Product Datasheet. Occludin Antibody NBP Unit Size: 0.1 ml

Transcription

1 Product Datasheet Occludin Antibody NBP Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Reviews: 2 Publications: 2 Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 7/15/2018 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at

2 NBP Occludin Antibody Product Information Unit Size Concentration Storage Clonality Preservative Isotype Purity Buffer 0.1 ml Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Polyclonal 0.02% Sodium Azide IgG Immunogen affinity purified PBS (ph 7.2) and 40% Glycerol Page 1 of 4 v.20.1 Updated 7/15/2018 Product Description Host Rabbit Gene ID Gene Symbol Species OCLN Human, Mouse Reactivity Notes Expected species cross reactivity based on sequence homology: Rat (83%) Marker Specificity/Sensitivity Immunogen Product Application Details Applications Tight Junctions Marker Specificity of human, mouse Occludin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. This antibody was developed against Recombinant Protein corresponding to amino acids: DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVND KRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGR AGRSKRTEQDHYETDYTTGGESCDELEED Western Blot, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated Recommended Dilutions Western Blot 0.4 ug/ml, Immunohistochemistry 1:200-1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry- Paraffin 1:200-1:500, Knockdown Validated Application Notes For IHC-Paraffin, HIER ph 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

3 Images Western Blot: Occludin Antibody [NBP ] - Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control sirna. Primary antibody was diluted 1:1000. This image was submitted via customer Review. Page 2 of 4 v.20.1 Updated 7/15/2018 Immunocytochemistry/Immunofluorescence: Occludin Antibody [NBP ] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cell junctions. Antibody staining shown in green. Staining of human thyroid gland shows high expression. Western Blot: Occludin Antibody [NBP ] - Lane 1: Marker [kda] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

4 Immunocytochemistry/Immunofluorescence: Occludin Antibody [NBP ] - Methanol fixed, mouse choroid plexus cells were stained with Occludin antibody. Image from verified customer review. Page 3 of 4 v.20.1 Updated 7/15/2018 Staining of human skeletal muscle shows low expression as expected. Staining in human thyroid gland and skeletal muscle tissues using anti- OCLN antibody. Corresponding OCLN RNA-seq data are presented for the same tissues. Publications Mikula-Pietrasik J, Uruski P, Szubert S et al. Malignant ascites determine the transmesothelial invasion of ovarian cancer cells Int. J. Biochem. Cell Biol Sep 06 [PMID: ] (IHC-P, Human) Liu W, Schrott-Fischer A, Glueckert R et al. The Human Cochlear Battery - Claudin-11 Barrier and Ion Transport Proteins in the Lateral Wall of the Cochlea Front Mol Neurosci 2017 Aug 29 [PMID: ] (ICC/IF, Human)

5 Novus Biologicals USA 8100 Southpark Way, A-8 Littleton, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Products Related to NBP NBP PEP HAF008 NB7156 NBP Occludin Recombinant Protein Antigen Goat anti-rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Goat anti-rabbit IgG (H+L) Secondary Antibody Rabbit IgG Isotype Control Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product: