Sequence Based Function Annotation Qi Sun Bioinformatics Facility Biotechnology Resource Center Cornell University
Sequence Based Function Annotation 1. Given a sequence, how to predict its biological function? 2. How to describe the function of a gene? 3. How to works with 50,000 genes?
Usage scenarios for sequence based function annotation Genomic scale function annotation for non-model organisms RNA-seq data Genomic sequencing Assembly (Trinity) Assembly (SOAP de novo) ORF prediction (Trinity) Gene prediction (Maker) Function prediction
Alternative Usage Scenario You are interested in this gene: Ig Ig Ig TM Kinase You want to know: Is this gene present in the new genome?
Given a protein sequence, how to predict its function? >unknow_protein_1 MVHLTDAEKAAVSCLWGKVNSDEVGGEALGRLLVVYPWTQR YFDSFGDLSSASAIMGNAKVKAHGKKVITAFNDGLNHLDSL KGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGKDF TPAAQAAFQKVVAGVATALAHKYH Common approaches Sequence alignment: BLAST Domains: PFAM, InterProScan
NCBI BLAST How does BLAST work? BLAST and Psi-BLAST: Position independent and position specific scoring matrix.
Two scenarios of BLAST 1. You have a gene sequence, you want to know the function of this gene. Query: your gene sequence Database: Genbank/Genpept, Refseq, Uniprot, Swissprot
Two scenarios of BLAST 2. You have a genome/transcriptome, you want to know whether your gene is present. Query: your gene sequence Database: BLAST formatted genome database
BLAST programs blastn nucleotide query vs. nucleotide database blastp protein query vs. protein database blastx nucleotide query vs. protein database tblastn protein query vs. translated nucleotide database tblastx translated query vs. translated database
BLAST Databases Services megablast blastn tblastn tblastx
Nucleic Databases NCBI: Genbank (raw) Refseq (curated) UCSC: Refseq EBI: Ensembl UCSC Refseq is derived from reference genome
Sequence types Genome Gene (exon + intron) cdna (exon)
Ensembl Biomart Provides each to use interface to retrieve sequences
Protein Databases NCBI: Genpept (raw) Refseq (curated) UCSC: Refseq EBI: SwissProt Uniref
NCBI Refseq Proteins: 81M Organisms: 68 K
84,827,567 EBI UniProtKB/Swiss-Prot Release 2017_04 UniProtKB Swiss-prot UniRef100 UniRef90 UniRef50 85 M 0.6 M 106 M 55 M 22 M
How does BLAST work Step 1. Create alignments between HSPs (High-scoring Segment Pair)
How does BLAST work Step 2. Score each alignment, and report the top alignments Number of Chance Alignments = 2 X 10-73 Match=+2 Mismatch=-3 Gap -(5 + 4(2))= -13 - NCBI Discovery Workshops
BLOSUM62, a position independent matrix
How does BLAST work Step 2. Score each alignment protein alignment Number of Chance Alignments = 4 X 10-50 K K +5 K E +1 Q F -3 Gap -(11 + 6(1))= - 18 Scores from BLOSUM62, a position independent matrix - NCBI Discovery Workshops
BLOSUM62 substitution score is position independent Scores from BLOSUM62, a position independent matrix - NCBI Discovery Workshops
PSSM Alignment: Globins Conserved Histidine - NCBI Discovery Workshops
PSSM Viewer Histidine scored differently at two positions - NCBI Discovery Workshops
PSI-BLAST Build PSSM with PSI-BLAST 1. Iteration 1: Regular BLASTP (BLOSSOM62) to identify a list of closely related proteins. Build PSSM from these proteins. 2. Iteration 2: Use the PSSM built from Iteration 1 to score alignment in this Iteration. 3. Repeat multiple iterations. - NCBI Discovery Workshops
Build PSSM with DELTA-BLAST DELTA-BLAST employs a subset of NCBI's Conserved Domain Database (CDD) to construct PSSM
Heme Binding Site Conserved Histidine blastp DELTA-BLAST - NCBI Discovery Workshops
Heme Binding Site Conserved Histidine blastp DELTA-BLAST BLAST is not reliable for alignment of homologous genes between distantly related species. - NCBI Discovery Workshops
BLAST does Local Alignment (Basic Local Alignment Search Tool) Local Alignment vs Global Alignment HSP-1 HSP-2 (Bowtie, BWA, ClustalW, et al)
Database usage examples 1. Identify species for a list of sequences. BioHPC: fastq_species_detector (using NCBI Genbank) https://cbsu.tc.cornell.edu/lab/userguide.aspx?a=softwar e&i=149#c 2. Function annotation BLAST to a closely related species. (Ensembl, Flybase, et al) BLAST to Swissprot, Uniref (EBI) or Refseq (NCBI)