alpha assay: How to setup an Alpha assay Make your own assay!
How to run Alpha assay: How to setup an Alpha assay Make your own assay! 1 2009 PerkinElmer AlphaLISA kits - recommendations before starting the assay Samples: Phenol red and hemoglobin: choose AlphaLISA
More informationspecial offers from your protein biology resource
special offers from your protein biology resource Pop open your cells, extract your proteins, purify, quantify and express them. Seeking knowledge about proteins with Thermo Scientific Protein Research
More informationSupplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons
Neuron, Volume 61 Supplemental Data LMO4 Controls the Balance between Excitatory and Inhibitory Spinal V2 Interneurons Kaumudi Joshi, Seunghee Lee, Bora Lee, Jae W. Lee, and Soo-Kyung Lee Supplemental
More informationHuman IL-10 ELISA MAX Set Deluxe
Human IL-10 ELISA MAX Set Deluxe Cat. No. 430604 (5 plates) 430605 (10 plates) 430606 (20 plates) ELISA Set for Accurate Cytokine Quantification from Cell Culture Supernatant, Serum, Plasma or Other Body
More informationRayBio Phospho- Akt (Ser473) ELISA Kit
RayBio Phospho- Akt (Ser473) ELISA Kit For Measuring Phosphorylated Akt (Ser473) in Human, Mouse and Rat Cell Lysates User Manual (Revised Mar 1, 2012) RayBio Akt (Ser473) ELISA Kit Protocol (Cat#: PEL-Akt-S473-001)
More informationRecombinant Antibody Production in Therapeutic Antibody Projects. Keshav Vasanthavada Senior Marketing Specialist, GenScript April 7, 2016
Recombinant Antibody Production in Therapeutic Antibody Projects Keshav Vasanthavada Senior Marketing Specialist, GenScript April 7, 2016 Presentation Outline 1 2 3 4 5 Introduction Recombinant Ab Production
More informationAcetyl-p53 (K381) Cell-Based Colorimetric ELISA Kit
Acetyl-p53 (K381) Cell-Based Colorimetric ELISA Kit Catalog No. KA8015C Detection and Quantification of Acetyl-p53 (K381) Protein Concentration in Cell. Research Purposes Only. Not Intended for Diagnostic
More informationThe World Leader in SPR Technology. Jimmy Page, PhD, Biacore, Inc.
The World Leader in SPR Technology Jimmy Page, PhD, Biacore, Inc. Objectives of Biacore Experiments Yes/No Data» Is there binding?» Ligand Fishing Concentration Analysis: How MUCH? Active Concentration
More informationApplication Note AN001
Testing hybridoma supernatants with the Spots On Dots Antibody Screening Kit Application Note AN1 Table of Contents Overview... 2 Figure 1. Screening of hybridomas raised against peptide antigens... 3
More informationCytoGLOW. IKK-α/β. Colorimetric Cell-Based ELISA Kit. Catalog #: CB5358
CytoGLOW IKK-α/β Colorimetric Cell-Based ELISA Kit Catalog #: CB5358 Please read the provided manual entirely prior to use as suggested experimental protocols may have changed. Research Purposes Only.
More informationDiscovery and Humanization of Novel High Affinity Neutralizing Monoclonal Antibodies to Human IL-17A
Discovery and Humanization of Novel High Affinity Neutralizing Monoclonal Antibodies to Human IL-17A Contacts: Marty Simonetti martysimonetti@gmail.com Kirby Alton kirby.alton@abeomecorp.com Rick Shimkets
More informationAntibody Services from GenScript
Services from GenScript www.genscript.com GenScript USA Inc. 860 Centennial Ave., Piscataway, NJ 08854 USA Toll-Free: 1-877-436-7274 Fax: 1-732-210-0262 1-732-855-5878 Academic Services Pharmaceutical
More informationTECHNICAL BULLETIN. Catalog Number RAB0012 Storage Temperature 20 C
Phospho-Akt (pser 473 )/pan-akt ELISA Kit for detection of human, mouse, or rat phospho-akt (pser 473 ) and pan-akt in cell and tissue lysates Catalog Number RAB0012 Storage Temperature 20 C TECHNICAL
More informationSupplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/-
#1074683s 1 Supplemental Online Material Materials and Methods Cell lines and tissue culture The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- knock-out animals
More informationSpin Micro DNA Extraction Kit
Spin Micro DNA Extraction Kit 2-020 20 extractions 18-25 C 1. Lysis Buffer (brown cap) 2x 2 ml R 36 2. Binding Buffer (red cap) 3x 2 ml R 11/36/67 3. Protease (orange cap) lyophilized R 36/37/38 Add 250
More informationProduct Datasheet. TGN38 Antibody NBP Unit Size: 0.5 mg
Product Datasheet TGN38 Antibody NBP1-03495 Unit Size: 0.5 mg Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Publications: 5 Protocols, Publications, Related Products,
More informationAntibodies to Animal Cells and Serum Proteins
ANTIBODIES TO ANIMAL CELLS AND SERUM PROTEINS Antibodies to Animal Cells and Serum Proteins Antibodies to Animal Cellular Antigens Antibodies to Mouse Brain Antibodies to Animal Serum Proteins INTERNATIONAL
More informationFOR RESEARCH USE ONLY. NOT FOR HUMAN OR DIAGNOSTIC USE.
Instruction manual MagExtractor-RNA-0810 F0982K MagExtractor -RNA- NPK-201F 100 preparations Store at 4 C Contents [1] Introduction [2] Components [3] Materials required [4] Protocol 1. Preparation of
More informationCell Line Characterization and Product Testing for CHO-Derived Biopharmaceutical Products
Cell Line Characterization and Product Testing for CHO-Derived Biopharmaceutical Products Founded in 96, Eurofins Lancaster Laboratories is a global leader in comprehensive laboratory services enabling
More informationPROCEDURE FOR USE NICKEL NTA Magnetic Agarose Beads (5%)
1 AFFINITY HIS-TAG PURIFICATION PROCEDURE FOR USE NICKEL NTA Magnetic Agarose Beads (5%) DESCRIPTION Nickel NTA Magnetic Agarose Beads are products that allow rapid and easy small-scale purification of
More informationAffi-Gel Protein A MAPS II Kit Instruction Manual
Affi-Gel Protein A MAPS II Kit Instruction Manual Catalog Number 153-6159 For Technical Service Call Your Local Bio-Rad Office or in the U.S. Call 1-800-4BIORAD (1-800-424-6723) Table of Contents Introduction...1
More informationPrions Other molecules besides organelle DNA are inherited in non-mendelian patterns.
Prions Other molecules besides organelle DNA are inherited in non-mendelian patterns. Examples of non-mendelian patterns of inheritance extend beyond the inheritance of organelle DNA. Certain DNA and RNA
More informationab Alkaline Phosphatase Conjugation Kit Protocol
ab102850 Alkaline Phosphatase Conjugation Kit Protocol Antibody and protein modification This product is for research use only and is not intended for diagnostic use. Version 2 Last Updated 12 March 2014
More informationConjugation Kit Protocol
ab102890 HRP Conjugation Kit Protocol Antibody and protein modification This product is for research use only and is not intended for diagnostic use. Version 5 Last Updated 1 July 2016 Table of Contents
More informationProtein A Ceramic HyperD F Affinity Chromatography Sorbent
PRODUCT NOTE BIOSEPRA Protein A Ceramic HYPERD F Protein A Ceramic HyperD F Affinity Chromatography Sorbent Ideal for large-scale antibody purification. High binding capacity for human and murine IgGs.
More informationImmunoglobulins. Harper s biochemistry Chapter 49
Immunoglobulins Harper s biochemistry Chapter 49 Immune system Detects and inactivates foreign molecules, viruses, bacteria and microorganisms Two components with 2 strategies B Lymphocytes (humoral immune
More informationNi-NTA Agarose. User Manual. 320 Harbor Way South San Francisco, CA Phone: 1 (888) MCLAB-88 Fax: 1 (650)
Ni-NTA Agarose User Manual 320 Harbor Way South San Francisco, CA 94080 Phone: 1 (888) MCLAB-88 Fax: 1 (650) 871-8796 www. Contents Introduction -----------------------------------------------------------------------
More informationPureColumn DNA Extraction Kit
Kit for isolation of DNA from canned and high processed food or other products for subsequent detection of DNA Research Use Only (RUO) Content 1. Introduction.. 2 2. Content of the Kit 3 3. Storage Conditions
More informationMouse Factor XII Total ELISA Kit
Mouse Factor XII Total ELISA Kit Catalog No: IMFXIIKT-TOT Lot No: SAMPLE INTENDED USE This mouse coagulation Factor XII antigen assay is intended for the quantitative determination of total Factor XII
More informationmcherry Monoclonal Antibody (16D7) Catalog Number M11217 Product data sheet
Website: thermofisher.com Customer Service (US): 1 800 955 6288 ext. 1 Technical Support (US): 1 800 955 6288 ext. 441 mcherry Monoclonal Antibody (16D7) Catalog Number M11217 Product data sheet Details
More informationGST Fusion Protein Purification Kit
Glutathione Resin GST Fusion Protein Purification Kit Cat. No. L00206 Cat. No. L00207 Technical Manual No. TM0185 Version 01042012 Index 1. Product Description 2. Related Products 3. Purification Procedure
More informationProtein A Mag Sepharose Xtra Protein G Mag Sepharose Xtra
GE Healthcare Data file 28-9768-1 AA Protein sample preparation Protein A Mag Sepharose Xtra Xtra products are magnetic beads designed for efficient, high capacity small-scale purification/screening of
More informationEGFR (Phospho-Ser695)
Assay Biotechnology Company www.assaybiotech.com Tel: 1-877-883-7988 Fax: 1-877-610-9758 EGFR (Phospho-Ser695) Colorimetric Cell-Based ELISA Kit Catalog #: OKAG02090 Please read the provided manual entirely
More informationLAMININ. For Immunohistochemical Demonstration of Laminin in Paraffin-embedded and Frozen Human Tissue Sections Stock No. IMMH-7
LAMININ For Immunohistochemical Demonstration of Laminin in Paraffin-embedded and Frozen Human Tissue Sections Stock No. IMMH-7 TABLE OF CONTENTS BACKGROUND AND PRINCIPLE... 4 REAGENTS AND EQUIPMENT PROVIDED...
More informationSPHERO TM Coated Particles
SPHERO TM Coated Particles Manufactured by either passive adsorption or covalent coupling depending upon the intended application Stable for several years under proper storage condition Available in a
More informationCF Dyes Next Generation Fluorescent Dyes Secondary antibody
CF Dyes Next Generation Fluorescent Dyes Secondary antibody OZYME 10 AVENUE AMPÈRE - CS 30268-78053 ST QUENTIN EN YVELINES CEDEX Tél. : 01 34 60 24 24 - Fax : 01 34 60 92 12 - www.ozyme.fr/info CF Dyes
More informationAnti-Piscirickettsia salmonis monoclonal antibody. Product no: P05
Anti-Piscirickettsia salmonis monoclonal antibody Product no: P05 Product Description The monoclonal antibody (Mab) against Piscirickettsia salmonis is specific for this bacterium. The specificity of the
More informationHigh Pure PCR Template Preparation Kit for preparation of 100 nucleic acid samples Cat. No
for preparation of 100 nucleic acid samples Cat. No. 1 796 88 Principle Cells are lysed during a short incubation with Proteinase K in the presence of a chaotropic salt (guanidine HCl), which immediately
More informationYour Antibody Source. prosci-inc.com. Extensive Antibody Services Broad Antibody Catalog
Your Source prosci-inc.com Extensive Services Broad Catalog Company Overview Established in 1998, ProSci Incorporated is a leading provider of high performance antibodies and custom antibody services.
More informationFor Research Use Only Ver
INSTRUCTION MANUAL ZR-Duet DNA/RNA MiniPrep Plus Catalog No. D7003 Highlights Efficient isolation and separation of DNA and RNA from any cells, tissue, blood, and biological fluids. High quality DNA and
More informationPolyclonal ARHGAP25 antibody was prepared from rabbit serum after intracutaneous
Preparation and purification of polyclonal antibodies Polyclonal ARHGAP25 antibody was prepared from rabbit serum after intracutaneous injections of glutathione S-transferase-ARHGAP25-(509-619) (GST-coiled
More informationab Antibody Serum Purification Kit (Protein A) Protocol
ab109209 Antibody Serum Purification Kit (Protein A) Protocol For preparing antibodies for conjugation The components of Ab109209 are fully compatible with our Conjugation kits however they are not compatible
More informationSOX2 antibody - Embryonic Stem Cell Marker (ab15830) datasheet
-Embryonic Stem Cell Marker (ab15830) 1/8 ページ d Products: Stem Cells >> Germline Stem Cells >> Embryonic Germ Cells SOX2 antibody - Embryonic Stem Cell Marker (ab15830) datasheet Product Name Product type
More informationRayBio Human, Mouse and Rat Phospho-STAT3 (Tyr705) ELISA Kit
RayBio Human, Mouse and Rat Phospho-STAT3 (Tyr705) ELISA Kit Catalog #: PEL-Stat3-Y705 User Manual Last revised August 10, 2016 Caution: Extraordinarily useful information enclosed ISO 13485 Certified
More informationMabSelect SuRe. GE Healthcare. Alkali-stabilized protein A-derived medium for capture of monoclonal antibodies. High stability in alkaline conditions
GE Healthcare Data File 11-11-65 AB Affinity chromatography MabSelect SuRe Alkali-stabilized protein A-derived medium for capture of monoclonal antibodies MabSelect SuRe (Superior Resistance) is a member
More informationIMMUNOPRECIPITATION (IP)
1 IMMUNOPRECIPITATION (IP) Overview and Technical Tips 2 CONTENTS 3 7 8 9 12 13 17 18 19 20 Introduction Factors Influencing IP General Protocol Modifications Of IP Protocols Troubleshooting Contact Us
More informationSUMOstar Gene Fusion Technology
Gene Fusion Technology NEW METHODS FOR ENHANCING FUNCTIONAL PROTEIN EXPRESSION AND PURIFICATION IN INSECT CELLS White Paper June 2007 LifeSensors Inc. 271 Great Valley Parkway Malvern, PA 19355 www.lifesensors.com
More informationAnti-White Spot Syndrome Virus (WSSV) monoclonal antibody. Product no: P13
Anti-White Spot Syndrome Virus (WSSV) monoclonal antibody Product no: P13 Product Description The monoclonal antibody (Mab) against the Vp28 protein of White Spot Syndrome Virus (WSSV) is specific for
More informationOPPF-UK Standard Protocols: Mammalian Expression
OPPF-UK Standard Protocols: Mammalian Expression Joanne Nettleship joanne@strubi.ox.ac.uk Table of Contents 1. Materials... 3 2. Cell Maintenance... 4 3. 24-Well Transient Expression Screen... 5 4. DNA
More informationSensitivity vs Specificity
Viral Detection Animal Inoculation Culturing the Virus Definitive Length of time Serology Detecting antibodies to the infectious agent Detecting Viral Proteins Western Blot ELISA Detecting the Viral Genome
More informationFor Investigational Use Only. Hypoxyprobe-1 MAb1. [Anti-pimonidazole mouse monoclonal IgG1 antibody clone ; primary antibody in HP-1 Kit]
Hypoxyprobe-1 MAb1 [Anti-pimonidazole mouse monoclonal IgG1 antibody clone 4.3.11.3; primary antibody in HP-1 Kit] Material Safety Data Sheet December 2015 1 Material Safety Data Sheet Date: 12_15_2015
More informationRat IGF-1 ELISA Kit (rigf-1-elisa)
Rat IGF-1 ELISA Kit (rigf-1-elisa) Cat. No. EK0377 96 Tests in 8 x 12 divisible strips Background Insulin-like growth factor 1 (IGF-1), also known as somatomedin C, is a polypeptide protein hormone similar
More informationARBRE-P4EU Consensus Protein Quality Guidelines for Biophysical and Biochemical Studies Minimal information to provide
ARBRE-P4EU Consensus Protein Quality Guidelines for Biophysical and Biochemical Studies Minimal information to provide Protein name and full primary structure, by providing a NCBI (or UniProt) accession
More informationPresto Stool DNA Extraction Kit
Instruction Manual Ver. 10.21.17 For Research Use Only Presto Stool DNA Extraction Kit Advantages STLD004 (4 Preparation Sample Kit) STLD050 (50 Preparation Kit) STLD100 (100 Preparation Kit) Sample: 180-200
More informationTechnical Note Detection of post-immunoprecipitation proteins by Western blot using the Quick Western Kit IRDye 680RD
Technical Note Detection of post-immunoprecipitation proteins by Western blot using the Quick Western Kit IRDye 680RD Developed for: Aerius, Odyssey Classic, Odyssey CLx and Odyssey Sa Imaging Systems
More informationLSBio TM Mouse/Human/Rat Phospho-SMAD3 Cell-Based Phosphorylation ELISA Kit. Catalog No. LS-F1058. User Manual
LSBio TM Mouse/Human/Rat Phospho-SMAD3 Cell-Based Phosphorylation ELISA Kit Catalog No. LS-F1058 User Manual Please Read the Manual Carefully Before Starting your Experiment For research use only. Not
More informationAnti-Asian Sea bass (Lates calcarifer) IgM monoclonal antibody labelled with horseradish peroxidase. Product no: C2-HRP
Anti-Asian Sea bass (Lates calcarifer) IgM monoclonal antibody labelled with horseradish peroxidase Product no: C2-HRP Product Description This monoclonal antibody (Mab) reacts with Asian Sea bass (Lates
More informationAffinity Chromatography. Teaching Kit Manual. GeNei TM. Cat No. New Cat No. KT Revision No.:
Affinity Chromatography Teaching Kit Manual Cat No. New Cat No. KT41 106192 Revision No.: 00010905 CONTENTS Page No. Objective 3 Principle 3 Kit Description 4 Materials Provided 6 Procedure 7 Result 12
More informationPurification of (recombinant) proteins. Pekka Lappalainen, Institute of Biotechnology, University of Helsinki
Purification of (recombinant) proteins Pekka Lappalainen, Institute of Biotechnology, University of Helsinki Physical properties of proteins that can be applied for purification -size -charge (isoelectric
More informationRayBio Human, Mouse and Rat Phospho-STAT3 (Tyr705) and Total STAT3 ELISA Kit
RayBio Human, Mouse and Rat Phospho-STAT3 (Tyr705) and Total STAT3 ELISA Kit Catalog #: PEL-Stat3-Y705-T User Manual Last revised October 10, 2017 Caution: Extraordinarily useful information enclosed ISO
More informationLSBio TM Mouse/Human/Rat CAMK2B / CaMKII Beta Cell-Based ELISA Kit. Catalog No. LS-F1847. User Manual
LSBio TM Mouse/Human/Rat CAMK2B / CaMKII Beta Cell-Based ELISA Kit Catalog No. LS-F1847 User Manual Please Read the Manual Carefully Before Starting your Experiment For research use only. Not approved
More informationFor Research Use Only Ver
INSTRUCTION MANUAL Quick-RNA Whole Blood Catalog Nos. R1201 Highlights Purify high-quality total RNA (including small/micro RNAs) from whole and partitioned blood samples. Compatible with commonly used
More informationfoodproof Sample Preparation Kit III
For food testing purposes FOR IN VITRO USE ONLY Version 1, June 2015 For isolation of DNA from raw material and food products of plant and animal origin for PCR analysis Order No. S 400 06.1 Kit for 50
More informationSensoLyte Anti-alpha-Synuclein Quantitative ELISA Kit (Human/Mouse/Rat) *Colorimetric*
Catalog # Kit Size SensoLyte Anti-alpha-Synuclein Quantitative ELISA Kit (Human/Mouse/Rat) *Colorimetric* AS-55550 One 96-well strip plate This kit is optimized to detect human/mouse/rat alpha-synuclein
More informationHuman IgG Antigen ELISA Kit
Human IgG Antigen ELISA Kit Catalog No: IHUIGGKT Lot No: SAMPLE INTENDED USE This human immunoglobulin G antigen assay is intended for the quantitative determination of total human IgG antigen in serum,
More informationNOTES. Scrapie Pathogenesis in Subclinically Infected B-Cell-Deficient Mice AND ADRIANO AGUZZI 1 * Received 26 April 1999/Accepted 26 July 1999
JOURNAL OF VIROLOGY, Nov. 1999, p. 9584 9588 Vol. 73, No. 11 0022-538X/99/$04.00 0 Copyright 1999, American Society for Microbiology. All Rights Reserved. NOTES Scrapie Pathogenesis in Subclinically Infected
More informationIdentifying Pharmacological Chaperones for the Cellular Prion Protein using a Label-free Biochemical Assay on the EnSight Multimode Plate Reader
APPLICATION NOTE Multimode Detection Authors: Saioa R. Elezgarai 1,3 Emiliano Biasini 2,3 Valentina Bonetto 1 1 Department of Molecular Biochemistry and Pharmacology 2 Department of Neuroscience IRCCS
More informationOrexin A (HUMAN, MOUSE, RAT, PORCINE, OVINE,
Orexin A (HUMAN, MOUSE, RAT, PORCINE, OVINE, BOVINE) Western Blot Kit Protocol (Catalog #WBK-003-30) PHOENIX PHARMACEUTICALS, INC. TABLE OF CONTENTS 1. Kit Contents...2 2. Storage...2 3. Introduction...3
More informationHBeAg and HBeAg Ab ELISA Kit
HBeAg and HBeAg Ab ELISA Kit Catalog Number KA0290 96 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 Principle of the Assay... 3 General
More informationab Cy3 Fast Conjugation Kit
ab188287 Cy3 Fast Conjugation Kit Instructions for Use For the Covalent Conjugation of Antibodies or Proteins to Cy3 This product is for research use only and is not intended for diagnostic use. Version
More informationAnti-Glycolipid Antibodies
Anti-Glycolipid Antibodies TCI antibody reagents support glycobiology research Purif ied Antibody A2505 Anti-GM 1 A2576 Anti-GM 2 A2582 Anti-GM 3 A2507 Anti-GD 1a A2508 Anti-GD 1b Isotype : Mouse IgG3
More informationPROTOCOL 1850 Millrace Drive, Suite 3A Eugene, Oregon
PROTOCOL Complex I Enzyme Activity Dipstick Assay Kit 1850 Millrace Drive, Suite 3A Eugene, Oregon 97403 MS130 Rev.3 DESCRIPTION Complex I Enzyme Activity Dipstick Assay Kit Sufficient materials are provided
More informationProduct Datasheet. Acetylcholinesterase/ACHE Antibody (HR2) NB Unit Size: 200uL. Store at -20C. Avoid freeze-thaw cycles.
Product Datasheet Acetylcholinesterase/ACHE Antibody (HR2) NB300-528 Unit Size: 200uL Store at -20C. Avoid freeze-thaw cycles. Publications: 1 Protocols, Publications, Related Products, Reviews, Research
More informationMutations and Disease
Mutations and Disease Objectives and lecture plan Describe what are mutations Explain how do we identify mutations Explain how and why mutant proteins lead to disease Describe what kinds of DNA mutations
More informationBovine Serum Albumin (BSA) Assay
Bovine Serum Albumin (BSA) Assay Immunoenzymetric Assay for the Measurement of BSA Catalog # F030 Intended Use This kit is intended for use in quantitating bovine serum albumin (BSA). The kit is for Research
More informationGuide. recombinant DNA proteins. for the elaboration of monographs on synthetic peptides and. European Pharmacopoeia
Guide for the elaboration of monographs on synthetic peptides and recombinant DNA proteins European Pharmacopoeia European Directorate for the Quality of Medicines & HealthCare Edition Council of Europe,
More informationDNA isolation from tissue DNA isolation from eukaryotic cells (max. 5 x 106 cells) DNA isolation from paraffin embedded tissue
INDEX KIT COMPONENTS 3 STORAGE AND STABILITY 3 BINDING CAPACITY 3 INTRODUCTION 3 IMPORTANT NOTES 4 EUROGOLD TISSUE DNA MINI KIT PROTOCOLS 5 A. DNA isolation from tissue 5 B. DNA isolation from eukaryotic
More informationSERVA Ni-NTA Magnetic Beads
INSTRUCTION MANUAL SERVA Ni-NTA Magnetic Beads Magnetic beads for Affinity Purification of His-Tag Fusion Proteins (Cat. No. 42179) SERVA Electrophoresis GmbH - Carl-Benz-Str. 7-69115 Heidelberg Phone
More informationApplication Note USD Purification of Mouse IgM from Cell Culture Supernatant by Cation Exchange Chromatography on CM Ceramic HyperD F Sorbent
Application Note USD 241 Purification of Mouse IgM from Cell Culture Supernatant by Cation Exchange Chromatography on CM Ceramic HyperD F Sorbent What this Study Demonstrates T h i s s t u d y o n C a
More information