Title:Streptococcus pyogenes strains in Sao Paulo, Brazil: molecular characterization as a basis for StreptInCor coverage capacity analysis.
|
|
- Jason Cook
- 6 years ago
- Views:
Transcription
1 Author's response to reviews Title:Streptococcus pyogenes strains in Sao Paulo, Brazil: molecular characterization as a basis for StreptInCor coverage capacity analysis. Authors: Samar Freschi de Barros (sfreschi@usp.br) Karine M De Amicis (karineamicis@gmail.com) Raquel Alencar (quelalencar@yahoo.com) Pierre R Smeesters (pierre.smeesters@mcri.edu.au) Ariel Trunkel (attsp@uol.com.br) Edilberto Postól (edilpostol@yahoo.com.br) João N de Almeida Jr (jnaj99@gmail.com) Flavia Rossi (flaviarossi61@gmail.com) Antonio CC Pignatari (pignatari@terra.com.br) Jorge Kalil (jkalil@usp.br) Luiza Guilherme (luizagui@usp.br) Version:4Date:3 July 2015 Author's response to reviews: see over
2 To: Hilary Logan São Paulo, July 3 rd, Dear Editor, It is our pleasure to resubmit the paper: Streptococcus pyogenes strains in Sao Paulo, Brazil: molecular characterization as a basis for StreptInCor coverage capacity analysis. We rebuilt the manuscript based on the comments of both reviewers considering all the comments in detail. In the following pages, we present the point-by-point description of the changes made We thank the reviewers for time spent and suggestions and we believe that we answered all the questions and comments. Thank you very much for your attention. Looking forward to hearing from you. Sincerely yours, Luiza GUILHERME, PhD Instituto do Coração (InCor) Av. Dr. Eneas de Carvalho Aguiar, 44 São Paulo, SP, Brazil Phone: , Fax: luizagui@usp.br
3 Reviewer: Dr Debra E. Bessen Title: Streptococcus pyogenes strains in Sao Paulo, Brazil: molecular characterization as a basis for StreptInCor coverage capacity analysis. We agree with the reviewer s view and based on the comments we made changes in the manuscript. We thank the reviewer for the time and efforts to improve our manuscript. We precisely indicated in the revised manuscript (red typed) where the changes were done. Response to major compulsory revisions: 1. The main outcome measure for this specific study is the % amino acid sequence identity with the StreptInCor polypeptide, which ranges from 59 to 94%. Yet, there is no discussion (or experimental data) that relates these specific homology values to predicted vaccine coverage. For this reason, the connection between the vaccine coverage goal of this study, and the data and its analysis, appears to be weak. We improved the discussion on vaccine coverage and a new text was added as follow: Page 12 - Discussion, Lines The possibility of the StrepInCor vaccine candidate epitope being processed by antigen-presenting cells (APCs) generating diverse peptides has also been previously demonstrated. The approach resulted in the observation that the vaccine epitope could be recognized by any individual, thus enabling a broad coverage capacity to trigger specific immunity [36]. The efficacy of this vaccine in animal models was evaluated in inbred and outbred mice, and a strong humoral response with high IgG production was observed [18]. Immunized Swiss mice challenged with the emm1 strain had a survival rate of 87% at 21 days compared with lower survival in controls (53%) [19]. 2. Lines 139, and The authors state that pattern D is associated with "skin" infections, which is not entirely true. Pattern D is associated specifically with "impetigo", and that association excludes other types of skin infections, such as wound infections. Similarly, Pattern A-C is specifically associated with throat "infections", and excludes oropharyngeal carriage. Thus, a more precise clinical definition of "skin"
4 and "throat" isolates is required in order to make valid calculations (Table 2, statistics) on the association between emm pattern and impetigo versus pharyngitis. We agree with the reviewer, but we do not have all clinical data so, we eliminated the Table 2 and modified the text. A new Table (Table 2) was presented with the strains classified in emm clusters as proposed by Sanderson-Smith et al. Page 7- Methods, lines DNA isolation, emm-typing, patterning and emm-cluster distribution. The genomic DNA extraction, emm-gene PCR amplification and sequencing and emm-type identification were performed according to the protocol described by the CDC ( using the primers MF2 and MR1 for amplification and sequencing, respectively, as previously described [22]. The emm-pattern for each emm-type was deduced using the table of correspondence provided by a recent multi-center study [4]. The emm-cluster classification of the strains identified in this study was based on the new functional classification recently proposed by Sanderson-Smith et al. [14]. Page 8- Results, lines emm-pattern and emm-cluster distribution. We inferred the emm-pattern for 213 of 214 emm-types, except for emm127 (previously named st223). Pattern E and A-C emm-types were present at similar proportions (43 and 38%), whereas pattern D strains were less frequent (18%). The strains were classified according to the emm-clusters, and the strains fit into 12 of 19 different emmclusters. Most strains belonged to emm-cluster A-C3 (21%), followed by E4 (20%), E3 (13%), D4 (12%), single protein cluster clade Y (9%), A-C4 and E6 (7%), A-C5 and E1 and E2 (3%), D2 and D5 (1%) (Table 2). Minor essential revisions: 1. Line 128: What is the evidence that emm22 and emm87 are among the four most common emm types "around the world"? This does not seem to be a correct statement. The emm22 and emm87 strains are in fact the most common in Brazil. The text was modified and these lines were excluded. 2. Lines Sentence structure error. Also, lines Numerous grammar errors. The reviewed manuscript was submitted to professional English correction as suggested.
5 Reply to reviewer: Dr Ran Nir-Paz Title: Streptococcus pyogenes strains in Sao Paulo, Brazil: molecular characterization as a basis for StreptInCor coverage capacity analysis. We agree with the reviewer s view and based on the comments we made changes in the manuscript. We thank the reviewer for the time and efforts to improve our manuscript We precisely indicated in the revised manuscript (red typed) where the changes were done. 1. Vaccine coverage the authors should clarify that when they speak on vaccine coverage they mean that it is in silico based on predicted AA sequence. (See for example the abstract, page 10 and also throughout). The vaccine coverage capacity prediction was done by in silico analysis based on predicted AA sequences. In the text, we clarified the statement as follow: Page 3- Abstract, line 66. In silico analysis of the coverage capacity of StreptInCor, an M protein-conserved regionally based vaccine candidate developed by our group, had a range of 94.5% to 59.7%, with a mean of 71.0% identity between the vaccine antigen and the predicted amino acid sequence of the emm-types included here. Page 11 - Discussion, lines Through in silico analysis with predicted amino acid sequence alignment, StreptInCor candidate vaccine had high sequence identity with 46 of the 48 emm-types described here (identity ranged from 94.5% to 59.7%, mean of 71%), which is an important property for the probability of protection. In previous data, we described the structural, chemical, and biological properties of the StreptInCor peptide and demonstrated that the molecule is stable, which is an important property for a vaccine candidate. 2. Paragraph in lines is probably too long and not too related to this manuscript. I would omit that and just summarize that very briefly in the previous paragraph. We agree with the reviewer and we modified the text as follow: Page 6 Background, lines To date, no anti-streptococcal A vaccine is available; however, several candidates based on both N- and C- terminal portions of the M protein are in different stages of development [15]. Briefly, the 30-valent is based on the highly variable amino-terminal region of the M protein [16], and the J8 candidate vaccine a construction of minimal B-cell epitope from the C-repeat region [17].
6 StreptInCor candidate vaccine is based on amino acid sequences of the conserved region of the M5 protein. This candidate vaccine, in contrast to the others, contains both B and T cell epitopes to provide a strong protective immune response [18]. 3. Simpson index is not widely used in GAS manuscripts. I would rather like the authors to explain why it is being used and to elaborate a bit more on the meaning and implications of its use, and to help the reader understanding this. Probably it would be better to reverse the order of the paragraph in the methods section and explain a bit more on the results and the in the discussion. We have reversed the order of the paragraph in the method section as suggested and have added more explanations in the result as follow: Page 7-8- Methods, lines Statistical analysis. The Simpson Reciprocal Index (1/D) of 1 corresponds to a theoretical situation in which only one emm-type/cluster is recovered, representing the lowest diversity possible. The maximum Simpson Reciprocal Index corresponds to the total number of emm-type/cluster recovered in one area. Higher values indicate greater diversity. A Simpson Index was calculated using the following formula: D = (n/n) 2, where n is the total number of isolates of a given emm-type or belonging to a given cluster and N is the total number of isolates of all the emm-types/clusters recovered in an area [25, 26]. Confidence intervals were calculated as previously described [27]. Page 8- Results, lines To better understand the strain diversity present in our study, and its likely consequence for multivalent vaccine coverage, we have calculated the reciprocal Simpson index of diversity which results was 12.7 (95% CI, ). We have also moved a section from the methods to the discussion for clarity reasons: Page 10- Discussion, lines In terms of GAS strain diversity, a Simpson Reciprocal Index of 1 corresponding to a theoretical situation where only one emm-type/cluster has been recovered, representing the lowest diversity possible. The maximum value of the Simpson Reciprocal Index corresponds to the total number of emm-type/cluster recovered in one area. The higher the value is, the greater the diversity. The reciprocal Simpson index of diversity found in this study was relatively low (12.7) when compared to the index of for Brasilia (in
7 the central region of Brazil) [22]. On the other hand, our results were similar to those reported for high incomes suburbs from Salvador, in northeastern Brazil [23]. 4. The emm cluster distribution (page 10) should be part of the EMM section (top of page 9) and combined in to that section. We combined emm cluster with the emm section as suggested. These modification in Methods section and in results section as follow: Page 7- Methods, lines DNA isolation, emm-typing, patterning and emm-cluster distribution. The genomic DNA extraction, emm-gene PCR amplification and sequencing and emm-type identification were performed according to the protocol described by the CDC ( using the primers MF2 and MR1 for amplification and sequencing, respectively, as previously described [22]. The emm-pattern for each emm-type was deduced using the table of correspondence provided by a recent multi-center study [4]. The emm-cluster classification of the strains identified in this study was based on the new functional classification recently proposed by Sanderson-Smith et al. [14]. Page 8- Results, lines emm-pattern and emm-cluster distribution. We inferred the emm-pattern for 213 of 214 emm-types, except for emm127 (previously named st223). Pattern E and A-C emm-types were present at similar proportions (43 and 38%), whereas pattern D strains were less frequent (18%). The strains were classified according to the emm-clusters, and the strains fit into 12 of 19 different emmclusters. Most strains belonged to emm-cluster A-C3 (21%), followed by E4 (20%), E3 (13%), D4 (12%), single protein cluster clade Y (9%), A-C4 and E6 (7%), A-C5 and E1 and E2 (3%), D2 and D5 (1%) (Table 2). 5. I didn t found the methods relevant to figure 3 in the methods section. A dedicated paragraph has been added in the method section as follow: Page 8- Methods, lines M protein sequence analyses. M proteins complete sequences and C repeat annotation from each emm-type included in this study were derived from previous study [4]. Multiple proteic alignments were obtained using Muscle software as implemented in Geneious version R8.
Results for week 1 Dr Mike Dyall-Smith
Lecture 2. emm sequence typing of GAS Results for week 1 Dr Mike Dyall-Smith Review of week 1 results Why (sero)group and (sero)type streptococci? Typing schemes: M, SOF, T antigens emm sequence typing
More informationReviewers' Comments: Reviewer #1 (Remarks to the Author)
Reviewers' Comments: Reviewer #1 (Remarks to the Author) In this study, Rosenbluh et al reported direct comparison of two screening approaches: one is genome editing-based method using CRISPR-Cas9 (cutting,
More informationCONCEPT OF SIMILAR MEDICINAL PRODUCT IN THE CONTEXT OF THE ORPHAN LEGISLATION: ADAPTATION TO TECHNICAL PROGRESS
Ref. Ares(2016)6257284-04/11/2016 04 November 2016 Submission of comments on the Consultation Document CONCEPT OF SIMILAR MEDICINAL PRODUCT IN THE CONTEXT OF THE ORPHAN LEGISLATION: ADAPTATION TO TECHNICAL
More informationEpidemiology analysis of Streptococcus pyogenes in a hospital of southern Taiwan using the
JCM Accepted Manuscript Posted Online 11 November 2015 J. Clin. Microbiol. doi:10.1128/jcm.02089-15 Copyright 2015, American Society for Microbiology. All Rights Reserved. 1 2 Epidemiology analysis of
More informationCloning and Sequence Analysis of the 22-kDa Antigen Genes of Orientia tsutsugamushi Strains Kato, TA763, AFSC 7, , TH1814, and MAK 119
Cloning and Sequence Analysis of the 22-kDa Antigen Genes of Orientia tsutsugamushi Strains Kato, TA763, AFSC 7, 18-032460, TH1814, and MAK 119 HONG GE, a MIN TONG, a ANDREW LI, b RAJAN MEHTA, b AND WEI-MEI
More information1 Name. 1. (3 pts) What is apoptosis and how does it differ from necrosis? Which is more likely to trigger inflammation?
1 Name MCB 150 Midterm Eam #1 (100 points total) Please write your full name on each page of the eam!! The eam consists of 17 questions (6 pages). Each has a different point count as indicated. Please
More informationTracking Evolutionary Genetic Events in Group A Streptococcus Using Whole Genome Mapping
#B-2001 Tracking Evolutionary Genetic Events in Group A Streptococcus Using Whole Genome Mapping J. Coppens 1, J. Sabirova 1, C. Lammens 1, K. Loens 2, S. Malhotra-Kumar 1, H. Goossens 1 1 Laboratory of
More informationSUPPLEMENTARY FIGURES AND TABLES. Exploration of mirna families for hypotheses generation
SUPPLEMENTARY FIGURES AND TABLES Exploration of mirna families for hypotheses generation Timothy K. K. Kamanu, Aleksandar Radovanovic, John A. C. Archer, and Vladimir B. Bajic King Abdullah University
More informationChapter 4. Antigen Recognition by B-cell and T-cell Receptors
Chapter 4 Antigen Recognition by B-cell and T-cell Receptors Antigen recognition by BCR and TCR B cells 2 separate functions of immunoglobulin (Ig) bind pathogen & induce immune responses recruit cells
More informationComparative genomics of clinical isolates of Pseudomonas fluorescens, including the discovery of a novel disease-associated subclade.
Comparative genomics of clinical isolates of Pseudomonas fluorescens, including the discovery of a novel disease-associated subclade. by Brittan Starr Scales A dissertation submitted in partial fulfillment
More informationSummary of activities (about 800 words, provide photos, tables and figures that clearly show the activities during the period)
(Abroad Domestic)Official trip report form(student) 2014/06/10 (Year/Month/Day) Name Jesca Nakayima Laboratory Division of Collaboration and Education, CZC Year (Grade) D4 Destination Obihiro University
More informationBioinformatics & Protein Structural Analysis. Bioinformatics & Protein Structural Analysis. Learning Objective. Proteomics
The molecular structures of proteins are complex and can be defined at various levels. These structures can also be predicted from their amino-acid sequences. Protein structure prediction is one of the
More informationTo the Reviewers: POINT-BY-POINT REPLY
To the Reviewers: We changed our manuscript according to the Reviewer s suggestions. We used a red character for the novel information added or for the sentences deleted from the original version of the
More informationCHAPTER 3 ANTIBODY STRUCTURE I
CHAPTER 3 ANTIBODY STRUCTURE I See APPENDIX: (3) OUCHTERLONY ANALYSIS; (6), EQUILIBRIUM DIALYSIS; (7) CROSS-REACTIVITY Electrophoretic separation of serum proteins identifies the GAMMA-GLOBULIN fraction
More informationBiology A: Chapter 9 Annotating Notes Protein Synthesis
Name: Pd: Biology A: Chapter 9 Annotating Notes Protein Synthesis -As you read your textbook, please fill out these notes. -Read each paragraph state the big/main idea on the left side. -On the right side
More informationTreponema pallidum reveals extensive within-patient genetic variation
SUPPLEMENTARY INFORMATION ARTICLE NUMBER: 16190 DOI: 10.1038/NMICROBIOL.2016.190 Genome-scale analysis of the non-cultivable Treponema pallidum reveals extensive within-patient genetic variation Miguel
More informationNovel T cell antigen discovery technology providing new momentum on a malaria vaccine
Novel T cell antigen discovery technology providing new momentum on a malaria vaccine World Vaccine Congress 2012 Best Vaccine Startup 2008 Jessica Baker Flechtner, PhD Vice President, Research Genocea
More informationChimp Sequence Annotation: Region 2_3
Chimp Sequence Annotation: Region 2_3 Jeff Howenstein March 30, 2007 BIO434W Genomics 1 Introduction We received region 2_3 of the ChimpChunk sequence, and the first step we performed was to run RepeatMasker
More informationA History of Bioinformatics: Development of in silico Approaches to Evaluate Food Proteins
A History of Bioinformatics: Development of in silico Approaches to Evaluate Food Proteins /////////// Andre Silvanovich Ph. D. Bayer Crop Sciences Chesterfield, MO October 2018 Bioinformatic Evaluation
More informationMETHODS IN CELL BIOLOGY EXAM II, MARCH 26, 2008
NAME KEY METHODS IN CELL BIOLOGY EXAM II, MARCH 26, 2008 1. DEFINITIONS (30 points). Briefly (1-3 sentences, phrases, word, etc.) define the following terms or answer question. A. depot effect refers to
More informationTools and Technologies for Immunogenicity and Allergenicity Risk Management
Tools and Technologies for Immunogenicity and Allergenicity Risk Management Dr. Jeremy Fry HESI PATC Symposium on Sensitizing Properties of Proteins 11-13 April 2012 Immunogenicity and Allergenicity Immunogenicity
More informationReviewers' comments: Reviewer #1 (Remarks to the Author):
Reviewers' comments: Reviewer #1 (Remarks to the Author): Modulating immune checkpoint pathways like CTLA-4 and PD-1 for cancer immunotherapy has gained much attention in recent years due to their immense
More informationESSENTIAL BIOINFORMATICS
ESSENTIAL BIOINFORMATICS Essential Bioinformatics is a concise yet comprehensive textbook of bioinformatics that provides a broad introduction to the entire field. Written specifically for a life science
More informationImmunogenicity: Assessing the Clinical Relevance and Risk Minimization of Antibodies to Biopharmaceuticals
Immunogenicity: Assessing the Clinical Relevance and Risk Minimization of Antibodies to Biopharmaceuticals Daniel Kramer/Kathleen Beach Need for public-private collaboration 1 All biopharmaceuticals are
More informationExamination Assignments
Bioinformatics Institute of India H-109, Ground Floor, Sector-63, Noida-201307, UP. INDIA Tel.: 0120-4320801 / 02, M. 09818473366, 09810535368 Email: info@bii.in, Website: www.bii.in INDUSTRY PROGRAM IN
More informationDETERMINATION OF THE Rh FACTOR BY PCR
DETERMINATION OF THE Rh FACTOR BY PCR Ref.: PCR2 1. EXPERIMENT OBJECTIVE The aim of this experiment is to introduce students to the principles and practice of the Polymerase Chain Reaction (PCR) by studying
More informationCodex Committee on Methods of Analysis and Sampling (31 st Session) Budapest, Hungary (8-12 March 2010)
CRD 13 Codex Committee on Methods of Analysis and Sampling (31 st Session) Budapest, Hungary (8-12 March 2010) European Union comments on the Proposed Draft Guidelines on Criteria for Methods for Detection,
More informationGenome-wide longitudinal analysis of emm1 invasive Group A Streptococcus isolated from Belgian patients during
#O226 Genome-wide longitudinal analysis of emm1 invasive Group A Streptococcus isolated from Belgian patients during 1994 2013 J. Coppens 1, B. B. Xavier, J. Sabirova 1, C. Lammens 1, K. Loens 2, S. Malhotra-Kumar
More informationComputational methods in bioinformatics: Lecture 1
Computational methods in bioinformatics: Lecture 1 Graham J.L. Kemp 2 November 2015 What is biology? Ecosystem Rain forest, desert, fresh water lake, digestive tract of an animal Community All species
More informationApplied Protein Services
Applied Protein Services Applied Protein Services A Window into the Future Development risk and attrition rates remain two of the greatest challenges to a successful biopharmaceutical pipeline. To help
More informationInterplay of Cells involved in Therapeutic Agent Immunogenicity. Robert G. Hamilton, Ph.D., D.ABMLI Professor of Medicine and Pathology
Interplay of Cells involved in Therapeutic Agent Immunogenicity Robert G. Hamilton, Ph.D., D.ABMLI Professor of Medicine and Pathology Disclosure The author works with Amicus on an immunogenicity project
More informationLaura Sims PhD UC Berkeley Forest Pathology and Mycology Lab
Laura Sims PhD UC Berkeley Forest Pathology and Mycology Lab Outline What can molecular biology tell us about a pathogen? Tools and techniques used for diagnostics ELISA PCR Sequencing Sequence alignment
More informationDRUG REGISTRATION REGULATION
DRUG REGISTRATION REGULATION Registration Categories and Application Information Items Requirements of Biological Products Part I I Therapeutic Biological Products Registration Categories 1) Biological
More informationMOLECULAR BIOLOGY OF EUKARYOTES 2016 SYLLABUS
03-442 Lectures: MWF 9:30-10:20 a.m. Doherty Hall 2105 03-742 Advanced Discussion Section: Time and place to be announced Probably Mon 4-6 p.m. or 6-8p.m.? Once we establish who is taking the advanced
More informationWriting Your Honors Thesis
Writing Your Honors Thesis Your thesis should be in the common scientific paper format using FIVE separate sections Abstract Introduction Materials and Methods Results Discussion Keep in mind----your thesis
More informationMastering Immunity. ProPresent. Antigen Presentation Assay. Copyright ProImmune Limited All Rights Reserved
Mastering Immunity ProPresent Antigen Presentation Assay Background Options to explore T cell epitopes Prediction (fast, inexpensive, accuracy?, does not confirm epitope) Proliferation assays (well suited
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature09944 Supplementary Figure 1. Establishing DNA sequence similarity thresholds for phylum and genus levels Sequence similarity distributions of pairwise alignments of 40 universal single
More informationEfficient translation initiation dictates codon usage at gene start in bacteria
Molecular Systems Biology Peer Review Process File Efficient translation initiation dictates codon usage at gene start in bacteria Kajetan Bentele, Paul Saffert, Robert Rauscher, Zoya Ignatova, Nils Blüthgen
More informationShort- and Long-Term Immune Responses of CD-1 Outbred Mice to the Scrub Typhus DNA Vaccine Candidate: p47kp
Short- and Long-Term Immune Responses of CD-1 Outbred Mice to the Scrub Typhus DNA Vaccine Candidate: p47kp GUANG XU, a SUCHISMITA CHATTOPADHYAY, a JU JIANG, a TEIK-CHYE CHAN, a CHIEN-CHUNG CHAO, a WEI-MEI
More informationNature Methods: doi: /nmeth Supplementary Figure 1. Construction of a sensitive TetR mediated auxotrophic off-switch.
Supplementary Figure 1 Construction of a sensitive TetR mediated auxotrophic off-switch. A Production of the Tet repressor in yeast when conjugated to either the LexA4 or LexA8 promoter DNA binding sequences.
More informationFinding Genes with Genomics Technologies
PLNT2530 Plant Biotechnology (2018) Unit 7 Finding Genes with Genomics Technologies Unless otherwise cited or referenced, all content of this presenataion is licensed under the Creative Commons License
More informationRNA-Guided Gene Activation by CRISPR-Cas9-Based Transcription Factors
Supplementary Information RNA-Guided Gene Activation by CRISPR-Cas9-Based Transcription Factors Pablo Perez-Pinera 1, Daniel D. Kocak 1, Christopher M. Vockley 2,3, Andrew F. Adler 1, Ami M. Kabadi 1,
More informationThe Iso-Seq Method: Transcriptome Sequencing Using Long Reads
The Iso-Seq Method: Transcriptome Sequencing Using Long Reads Elizabeth Tseng, Ph.D. Senior Staff Scientist FIND MEANING IN COMPLEXITY For Research Use Only. Not for use in diagnostic procedures. Copyright
More informationPrimePCR Assay Validation Report
Gene Information Gene Name major histocompatibility complex, class II, DR beta 1 Gene Symbol Organism Gene Summary Gene Aliases RefSeq Accession No. UniGene ID Ensembl Gene ID HLA-DRB1 Human HLA-DRB1 belongs
More informationName with Last Name, First: BIOE111: Functional Biomaterial Development and Characterization MIDTERM EXAM (October 7, 2010) 93 TOTAL POINTS
BIOE111: Functional Biomaterial Development and Characterization MIDTERM EXAM (October 7, 2010) 93 TOTAL POINTS Question 0: Fill in your name and student ID on each page. (1) Question 1: What is the role
More informationBIO4342 Lab Exercise: Detecting and Interpreting Genetic Homology
BIO4342 Lab Exercise: Detecting and Interpreting Genetic Homology Jeremy Buhler March 15, 2004 In this lab, we ll annotate an interesting piece of the D. melanogaster genome. Along the way, you ll get
More informationA novel therapeutic strategy to rescue the immune effector function of proteolyticallyinactivated
A novel therapeutic strategy to rescue the immune effector function of proteolyticallyinactivated cancer therapeutic antibodies Supplemental Data File in this Data Supplement: Supplementary Figure 1-4
More informationCorynebacterium pseudotuberculosis genome sequencing: Final Report
Summary To provide an invaluable resource to assist in the development of diagnostics and vaccines against caseous lymphadenitis (CLA), the sequencing of the genome of a virulent, United Kingdom Corynebacterium
More informationTextbook Reading Guidelines
Understanding Bioinformatics by Marketa Zvelebil and Jeremy Baum Last updated: January 16, 2013 Textbook Reading Guidelines Preface: Read the whole preface, and especially: For the students with Life Science
More informationChapter 17: Immunization & Immune Testing. 1. Immunization 2. Diagnostic Immunology
Chapter 17: Immunization & Immune Testing 1. Immunization 2. Diagnostic Immunology 1. Immunization Chapter Reading pp. 505-511 What is Immunization? A method of inducing artificial immunity by exposing
More information1. Immunization. What is Immunization? 12/9/2016. Chapter 17: Immunization & Immune Testing. 1. Immunization 2. Diagnostic Immunology
Chapter 17: Immunization & Immune Testing 1. Immunization 2. Diagnostic Immunology 1. Immunization Chapter Reading pp. 505-511 What is Immunization? A method of inducing artificial immunity by exposing
More informationSupplemental Fig. S1. Key to underlines: Key to amino acids:
AspA-F1 AspA 1 MKQMETKGYGYFRKTKAYGLVCGIT--------------LAGALTLGTTSVSADDVTTLNPATNLTTLQTPPTADQTQLAHQAGQQSGELVSEVSNTEWD 86 SspB 1 MQKREV--FG-FRKSKVAKTLCGAV-LGAALIAIADQQVLADEVTETNSTANVAVTTTGNPATNLPEAQGEATEAASQSQAQAGSKDGALPVEVSADDLN
More informationA primer on the structure and function of genes
A primer on the structure and function of genes What is the definition of a gene? GENE: the genetic element which is transmitted from parent to offspring during the process of reproduction that influences
More informationAbstract... i. Committee Membership... iii. Foreword... vii. 1 Scope Introduction Standard Precautions References...
Vol. 28 No. 12 Replaces MM18-P Vol. 27 No. 22 Interpretive Criteria for Identification of Bacteria and Fungi by DNA Target Sequencing; Approved Guideline Sequencing DNA targets of cultured isolates provides
More informationArray-Ready Oligo Set for the Rat Genome Version 3.0
Array-Ready Oligo Set for the Rat Genome Version 3.0 We are pleased to announce Version 3.0 of the Rat Genome Oligo Set containing 26,962 longmer probes representing 22,012 genes and 27,044 gene transcripts.
More informationSupplementary Materials
Supplementary Materials The number of sequence variations among the known phage genomes can provide an estimate of the P. acnes phage population diversity within each skin community. We calculated the
More informationThis place covers: Methods or systems for genetic or protein-related data processing in computational molecular biology.
G16B BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY Methods or systems for genetic
More informationLAMPIRE Hybridoma Project Initiation Form
1. General Information Company / Institution: Investigator Name: Contact Name: Phone: Fax: 2. Billing / Shipping Information Accounts Payable contact: Company: Dept./Bldg./Room#: Address: Project Name
More informationFUNCTIONAL BIOINFORMATICS
Molecular Biology-2018 1 FUNCTIONAL BIOINFORMATICS PREDICTING THE FUNCTION OF AN UNKNOWN PROTEIN Suppose you have found the amino acid sequence of an unknown protein and wish to find its potential function.
More informationSUPPORTING INFORMATION. A cleavage-responsive stem-loop hairpin for assaying guide RNA activity
SUPPORTING INFORMATION A cleavage-responsive stem-loop hairpin for assaying guide RNA activity Tara R. deboer 1, Noreen Wauford 1, Jing-Yi Chung, Miguel Salvador Torres Perez, and Niren Murthy* University
More informationTECHNIQUES IN BIOTECHNOLOGY (BIO 461) Spring 2013
TECHNIQUES IN BIOTECHNOLOGY (BIO 461) Spring 2013 Class Meets MW 3:30 to 5:50 in FSC 132 Course Instructors: Drs. Lucinda Elliott and William Patrie Offices: Dr. Elliott (FSC 153), Dr. Patrie (FSC 152)
More informationSupplementary Material
Supplementary Material The Cerato-Platanin protein Epl-1 from Trichoderma harzianum is involved in mycoparasitism, plant resistance induction and self cell wall protection Eriston Vieira Gomes 1, Mariana
More informationAdaptive Immunity: Specific Defenses of the Host
PowerPoint Lecture Presentations prepared by Bradley W. Christian, McLennan Community College C H A P T E R 17 Adaptive Immunity: Specific Defenses of the Host The Adaptive Immune System Adaptive immunity:
More informationWhole Genome Association Study on Tissue Tropism Phenotypes. in Group A Streptococcus. Julie C. Dunning Hotopp 2, and Hervé Tettelin 2
JB Accepts, published online ahead of print on 23 September 2011 J. Bacteriol. doi:10.1128/jb.05263-11 Copyright 2011, American Society for Microbiology and/or the Listed Authors/Institutions. All Rights
More informationWestern-GUARANTEED Antibody Service FAQ
Western-GUARANTEED Antibody Service FAQ Content Q 1: When do I need a Western GUARANTEED Peptide Antibody Package?...2 Q 2: Can GenScript provide a Western blot guaranteed antibody?...2 Q 3: Does GenScript
More informationSupplement to: The Genomic Sequence of the Chinese Hamster Ovary (CHO)-K1 cell line
Supplement to: The Genomic Sequence of the Chinese Hamster Ovary (CHO)-K1 cell line Table of Contents SUPPLEMENTARY TEXT:... 2 FILTERING OF RAW READS PRIOR TO ASSEMBLY:... 2 COMPARATIVE ANALYSIS... 2 IMMUNOGENIC
More informationBIOLOGY 205 Midterm II - 19 February Each of the following statements are correct regarding Eukaryotic genes and genomes EXCEPT?
BIOLOGY 205 Midterm II - 19 February 1999 Name Multiple choice questions 4 points each (Best 12 out of 13). 1. Each of the following statements are correct regarding Eukaryotic genes and genomes EXCEPT?
More informationICH Considerations. Oncolytic Viruses September 17, 2009
INTERNATIONAL CONFERENCE ON HARMONISATION OF TECHNICAL REQUIREMENTS FOR REGISTRATION OF PHARMACEUTICALS FOR HUMAN USE ICH Considerations Oncolytic Viruses September 17, 2009 1. Introduction Oncolytic viruses
More informationHLA-DR TYPING OF GENOMIC DNA
HLA-DR TYPING OF GENOMIC DNA Zofia SZCZERKOWSKA, Joanna WYSOCKA Institute of Forensic Medicine, Medical University, Gdañsk, Poland ABSTRACT: Advances in molecular biology techniques allowed for introduction
More informationCENTER FOR BIOTECHNOLOGY
CENTER FOR BIOTECHNOLOGY Keith A. McGee, Ph.D., Program Director Math and Science Building, 3 rd Floor 1000 ASU Drive #870 Phone: 601-877-6198 FAX: 601-877-2328 Degree Offered Required Admission Test M.
More informationStrep Assay. Frequently Asked Questions
Strep Assay Frequently Asked Questions General What is the sensitivity/specificity of the Lyra Direct Strep Assay? Performance characteristics of the Lyra Direct Strep Assay using the Applied Biosystems
More informationFinding Data in the IEDB 3.0. Kerrie Vaughan, PhD - Sr. Biocurator/Meta-Analysis Nima Salimi, MS - Sr. Biocurator/Curation Mgr
Finding Data in the IEDB 3.0 Kerrie Vaughan, PhD - Sr. Biocurator/Meta-Analysis Nima Salimi, MS - Sr. Biocurator/Curation Mgr 1 Finding Data in the IEDB 3.0 IEDB Overview Content and Organization IEDB
More informationImmunoglobulins. Harper s biochemistry Chapter 49
Immunoglobulins Harper s biochemistry Chapter 49 Immune system Detects and inactivates foreign molecules, viruses, bacteria and microorganisms Two components with 2 strategies B Lymphocytes (humoral immune
More information2. From the first paragraph in this section, find three ways in which RNA differs from DNA.
Name Chapter 17: From Gene to Protein Begin reading at page 328 Basic Principles of Transcription and Translation. Work on this chapter a single concept at a time, and expect to spend at least 6 hours
More informationDNA Function: Information Transmission
DNA Function: Information Transmission DNA is called the code of life. What does it code for? *the information ( code ) to make proteins! Why are proteins so important? Nearly every function of a living
More informationGene-centered resources at NCBI
COURSE OF BIOINFORMATICS a.a. 2014-2015 Gene-centered resources at NCBI We searched Accession Number: M60495 AT NCBI Nucleotide Gene has been implemented at NCBI to organize information about genes, serving
More informationMalaria research: A perspective from Brazil
FAPESP Week 2011 Malaria research: A perspective from Brazil Marcelo Urbano Ferreira University of São Paulo, Brazil muferrei@usp.br www.icb.usp.br/~muferrei Malaria distribution worldwide If more than
More informationFigure S1 Correlation in size of analogous introns in mouse and teleost Piccolo genes. Mouse intron size was plotted against teleost intron size for t
Figure S1 Correlation in size of analogous introns in mouse and teleost Piccolo genes. Mouse intron size was plotted against teleost intron size for the pcloa genes of zebrafish, green spotted puffer (listed
More informationGenetic Variation in Hookworm Populations in China. John M. Hawdon Zheng Qi Hu Ling Xiao Shua-Hua. China TMRC Feng Zheng, P.I.
Genetic Variation in Hookworm Populations in China John M. Hawdon Zheng Qi Hu Ling Xiao Shua-Hua China TMRC Feng Zheng, P.I. Ongoing collaboration through NIH-TMRC funding TMRC I 1996-2001 PGS of Hookworms
More informationSequencing emm-specific PCR Products for Routine and Accurate Typing of Group A Streptococci
JOURNAL OF CLINICAL MICROBIOLOGY, Apr. 1996, p. 953 958 Vol. 34, No. 4 0095-1137/96/$04.00 0 Copyright 1996, American Society for Microbiology Sequencing emm-specific PCR Products for Routine and Accurate
More informationTB Symposium, Barcelo Hotel September 20-22
Evolution of Mycobacterium tuberculosis PE/PPE multigenefamilies By Helmi Mardassi, Institut Pasteur de Tunis TB Symposium, Barcelo Hotel September 20-22 PE/PPE multigene families have been uncovered owing
More informationQuality Control Assays
QUALITY CONTROL An integral part of the Penn Vector Core is its robust quality control program which is carried out by a separate quality control group. Quality control assays have been developed and optimized
More informationSynthetic vaccine research and development. Comprehensive and innovative synthetic biology solutions and technologies
Synthetic vaccine research and development Comprehensive and innovative synthetic biology solutions and technologies From plan to product, Thermo Fisher Scientific supports your synthetic vaccine goals
More informationChang Xu Mohammad R Nezami Ranjbar Zhong Wu John DiCarlo Yexun Wang
Supplementary Materials for: Detecting very low allele fraction variants using targeted DNA sequencing and a novel molecular barcode-aware variant caller Chang Xu Mohammad R Nezami Ranjbar Zhong Wu John
More information3. This is the name of the small fragments of DNA that are replicated with several RNA primers in between them:
Section A: Multiple Choice [15] 1. The central dogma states that: a) DNA is held in the nucleus, which is translated into an amino acid strand, which leaves the nucleus and is transcribed into a mrna strand
More informationSolutions for Your Research
Solutions for Your Research Custom Antibody Services Polyclonal Monoclonal The service we offer is very complete starting from rabbits, mice and rats. The different formats provided by Primm depend on
More informationWhat I hope you ll learn. Introduction to NCBI & Ensembl tools including BLAST and database searching!
What I hope you ll learn Introduction to NCBI & Ensembl tools including BLAST and database searching What do we learn from database searching and sequence alignments What tools are available at NCBI What
More information8 th Vaccine & ISV Congress October 2014 Philadelphia, USA
8 th Vaccine & ISV Congress 26-28 October 2014 Philadelphia, USA 2014 Guinea Ebola Virus Recombinant Glycoprotein (GP) Nanoparticle Vaccine was Highly Immunogenic and Cross- Neutralized 1976 Ebola Virus
More informationMachine Learning. HMM applications in computational biology
10-601 Machine Learning HMM applications in computational biology Central dogma DNA CCTGAGCCAACTATTGATGAA transcription mrna CCUGAGCCAACUAUUGAUGAA translation Protein PEPTIDE 2 Biological data is rapidly
More informationPractice Exam A. Briefly describe how IL-25 treatment might be able to help this responder subgroup of liver cancer patients.
Practice Exam 2007 1. A special JAK-STAT signaling system (JAK5-STAT5) was recently identified in which a gene called TS5 becomes selectively transcribed and expressed in the liver upon induction by a
More informationCENTRE FOR BIOINFORMATICS M. D. UNIVERSITY, ROHTAK
Program Specific Outcomes: The students upon completion of Ph.D. coursework in Bioinformatics will be able to: PSO1 PSO2 PSO3 PSO4 PSO5 Produce a well-developed research proposal. Select an appropriate
More informationSupplemental Figure 1
Supplemental Figure 1 Supplemental figure 1. Generation of gene targeted mice expressing an anti-id BCR. (A,B) Generation of the VDJ aid H KI mouse. (A) Targeting Construct. Top: Targeting construct for
More information1 R01 AI VMD HALFORD, W
1 R01 AI104935-01 2 VMD 1R01AI104935-01 ILLIAM CRITIQUE 1: Significance: 5 Investigator(s): 2 Innovation: 5 Approach: 8 Environment: 2 Overall Impact: This application proposes to develop a recombinant
More informationICH CONSIDERATIONS Oncolytic Viruses
European Medicines Agency Pre-authorisation Evaluation of Medicines for Human Use 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 ICH CONSIDERATIONS Oncolytic Viruses 20 November 2008 EMEA/CHMP/GTWP/607698/2008
More informationABSTRACT. tropical and sub-tropical countries. Recent utility of turmeric by the pharmaceutical
ABSTRACT Turmeric (Curcuma longa L; Zingiberaceae) is one of the most important herb in the tropical and sub-tropical countries. Recent utility of turmeric by the pharmaceutical industries as a source
More informationBasics of RNA-Seq. (With a Focus on Application to Single Cell RNA-Seq) Michael Kelly, PhD Team Lead, NCI Single Cell Analysis Facility
2018 ABRF Meeting Satellite Workshop 4 Bridging the Gap: Isolation to Translation (Single Cell RNA-Seq) Sunday, April 22 Basics of RNA-Seq (With a Focus on Application to Single Cell RNA-Seq) Michael Kelly,
More informationLab Book igem Stockholm Sortase A. Week 5
Sortase A Week 5 Summarized below are the experiments conducted this week in chronological order. Click on the experiment name to view it. To go back to this summary, click Summary in the footer. Summary
More informationGuideline for the quality, safety and efficacy of follow-on biological medicinal products
Guideline for the quality, safety and efficacy of follow-on biological medicinal products 1. Introduction A follow-on biological medicinal product (hereinafter referred to as FOBMP) is considered as a
More informationChapter 20 Recombinant DNA Technology. Copyright 2009 Pearson Education, Inc.
Chapter 20 Recombinant DNA Technology Copyright 2009 Pearson Education, Inc. 20.1 Recombinant DNA Technology Began with Two Key Tools: Restriction Enzymes and DNA Cloning Vectors Recombinant DNA refers
More informationTrivalent M-related protein as a component of next generation group A streptococcal vaccines
Original article CLINICAL EXPERIMENTAL VACCINE RESEARCH Trivalent M-related protein as a component of next generation group A streptococcal vaccines Clin Exp Vaccine Res 2017;6:45-49 pissn 2287-3651 eissn
More information