Protein-Protein Interactions I
|
|
- Kristopher Thomas
- 6 years ago
- Views:
Transcription
1 Biochemistry 412 Protein-Protein Interactions I March 11, 2008
2 Macromolecular Recognition by Proteins Protein folding is a process governed by intramolecular recognition. Protein-protein association is an intermolecular process. Note: the biophysical principles are the same!
3 Special Features of Protein-Protein Interfaces Critical for macromolecular recognition Typically, ca Å 2 of surface buried upon complex formation by two globular proteins Epitopes on protein surface thus may have a hybrid character, compatible with both a solvent-exposed ( free ) state and a buried, solvent-inaccessible ( bound ) state Energetics of binding primarily determined by a few critical residues Flexibility of surface loops may be quite important for promoting adaptive binding and for allowing high specificity interactions without overly-tight binding (via free state entropy effects) Most contacts between two proteins at the interface involve amino acid side chains, although there are some backbone interactions
4 Formalisms for Characterizing Binding Affinities For a protein (P), ligand (A), and complex (P A) P + A k a k d P A where [P] total = [P] + [P A] The association constant: K a = [P A]/[P][A] = k a /k d The dissociation constant: K d = 1/K a = [P][A]/[P A] please note that K d has units of concentration, and so when K d = [A] then [P] = [P A], and thus K d is equal to the concentration of the ligand A at the point of half-maximal binding.
5 At a given ligand concentration [A] the free energy of binding, in terms of the difference in free energies between the free and the bound states, can be described as ΔG binding = -RT ln ([A]/K d ) It is also often useful to describe the difference in binding affinity between a wild type protein and a mutant of the same protein, which is an intrinsic property independent of the ligand concentration. In that case we can express this as ΔΔG wt-mut = -RT ln (K d mut /K d wt )
6 Mapping Protein-Protein Interactions Using Alanine-Scanning Mutagenesis
7 If amino acids had personalities, alanine would not be the life of the party! - George Rose Johns Hopkins Univ.
8 Auguste Rodin The Kiss 1886 (100 Kb); Bronze, 87 x 51 x 55 cm; Musee Rodin, Paris
9
10
11
12
13
14
15 Clackson et al (1998) J. Mol. Biol. 277, 1111.
16 Most mutations that markedly affect the binding affinity (K a ) do so by affecting the off-rate (k d or k off ). In general, mutational effects on the on-rate (k a or k on ) are limited to the following circumstances: Long-range electrostatic effects (steering) Folding mutations masquerading as affinity mutations (i. e., mutations that shift the folding equilibrium to the non-native [and non-binding] state) Inadvertent creation of alternative binding modes that compete with the correct binding mode
17 Cunningham & Wells (1993) J. Mol. Biol. 234, 554.
18 Cunningham & Wells (1993) J. Mol. Biol. 234, 554.
19 Alanine Shaving (a. k. a., Mohawk Mutagenesis ) Clackson et al (1998) J. Mol. Biol. 277, 1111.
20
21
22 Quiz: When we say we are comparing the mutant with wt, what does wt mean?
23 (just kidding!)
24 Seriously though, the reference molecule here is: Turkey Ovomucoid Third Domain (a Serine Protease Inhibitor) All nineteen possible amino acid substitutions were made for each of the residues shown in blue (total = 190). For each inhibitor, binding constants were measured precisely for each of six different serine proteases (>1000 separate measurements!). X-ray structures were performed on a subset of the mutant complexes.
25 3D View of Turkey Ovomucoid Third Domain in Complex with a Cognate Protease Li et al (2005) Proteins: Struct. Funct. Bioinformat. 58, 661.
26 Partial view of the structure of the complex of TKY-OM3D P1 Pro with Streptomyces griseus Protease B Bateman et al (2001) J. Mol. Biol. 305, 839.
27 The Principle of Additivity Consider the double mutant, AB, composed of mutation A and mutation B. In general (but not always -- see below), the binding free energy perturbations caused by single mutations are additive, in other words ΔΔG wt-mutab = ΔΔG wt-muta + ΔΔG wt-mutb + ΔΔG i where ΔΔG i 0. ΔΔG i has been termed the interaction energy (see (Wells [1990] Biochemistry 29, 8509). If ΔΔG i 0, then mutations A and B are said to be nonadditive and it can therefore be inferred that the two residues at which these mutations occur must physically interact, directly or indirectly, in the native structure. Note: this has important implications regarding how evolution shapes proteins.
28 Example of a perfectly* additive pair of mutations in avian ovomucoids *Note: within experimental error Qasim et al (2003) Biochemistry 42, 6460.
29 Predicted vs. observed binding free energies for all possible members of the Kazal (ovomucoid) inhibitor family Laskowski et al (2003) Curr. Opin. Struct. Biol. 13, 130.
30 Residue clustering at a protein-protein interface Reichmann et al (2005) Proc. Natl. Acad. Sci. USA 102, 57.
31 Protein-protein interface clusters and the free energy additivity of mutations Mutations within clusters are generally nonadditive (ΔΔG i 0) Mutations between clusters are generally additive (ΔΔG i 0) Reichmann et al (2007) Curr. Opin. Struct. Biol. 17, 67.
32 Theorists are now beginning to mine the OM3D data to refine their docking programs. Bad prediction Good prediction Lorber et al (2002) Protein Sci. 11, 1393.
Biophysical characterization of proteinprotein
Biophysical characterization of proteinprotein interactions Rob Meijers EMBL Hamburg EMBO Global Exchange Lecture Course Hyderabad 2012 Bottom up look at protein-protein interactions Role of hydrogen bonds
More informationHotPoint: hot spot prediction server for protein interfaces
W402 W406 Nucleic Acids Research, 2010, Vol. 38, Web Server issue Published online 5 May 2010 doi:10.1093/nar/gkq323 HotPoint: hot spot prediction server for protein interfaces Nurcan Tuncbag, Ozlem Keskin*
More informationSupplementary Table 1: List of CH3 domain interface residues in the first chain (A) and
Supplementary Tables Supplementary Table 1: List of CH3 domain interface residues in the first chain (A) and their side chain contacting residues in the second chain (B) a Interface Res. in Contacting
More informationProtein-Protein Interaction Analysis by Docking
Algorithms 2009, 2, 429-436; doi:10.3390/a2010429 OPEN ACCESS algorithms ISSN 1999-4893 www.mdpi.com/journal/algorithms Article Protein-Protein Interaction Analysis by Docking Florian Fink *, Stephan Ederer
More informationProtocol S1: Supporting Information
Protocol S1: Supporting Information Basis for the specificity of the kinase domain of Abl for peptide substrates The crystal structures reported in this work were obtained using two different ATP analog-peptide
More informationRajan Sankaranarayanan
Proofreading during translation of the genetic code Rajan Sankaranarayanan Centre for Cellular and Molecular Biology (CCMB) Council for Scientific and Industrial Research (CSIR) Hyderabad, INDIA Accuracy
More informationBinding Studies with Mutants of Zif268
THE JOURNAL OF BIOLOGICAL CHEISTRY Vol. 274, No. 27, Issue of July 2, pp. 19281 19285, 1999 1999 by The American Society for Biochemistry and olecular Biology, Inc. Printed in U.S.A. Binding Studies with
More informationExamination of Protein G stability and Binding Characteristics Using Four Body Nearest Neighbor Contact Potentials
Examination of Protein G stability and Binding Characteristics Using Four Body Nearest Neighbor Contact Potentials Abstract Gregory M. Reck George Mason University A computational geometry technique employing
More informationStructural bioinformatics
Structural bioinformatics Why structures? The representation of the molecules in 3D is more informative New properties of the molecules are revealed, which can not be detected by sequences Eran Eyal Plant
More informationThe mechanism(s) of protein folding. What is meant by mechanism. Experimental approaches
The mechanism(s) of protein folding What is meant by mechanism Computational approaches Experimental approaches Questions: What events occur and in what time sequence when a protein folds Is there a specified
More informationFrom Computational Biophysics to Systems Biology (CBSB11) Celebrating Harold Scheraga s 90 th Birthday
Forschungszentrum Jülich GmbH Institute for Advanced Simulation (IAS) Jülich Supercomputing Centre (JSC) From Computational Biophysics to Systems Biology (CBSB11) Celebrating Harold Scheraga s 90 th Birthday
More informationIntroduction to Proteins
Introduction to Proteins Lecture 4 Module I: Molecular Structure & Metabolism Molecular Cell Biology Core Course (GSND5200) Matthew Neiditch - Room E450U ICPH matthew.neiditch@umdnj.edu What is a protein?
More informationJames E. Mace*, Barry J. Wilk and David A. Agard. Introduction. JMB MS 667 Cust. Ref. No. FC029/95
Cust. Ref. No. FC029/95 [SGML] J. Mol. Biol. (1995) 251, 116 134 Functional Linkage Between the Active Site of -Lytic Protease and Distant Regions of Structure: Scanning Alanine Mutagenesis of a Surface
More informationTransition States: Substrateinduced. Transitions. Introduction. Secondary article. Carol B Post, Purdue University, West Lafayette, Indiana, USA
Transition States: Substrateinduced Conformational Transitions Carol B Post, Purdue University, West Lafayette, Indiana, USA Secondary article Article Contents. Introduction. Conformational Changes of
More informationChapter 4. Antigen Recognition by B-cell and T-cell Receptors
Chapter 4 Antigen Recognition by B-cell and T-cell Receptors Antigen recognition by BCR and TCR B cells 2 separate functions of immunoglobulin (Ig) bind pathogen & induce immune responses recruit cells
More information6-Foot Mini Toober Activity
Big Idea The interaction between the substrate and enzyme is highly specific. Even a slight change in shape of either the substrate or the enzyme may alter the efficient and selective ability of the enzyme
More informationPacking of Secondary Structures
7.88 Lecture Notes - 5 7.24/7.88J/5.48J The Protein Folding and Human Disease Packing of Secondary Structures Packing of Helices against sheets Packing of sheets against sheets Parallel Orthogonal Table:
More informationMinimizing a binding domain from protein A
Proc. Natl. Acad. Sci. USA Vol. 93, pp. 5688 5692, June 1996 Biochemistry Minimizing a binding domain from protein A ANDREW C. BRAISTED AND JAMES A. WELLS* Department of Protein Engineering, Genentech,
More informationGlobins. The Backbone structure of Myoglobin 2. The Heme complex in myoglobin. Lecture 10/01/2009. Role of the Globin.
Globins Lecture 10/01/009 The Backbone structure of Myoglobin Myoglobin: 44 x 44 x 5 Å single subunit 153 amino acid residues 11 residues are in an a helix. Helices are named A, B, C, F. The heme pocket
More informationFluorescence Quenching of Green Fluorescent Protein during Denaturation by Guanidine
Fluorescence Quenching of GFP during Denaturation Bull. Korean Chem. Soc. 2005, Vol. 26, No. 3 413 Fluorescence Quenching of Green Fluorescent Protein during Denaturation by Guanidine Kichul Jung, Jaebok
More informationLearning to Use PyMOL (includes instructions for PS #2)
Learning to Use PyMOL (includes instructions for PS #2) To begin, download the saved PyMOL session file, 4kyz.pse from the Chem 391 Assignments web page: http://people.reed.edu/~glasfeld/chem391/assign.html
More informationA Functional Analysis of the Allosteric Nucleotide Monophosphate Binding Site of Carbamoyl Phosphate Synthetase
Archives of Biochemistry and Biophysics Vol. 400, No. 1, April 1, pp. 34 42, 2002 doi:10.1006/abbi.2002.2767, available online at http://www.idealibrary.com on A Functional Analysis of the Allosteric Nucleotide
More informationMutating aspartate in the calcium-binding site of α-lactalbumin: effects on the protein stability and cation binding
Protein Engineering vol.14 no.10 pp.785 789, 2001 Mutating aspartate in the calcium-binding site of α-lactalbumin: effects on the protein stability and cation binding Sergei E.Permyakov 1, Vladimir N.Uversky
More informationScience June 3, 1988 v240 n4857 p1310(7) Page 1
Science June 3, 1988 v240 n4857 p1310(7) Page 1 by Brian K. Kobilka, Tong Sun Kobilka, Kiefer Daniel, John W. Regan, Marc G. Caron and Robert J. Lefkowitz COPYRIGHT 1988 American Association for the Advancement
More informationAmino Acids. Amino Acid Structure
Amino Acids Pratt & Cornely Chapter 4 Alpha carbon Sidechain Proteins peptides Amino Acid Structure 1 L amino acids Glycine R/S vs D/L L isoleucine racemization Stereochemisty Common Amino Acids 2 Which
More informationFinal exam. Please write your name on the exam and keep an ID card ready.
Biophysics of Macromolecules Prof. R. Jungmann and Prof. J. Lipfert SS 2017 Final exam Final exam First name: Last name: Student number ( Matrikelnummer ): Please write your name on the exam and keep an
More informationIntroduction to Bioinformatics Online Course: IBT
Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec6:Interpreting Your Multiple Sequence Alignment Interpreting Your Multiple Sequence
More informationNature Structural & Molecular Biology: doi: /nsmb.2548
Supplementary Figure 1. Structure of GltPhout. (a) Stereo view of a slice through a single GltPhout protomer shown in stick representation along with 2Fo-Fc and anomalous difference electron maps. The
More informationPolypharmacology. Giulio Rastelli Molecular Modelling and Drug Design Lab
Polypharmacology Giulio Rastelli Molecular Modelling and Drug Design Lab www.mmddlab.unimore.it Dipartimento di Scienze della Vita Università di Modena e Reggio Emilia giulio.rastelli@unimore.it Magic
More informationAb Initio SERVER PROTOTYPE FOR PREDICTION OF PHOSPHORYLATION SITES IN PROTEINS*
COMPUTATIONAL METHODS IN SCIENCE AND TECHNOLOGY 9(1-2) 93-100 (2003/2004) Ab Initio SERVER PROTOTYPE FOR PREDICTION OF PHOSPHORYLATION SITES IN PROTEINS* DARIUSZ PLEWCZYNSKI AND LESZEK RYCHLEWSKI BiolnfoBank
More informationHomology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen
Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,
More informationRNA does not adopt the classic B-DNA helix conformation when it forms a self-complementary double helix
Reason: RNA has ribose sugar ring, with a hydroxyl group (OH) If RNA in B-from conformation there would be unfavorable steric contact between the hydroxyl group, base, and phosphate backbone. RNA structure
More information2013 W. H. Freeman and Company. 5 Function of Globular Proteins
2013 W. H. Freeman and Company 5 Function of Globular Proteins CHAPTER 5: Function of Globular Proteins Key topics in protein function: Reversible binding of ligands is essential Specificity of ligands
More informationReviewers' comments: Reviewer #1 (Remarks to the Author):
Reviewers' comments: Reviewer #1 (Remarks to the Author): Modulating immune checkpoint pathways like CTLA-4 and PD-1 for cancer immunotherapy has gained much attention in recent years due to their immense
More informationArtificial Nucleic Acids -Their Developments and Recent Applications
Artificial Nucleic Acids -Their Developments and Recent Applications Bioorganic Chemistry Laboratory D2 Kenichiro Ito Organic Seminar 2012/5/7 1 Nucleic acids play central roles in life Replication Transcription
More informationHomology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen
Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,
More informationThe microtubule-associated tau protein has intrinsic acetyltransferase activity. Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and
SUPPLEMENTARY INFORMATION: The microtubule-associated tau protein has intrinsic acetyltransferase activity Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and Virginia M.Y. Lee Cohen
More informationB-cell Epitope Prediction and Cloning monoclonal ADAs
B-cell Epitope Prediction and Cloning monoclonal ADAs Stefan Ryser, CEO, Trellis Bioscience 3 rd International Symposium on Higher Order Structure of Protein Therapeutics Arlington, Virginia, February
More informationChapter 4 Fluorescence Resonance Energy Transfer (FRET) by Minor Groove-Associated Cyanine-Polyamide Conjugates
Chapter 4 Fluorescence Resonance Energy Transfer (FRET) by Minor Groove-Associated Cyanine-Polyamide Conjugates The work described in this chapter was accomplished in collaboration with V. Rucker (Dervan
More informationEnsemble refinement shows conformational flexibility in crystal structures of human complement factor D
Supplementary Information for Ensemble refinement shows conformational flexibility in crystal structures of human complement factor D Federico Forneris a,b, B. Tom Burnley a,b,c and Piet Gros a * a Crystal
More informationStructure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München
Structure formation and association of biomolecules Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Motivation Many biomolecules are chemically synthesized
More informationSolution Structure of the DNA-binding Domain of GAL4 from Saccharomyces cerevisiae
Vol. 14, No. 1-4 175 Solution Structure of the DNA-binding Domain of GAL4 from Saccharomyces cerevisiae James D. Baleja, V. Thanabal, Ted Mau, and Gerhard Wagner Department of Biological Chemistry and
More information[4] SCHEMA-Guided Protein Recombination
[4] SCHEMA-guided protein recombination 35 [4] SCHEMA-Guided Protein Recombination By Jonathan J. Silberg, Jeffrey B. Endelman, and Frances H. Arnold Introduction SCHEMA is a scoring function that predicts
More informationGenetic Algorithms For Protein Threading
From: ISMB-98 Proceedings. Copyright 1998, AAAI (www.aaai.org). All rights reserved. Genetic Algorithms For Protein Threading Jacqueline Yadgari #, Amihood Amir #, Ron Unger* # Department of Mathematics
More informationDiversity in DNA recognition by p53 revealed by crystal structures with Hoogsteen base pairs
SUPPLEMENTARY INFORMATION Diversity in DNA recognition by p53 revealed by crystal structures with Hoogsteen base pairs Malka Kitayner 1, 3, Haim Rozenberg 1, 3, Remo Rohs 2, 3, Oded Suad 1, Dov Rabinovich
More informationMATERIALS AND METHODS
THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 280, NO. 37, pp. 32480 32484, September 16, 2005 2005 by The American Society for Biochemistry and Molecular Biology, Inc. Printed in the U.S.A. Free Energy Contributions
More informationΤάσος Οικονόµου ιαλεξη 8. Kινηση, λειτουργια, ελεγχος.
Τάσος Οικονόµου ιαλεξη 8 Kινηση, λειτουργια, ελεγχος http://ecoserver.imbb.forth.gr/bio321.htm εν ξεχνω. Cell The peptide bond Polypeptides are stabilized by: 1. Covalent bonds= amide bond 2. Noncovalent,
More informationBIOCHEMISTRY 551: BIOCHEMICAL METHODS SYLLABUS
BIOCHEMISTRY 551: BIOCHEMICAL METHODS SYLLABUS Course Description: Biochemistry 551 is an integrated lecture, lab and seminar course that covers biochemistry-centered theory and techniques. The course
More information2/23/16. Protein-Protein Interactions. Protein Interactions. Protein-Protein Interactions: The Interactome
Protein-Protein Interactions Protein Interactions A Protein may interact with: Other proteins Nucleic Acids Small molecules Protein-Protein Interactions: The Interactome Experimental methods: Mass Spec,
More informationRobustness of protein folding kinetics to surface hydrophobic substitutions
Protein Science ~1999!, 8:2734 2741. Cambridge University Press. Printed in the USA. Copyright 1999 The Protein Society Robustness of protein folding kinetics to surface hydrophobic substitutions H. GU,
More informationinactive derivatives: Implications for active sites shared between polypeptide chains of aspartate transcarbamoylase
Proc. Nati. Acad. Sci. USA Vol. 82, pp. 361-365, January 1985 Biochemistry Regeneration of active enzyme by formation of hybrids from inactive derivatives: Implications for active sites shared between
More informationsimplified deployment of structurebased models in GROMACS
Published online 4 June 2010 Nucleic Acids Research, 2010, Vol. 38, Web Server issue W657 W661 doi:10.1093/nar/gkq498 SMOG@ctbp: simplified deployment of structurebased models in GROMACS Jeffrey K. Noel
More informationSimulation Study of the Reliability and Robustness of the Statistical Methods for Detecting Positive Selection at Single Amino Acid Sites
Simulation Study of the Reliability and Robustness of the Statistical Methods for Detecting Selection at Single Amino Acid Sites Yoshiyuki Suzuki and Masatoshi Nei Institute of Molecular Evolutionary Genetics,
More informationDistributions of Beta Sheets in Proteins with Application to Structure Prediction
Distributions of Beta Sheets in Proteins with Application to Structure Prediction Ingo Ruczinski Department of Biostatistics Johns Hopkins University Email: ingo@jhu.edu http://biostat.jhsph.edu/ iruczins
More informationdoi: /j.jmb J. Mol. Biol. (2006) 357,
doi:10.1016/j.jmb.2006.01.001 J. Mol. Biol. (2006) 357, 1669 1682 Efficient Restraints for Protein Protein Docking by Comparison of Observed Amino Acid Substitution Patterns with those Predicted from Local
More informationSerine Proteases and their Inhibitors
ugo Kubinyi, www.kubinyi.de Serine Proteases and their Inhibitors ugo Kubinyi Germany E-Mail kubinyi@t-online.de omepage www.kubinyi.de ugo Kubinyi, www.kubinyi.de Serine Proteases of Physiological Importance
More informationProtein 3D Structure Prediction
Protein 3D Structure Prediction Michael Tress CNIO ?? MREYKLVVLGSGGVGKSALTVQFVQGIFVDE YDPTIEDSYRKQVEVDCQQCMLEILDTAGTE QFTAMRDLYMKNGQGFALVYSITAQSTFNDL QDLREQILRVKDTEDVPMILVGNKCDLEDER VVGKEQGQNLARQWCNCAFLESSAKSKINVN
More informationIntroduction to Bioinformatics
Introduction to Bioinformatics http://1.51.212.243/bioinfo.html Dr. rer. nat. Jing Gong Cancer Research Center School of Medicine, Shandong University 2011.10.19 1 Chapter 4 Structure 2 Protein Structure
More informationAntibody Structure. Antibodies
Antibodies Secreted by B lymphocytes Great diversity and specificity: >10 9 different antibodies; can distinguish between very similar molecules Tag particles for clearance/destruction Protect against
More informationAntibody Structure supports Function
Antibodies Secreted by B lymphocytes Great diversity and specificity: >10 9 different antibodies; can distinguish between very similar molecules Tag particles for clearance/destruction Protect against
More informationBIRKBECK COLLEGE (University of London)
BIRKBECK COLLEGE (University of London) SCHOOL OF BIOLOGICAL SCIENCES M.Sc. EXAMINATION FOR INTERNAL STUDENTS ON: Postgraduate Certificate in Principles of Protein Structure MSc Structural Molecular Biology
More informationWhat does a protein need to work?
Department of Physics, MIT What does a protein need to work? Leonid Mirny leonid@mit.edu What does a protein need to work? 1. Stable structure 2. Specific active/binding sites. What does a protein need
More informationMechanism of Folding and Binding of an Intrinsically Disordered Protein As Revealed by ab Initio Simulations
pubs.acs.org/jctc Mechanism of Folding and Binding of an Intrinsically Disordered Protein As Revealed by ab Initio Simulations Mateusz Kurcinski, Andrzej Kolinski, and Sebastian Kmiecik* Faculty of Chemistry,
More informationRelationship between nucleotide sequence and 3D protein structure of six genes in Escherichia coli, by analysis of DNA sequence using a Markov model
Relationship between nucleotide sequence and 3D protein structure of six genes in Escherichia coli, by analysis of DNA sequence using a Markov model Yuko Ohfuku 1,, 3*, Hideo Tanaka and Masami Uebayasi
More informationCSE : Computational Issues in Molecular Biology. Lecture 19. Spring 2004
CSE 397-497: Computational Issues in Molecular Biology Lecture 19 Spring 2004-1- Protein structure Primary structure of protein is determined by number and order of amino acids within polypeptide chain.
More informationApplication of Biacore Technology
Principles and typical results Application of Biacore Technology Common types of Biacore analyses Specificity analysis Is my molecule of interest specific for its target? Multiple binding analysis In which
More informationproduces an RNA copy of the coding region of a gene
1. Transcription Gene Expression The expression of a gene into a protein occurs by: 1) Transcription of a gene into RNA produces an RNA copy of the coding region of a gene the RNA transcript may be the
More informationName: SID: ( ) MIDTERM EXAMINATION (October 7, 2014) BIOE150. Introduction to Bio-Nanoscience & Bio-Nanotechnology Fall Semester, 2014
MIDTERM EXAMINATION (October 7, 2014) BIOE150. Introduction to Bio-Nanoscience & Bio-Nanotechnology Fall Semester, 2014 0. Write down your name and the last 4 digits of your SID on all the pages (1) 1.
More informationSuperScript IV Reverse Transcriptase as a better alternative to AMV-based enzymes
WHITE PAPER SuperScript IV Reverse Transcriptase SuperScript IV Reverse Transcriptase as a better alternative to AMV-based enzymes Abstract Reverse transcriptases (RTs) from avian myeloblastosis virus
More informationBuilding an Antibody Homology Model
Application Guide Antibody Modeling: A quick reference guide to building Antibody homology models, and graphical identification and refinement of CDR loops in Discovery Studio. Francisco G. Hernandez-Guzman,
More informationLectures 9 and 10: Random Walks and the Structure of Macromolecules (contd.)
Lectures 9 and 10: Random Walks and the Structure of Macromolecules (contd.) Lecturer: Brigita Urbanc Office: 12 909 (E mail: brigita@drexel.edu) Course website: www.physics.drexel.edu/~brigita/courses/biophys_2011
More informationExploring Similarities of Conserved Domains/Motifs
Exploring Similarities of Conserved Domains/Motifs Sotiria Palioura Abstract Traditionally, proteins are represented as amino acid sequences. There are, though, other (potentially more exciting) representations;
More informationProteins Higher Order Structures
Proteins Higher Order Structures Dr. Mohammad Alsenaidy Department of Pharmaceutics College of Pharmacy King Saud University Office: AA 101 msenaidy@ksu.edu.sa Previously on PHT 426!! Protein Structures
More informationThere have been many experimental and theoretical studies of
Conformational entropy of alanine versus glycine in protein denatured states Kathryn A. Scott*, Darwin O. V. Alonso*, Satoshi Sato, Alan R. Fersht, and Valerie Daggett* *Department of Medicinal Chemistry,
More information3D Structure Prediction with Fold Recognition/Threading. Michael Tress CNB-CSIC, Madrid
3D Structure Prediction with Fold Recognition/Threading Michael Tress CNB-CSIC, Madrid MREYKLVVLGSGGVGKSALTVQFVQGIFVDEYDPTIEDSY RKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFAL VYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDL
More informationLigand-Binding Residues Integrate Affinity and Efficacy in the NMDA Receptor
0026-895X/04/6602-209 219$20.00 MOLECULAR PHARMACOLOGY Vol. 66, No. 2 Copyright 2004 The American Society for Pharmacology and Experimental Therapeutics 3041/1163135 Mol Pharmacol 66:209 219, 2004 Printed
More informationDiscovery and Humanization of Novel High Affinity Neutralizing Monoclonal Antibodies to Human IL-17A
Discovery and Humanization of Novel High Affinity Neutralizing Monoclonal Antibodies to Human IL-17A Contacts: Marty Simonetti martysimonetti@gmail.com Kirby Alton kirby.alton@abeomecorp.com Rick Shimkets
More informationENZYMES. Unit 3 - Energy
ENZYMES Unit 3 - Energy What is an enzyme? What do they do? What is an enzyme? What do they do? Key Things to remember: They are proteins They are catalysts They are reusable - not consumed in reaction
More informationIdentification of the -Lactamase Inhibitor Protein-II (BLIP-II) Interface Residues Essential for Binding Affinity and Specificity for Class A
THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 288, NO. 24, pp. 17156 17166, June 14, 2013 2013 by The American Society for Biochemistry and Molecular Biology, Inc. Published in the U.S.A. Identification of
More informationSupporting Information
Supporting Information Wiley-VCH 2006 69451 Weinheim, Germany RNA ligands that distinguish metabolite-induced conformations in the TPP riboswitch Günter Mayer, Marie-Sophie L. Raddatz, Julia D. Grunwald,
More informationWatson BM Gene Capitolo 11 Watson et al., BIOLOGIA MOLECOLARE DEL GENE, Zanichelli editore S.p.A. ? Le proteine della trasposizione Watson et al., BIOLOGIA MOLECOLARE DEL GENE, Zanichelli editore S.p.A.
More informationStructural biology and its role in variant classification
Structural biology and its role in variant classification Created for educational purposes by Iain Kerr, Ph.D. Medical Services, Myriad Genetic Laboratories, Inc. Data presented as of June 2016 Myriad
More informationDENATURATION OF HEMOGLOBIN IN THE PRESENCE OF TANNIC ACID
PROCEEDINGS OF THE YEREVAN STATE UNIVERSITY C h e m i s t r y a n d B i o l o g y 2014, 1, p. 23 27 C h emistr y DENATURATION OF HEMOGLOBIN IN THE PRESENCE OF TANNIC ACID K. R. GRIGORYAN, L. S. SARGSYAN
More information1. DNA replication. (a) Why is DNA replication an essential process?
ame Section 7.014 Problem Set 3 Please print out this problem set and record your answers on the printed copy. Answers to this problem set are to be turned in to the box outside 68120 by 5:00pm on Friday
More informationCreation of a PAM matrix
Rationale for substitution matrices Substitution matrices are a way of keeping track of the structural, physical and chemical properties of the amino acids in proteins, in such a fashion that less detrimental
More informationS P E E D I N G U P C H E M I C A L R E AC T I O N S
ENZYMES S P E E D I N G U P C H E M I C A L R E AC T I O N S TEKS 9C: Students will identify and investigate the role of enzymes WHAT ARE ENZYMES? Enzymes are proteins (what is their monomer?) These proteins
More informationTeaching Principles of Enzyme Structure, Evolution, and Catalysis Using Bioinformatics
KBM Journal of Science Education (2010) 1 (1): 7-12 doi: 10.5147/kbmjse/2010/0013 Teaching Principles of Enzyme Structure, Evolution, and Catalysis Using Bioinformatics Pablo Sobrado Department of Biochemistry,
More informationMATERIAL DATA SHEET. Reagents Provided in Kit
Lot # XXXXX MATERIAL DATA SHEET HSP70/HSP40 Glow-Fold Protein Refolding Kit Cat. # K-290 Heat shock proteins (HSPs) are a family of highly conserved stress response proteins. Heat shock proteins function
More informationHuman SNP haplotypes. Statistics 246, Spring 2002 Week 15, Lecture 1
Human SNP haplotypes Statistics 246, Spring 2002 Week 15, Lecture 1 Human single nucleotide polymorphisms The majority of human sequence variation is due to substitutions that have occurred once in the
More information7.06 Cell Biology EXAM #2 March 20, 2003
7.06 Cell Biology EXAM #2 March 20, 2003 This is an open book exam, and you are allowed access to books, a calculator, and notes but not computers or any other types of electronic devices. Please write
More informationChromatin Structure. a basic discussion of protein-nucleic acid binding
Chromatin Structure 1 Chromatin DNA packaging g First a basic discussion of protein-nucleic acid binding Questions to answer: How do proteins bind DNA / RNA? How do proteins recognize a specific nucleic
More informationChapter 8 DNA Recognition in Prokaryotes by Helix-Turn-Helix Motifs
Chapter 8 DNA Recognition in Prokaryotes by Helix-Turn-Helix Motifs 1. Helix-turn-helix proteins 2. Zinc finger proteins 3. Leucine zipper proteins 4. Beta-scaffold factors 5. Others λ-repressor AND CRO
More informationThe GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity
Promega Notes Magazine Number 62, 1997, p. 02 The GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity By Christine Andrews and Scott Lesley Promega
More informationProtein Structure and Function: From Sequence to Consequence 1. From Sequence to Structure
Protein Structure and Function: From Sequence to Consequence Gregory A. Petsko and Dagmar Ringe, Brandeis University Published by New Science Press Ltd and distributed in the United States and Canada by
More informationstatic MM_Index snap(mm_index corect, MM_Index ligct, int imatch0, int *moleatoms, i
BIOLUMINATE static MM_Index snap(mm_index corect, MM_Index ligct, int imatch0, int *moleatoms, int *refcoreatoms){int ncoreat = :vector mappings; PhpCoreMapping mapping; for COMMON(glidelig).
More informationnanodsf 2bind: Your service provider for biophysical characterization of proteins Precisely revealing protein folding and stability
nanodsf Precisely revealing protein folding and stability 2bind: Your service provider for biophysical characterization of proteins This booklet was written and designed by 2bind 08 2015 Any reproduction
More informationStructural Basis for Phosphorylationdependent. Damage Response J. N. Mark Glover Department of Biochemistry, University of Alberta, Edmonton
Structural Basis for Phosphorylationdependent Signaling in the DNA Damage Response J. N. Mark Glover Department of Biochemistry, University of Alberta, Edmonton Abstract The response of eukaryotic cells
More informationSupplementary Fig. S1. SAMHD1c has a more potent dntpase activity than. SAMHD1c. Purified recombinant SAMHD1c and SAMHD1c proteins (with
Supplementary Fig. S1. SAMHD1c has a more potent dntpase activity than SAMHD1c. Purified recombinant SAMHD1c and SAMHD1c proteins (with concentration of 800nM) were incubated with 1mM dgtp for the indicated
More informationprotein interaction analysis tech note 5367
protein interaction analysis tech note 5367 Rapid Optimization of Immobilization and Binding Conditions for Kinetic Analysis of Protein-Protein Interactions Using the ProteOn XPR36 Protein Interaction
More informationMacromolecular Modeling with Rosetta
ANNUAL REVIEWS Further Click here for quick links to Annual Reviews content online, including: Other articles in this volume Top cited articles Top downloaded articles Our comprehensive search Annu. Rev.
More information