Product Datasheet. Transthyretin/Prealbumin Antibody NBP Unit Size: 0.1 ml
|
|
- Jacob Miller
- 5 years ago
- Views:
Transcription
1 Product Datasheet Transthyretin/Prealbumin Antibody NBP Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Publications: 3 Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 3/18/2018 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at
2 NBP Transthyretin/Prealbumin Antibody Product Information Unit Size Concentration Storage Clonality Preservative Isotype Purity Buffer Product Description Host 0.1 ml Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Polyclonal 0.02% Sodium Azide IgG Immunogen affinity purified PBS (ph 7.2) and 40% Glycerol Rabbit Gene ID 7276 Gene Symbol Species TTR Human Reactivity Notes Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (83%). Human reactivity reported in scientific literature (PMID: ). Specificity/Sensitivity Immunogen Product Application Details Applications Specificity of human Transthyretin/Prealbumin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. This antibody was developed against Recombinant Protein corresponding to amino acids: GTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGEL HGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAAL LSPYSYSTTAVVTNPKE Western Blot, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin Recommended Dilutions Western Blot 0.4 ug/ml, Immunohistochemistry 1:500-1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry- Paraffin 1:500-1:1000 Application Notes Page 1 of 4 v.20.1 Updated 3/18/2018 For IHC-Paraffin, HIER ph 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
3 Images Western Blot: Transthyretin/Prealbumin Antibody [NBP ] - Analysis in human plasma. Page 2 of 4 v.20.1 Updated 3/18/2018 Immunocytochemistry/Immunofluorescence: Transthyretin/Prealbumin Antibody [NBP ] - Immunofluorescent staining of human cell line CACO-2 shows localization to the Golgi apparatus. Antibody staining is shown in green. [NBP ] - Staining in human pancreas and tonsil tissues. Corresponding TTR RNA-seq data are presented for the same tissues. [NBP ] - Staining of human pancreas shows moderate cytoplasmic positivity in a subset of islets of Langerhans cells.
4 [NBP ] - Staining of human duodenum shows positivity in plasma. Page 3 of 4 v.20.1 Updated 3/18/2018 [NBP ] - Staining of human tonsil shows no positivity as expected. Publications Liu T, Zhang B, Jin X et al. Ophthalmic manifestations in a Chinese family with familial amyloid polyneuropathy due to a TTR Gly83Arg mutation. Eye (Lond) 2014 Jan [PMID: ] (IHC, Human) Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011 Nov [PMID: ] Noborn F, O'Callaghan P, Hermansson E et al. Heparan sulfate/heparin promotes transthyretin fibrillization through selective binding to a basic motif in the protein. Proc Natl Acad Sci U S A 2011 Apr [PMID: ]
5 Novus Biologicals USA 8100 Southpark Way, A-8 Littleton, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Products Related to NBP NBP PEP HAF008 NB7156 NBP Transthyretin/Prealbumin Recombinant Protein Antigen Goat anti-rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Goat anti-rabbit IgG (H+L) Secondary Antibody Rabbit IgG Isotype Control Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product: