CONTRACTORS INDUCTION KIT CONTRACTORS

Transcription

1 CONTRACTORS INDUCTION KIT CONTRACTORS The Contractor must, so far as is reasonably practicable, provide and maintain a working environment in which people are not exposed to hazards. Contractors will ensure that safety barriers are erected for all site works to keep unauthorised persons out of the work area. Safety barriers will be maintained in a good condition at all times and may include but not be restricted to such items as a water-filled barrier, signage and lighting. TO MINIMISE RISKS TO HEALTH AND SAFETY OF CONTRACTORS, UNIVERSITY STAFF, STUDENTS AND THE GENERAL PUBLIC FROM THE WORK ACTIVITIES OF CONTRACTORS ENGAGED TO CARRY OUT WORK ON BEHALF OF THE UNIVERSITY. > OHSW Regulations 1995, Division 2.5 Electrical > AS3760 In-Service safety inspection and testing of electrical equipment IT IS EXPRESSLY FORBIDDEN FOR CHEMICAL WASTES TO BE TIPPED INTO SINKS, ONTO THE GROUND, OR INTO SEWERS OR STORMWATER DRAINS IE: PAINT THINNERS, CHEMICALS, PAINTS, SOLVENTS, DETERGENTS, OILS ETC. OHSW&IM > NOHSC Safety Guidelines for Electrical Workers (1994) > NOHSC Electrical Safety for Construction Work (1993) > UniSA OHSW Procedure - Energy Isolation Tags and Lock-Off > UniSA OHSW Procedure - Electrical Equipment Inspection and Testing

2

3 Table of contents Section 1 About UniSA The University The Property Unit The Services Unit UniSA Section 2 General Information Arrival on campus Contractor Management Arrival on Campus Services Isolation Access / Isolation of Site Car Parking and Use of Vehicles on University Grounds Security Services Contacting Security Services in an Emergency Isolation of Fire & Security Alarms Contractor s Basic Responsibilities Induction Supervision Continued Occupation Safety Inspections / Breaches Reporting Incidents Cleaning Publicity & Advertising Smoke-Free Work Environment Ethical Standards Section 3 Occupational Health, Safety, Welfare and Injury Management Restricted Areas Isolation of Fume Cupboards Safety Issues Safety Signage Safety Equipment Other OHSW&IM Issues Comfort & Safety Facilities Enforcement Notices Manual Handling Motors and Machinery Noise Levels Use of Hazardous Substances Use of Hazardous Materials Chemical Spills Hazardous or Dangerous Materials Storage of Materials Salvaged Materials Fire Evacuation Procedures Fire Extinguishers

4 Table of contents Equipment, Plant and Tools Maintenace of Equipment, Plant and Tools Scaffolding and Hoardings Electrical Electrical Welding Machine Guarding Hand Tools Lasers Explosive Power Tools Mobile Mechanical Plant Compressed Air Equipment Danger and Out of Service Tags Barricades and Fencing Interruption of Services Hazardous Works Asbestos Trenching and Excavation Isolation of Services Working in Confined Spaces Hot Work UniSA Section 4 Our Environment Our Environment Commitment To Our Environment Contractor s Basic Responsibilities Reporting Environmental Problems Sanitary Provisions Waste Management Bins and Skips Refrigerant Gases Chemical Wastes Electrical Wastes Contaminated Wastes Metals Electrical/Transformer Oils Contaminated Soils Recycling Water Pollution Air Pollution Noise Pollution Section 5 Contact Information & Campus Maps Contact Information City East Campus Map City West Campus Map Mawson Lakes Campus Map Magill Campus Map Underdale Campus Map Whyalla Campus Map

5 Table of contents Section 6 Policies and Procedures UniSA Policies and Procedures Checklist UniSA Section 7 Forms UniSA Forms Checklist Section 8 Project Specific Information Section 9 References

6 ABOUT UNISA 1

7 The University UniSA With a growing reputation for the quality of its teaching and the national importance of its research programs, the University of South Australia has an enrolment of around 25,000 undergraduate and postgraduate students. Our students come from all over the state and other parts of Australia, from many Asian countries, from Europe and the United Kingdom, the United States and other countries. Nearly 5,000 of these are distance education students. The University moved from a faculty-based to a divisional structure in 1998 with four divisions covering the teaching areas of the University. The divisions are headed by Pro Vice Chancellors for the areas of Health Sciences; Business and Enterprise; Information Technology, Engineering and the Environment; and Education, Arts and Social Sciences. Schools and research centres are spread over five campuses (City East, City West, Magill, Mawson Lakes and Underdale) in and around the city of Adelaide and a sixth counter regional centre of Whyalla, 400 kilometres to the North-West. The Vice Chancellor as the principal responsible officer of the University of South Australia recognises that Occupational Health, Safety, Welfare and Injury Management rank equally with all other operational considerations at UniSA. The University is committed to maintaining a position of excellence in Occupational Health, Safety, Welfare and Injury Management. The Contractor must comply with the current Occupational Health Safety & Welfare Act 1986 and Regulations whilst on UniSA grounds including: UniSA OHSW&IM Policy Provision of relevant Codes of Practice, Australian Standards and Statutory Regulations. UniSA Contractors Induction Kit Information is available on the UniSA Web and relevant documentation will also be made available in hard copy format during contractual negotiations and or as part of a formal induction process. The Contractor is responsible for providing the appropriate safety training to his or her employees and must be able, if requested, to provide evidence of such training. The Contractor must provide all his or her employees with a safety induction prior to commencing work on site. Contractors Induction Kit Section 1 - November 2002 Established by an act of the South Australian Parliament on January , the University traces its history through parent institutions as far back as It has strong and expanding links with Asian countries and the number of international students at the University has risen to approximately 5,763 since the University s foundation.

8 UniSA The Contractor shall also: produce a copy of their Safety Policy including all safe systems of work statements, as required. be responsible for payment of any consequential costs ie extension of time or rework incurred that results from the adoption of unsafe work practices or the use of unsafe plant or equipment to those persons / organisations affected by such works. provide and maintain an adequate number of fire extinguishers of the correct type for all work sites. Refer AS2444 Portable fire extinguishers and fire blankets Selection and location. be responsible for providing first aid for his or her employees. University Security staff are trained in first aid and may provide assistance during an emergency. In other cases of emergency, including a building evacuation practice drill, the Contractor will accept direction from designated University personnel. (Refer to Section 6, Policies and Procedures for the UniSA Evacuation Procedure.) Permission must be obtained from the Contract Supervisor prior to the commencement of works as specified in the UniSA OHSW Contractor Management Procedure. Completion of a Contractor s Permit to Work Form OHSW27 must be authorised and includes but is not restricted to the following processes: fire services isolation working in confined spaces disconnection of services, water, gas and electrical fume cupboard clearance hot work roof access communications services PC2 and PC3 biohazard laboratories, microwave dishes Authorised personnel must be trained in all the relevant procedures. Contractors Induction Kit Section 1 - November 2002 The Contractor must identify specific areas of construction, demolition and other potentially hazardous operations where safety equipment must be used and/or personal protective clothing must be worn.

9 The Property Unit UniSA Finance & Resources Portfolio Property Unit Services Unit Finance Unit Role of the Property Unit The role of the Property Unit is to support the University in achieving its goals and objectives by ensuring it contributes to effective leadership and the efficient management of physical assets and resources used for teaching, learning, research and organisational support. The Property Unit, Services Unit and Finance Unit are part of the Finance and Resources Portfolio, managed by the Executive Director Finance and Resources. The reporting structure for these units is depicted in the organisational chart above: Statement of Strategic Intent Aligning the University s physical assets with its service delivery priorities Providing best practice stewardship of the University s physical assets and budgets Serving the community Role in quality assurance and minimisation of risk The Property Unit is the only administrative group within the University with specialised knowledge and experience related to project management, asset management, design, documentation, statutory and regulatory requirements, contract administration and financial control within the building industry. Extensive strategies are initiated to employ quality focused outcomes on behalf of UniSA. In particular, the development and implementation of Risk Management strategies through internal and external formal assessment processes are maintained. Contractors Induction Kit Section 1 - November 2002 Together we: value quality, ecological sustainability, equity, safety, campus culture and sound economic management strive to create an environment that best supports teaching, learning, research and administration through action that is: customer focused, service oriented and multi disciplinary intelligent in its use of new and emerging technologies innovative, collaborative, consultative, enterprising and flexible

10 UniSA Role in service provision The Property Unit provides University-wide services in: The provision of strategic advice related to the physical infrastructure and the dynamics of change the projection of floor space and accommodation requirements capital planning and programming preparation and maintenance of master plans for the campuses capital development of new buildings and approved floor space (including signage) maintenance of University buildings the provision of physical infrastructure to assist people with a disability project coordination the leasing of property management of external and remote sites financial management of all propertyrelated functions. Property Unit Values A professional group committed to ethical practice and personal integrity, who strive to get the right jobs done and do them well. Committed to personal development that advances team competencies and achieves Unit objectives. Consultative, co-operative and open in dealings with customers. Committed to a working environment that supports and encourages innovation and creativity. Valuing the diversity of interpersonal relationships at work as in private life. Valuing a balance between personal/family and working life and supportive of each other in achieving this. Contractors Induction Kit Section 1 - November 2002

11 GENERAL INFORMATION 2

12 Arrival on campus UniSA Contractor Management UniSA is committed to the OHSW&IM of all persons on campus and as such have developed a Contractor Management Procedure outlining the requirements of health and safety in relation to contractors working at University workplaces. (Refer Section 6, Policies and Procedures.) The intention is to minimise risks to health and safety of contractors, University staff, students and the general public from the work activities of contractors engaged to carry out work on behalf of the University. Services Isolation Before interrupting any existing services such as electricity, water, gas, telephone, data etc, the Contractor shall give at least five (5) working days notice to the Contract Supervisor describing the nature of the work to be done, the time and the expected duration of the shutdown. All interruptions shall be kept to an absolute minimum and only at such a time as has been agreed by the Contract Supervisor. Refer also Interruption of Services Section 3, OHSW&IM and Hazardous Works Isolation of Services. Arrival on Campus Prior to any work being carried out on campus, the Contract Supervisor must ensure that the Contractor is aware of all risks and hazards relevant to the worksite and associated tasks. This information is available in Section 8, Project Specific Information or as directed by the Contract Supervisor. The Contractor and Contract Supervisor are required to confirm that service isolations have been arranged and that individuals or areas affected have been advised within five (5) working days of intended works. Access / Isolation of Site The Contractor must contact the Contract Supervisor to establish which campus entrance may be used by the Contractor and their representatives for vehicle access and deliveries. Suitable drawings will also be made available to the contractor. Refer Section 8, Project Specific Information. Isolation of all works is imperative to ensure the safety of persons on campus. Isolation shall be in the form of a physical barrier, including signage to suit specified works and or as directed by the Contract Supervisor. Contractors Induction Kit Section 2 - November 2002 Contractors arriving on University grounds to attend any project work(s) must report daily to Security Services and obtain a Contractors Badge and access to the site. The Contractors Badge must be worn at all times whilst on campus. Similarly on leaving the site, the Contractor and their representatives shall report to the University Security Office and return the Contractors Badge. The Contractor is responsible to ensure at the end of each day that the site area is secure.

13 The Services Unit UniSA Role of the Services Unit The Services Unit together with other units works to provide infrastructure support for the teaching, research and learning environment for students, staff and the community. The Services Unit, Property Unit and Finance Unit are part of the Finance and Resources Portfolio, managed by the Executive Director Finance and Resources. (Refer previous organisational chart.) Statement of Strategic Intent The Services Unit exists to: Provide infrastructure support services for the teaching, research and learning environment for students, staff and the wider community that are innovative, cost effective, environmentally sustainable, income generating and ethical Create an environment in which a range of quality customer-focused services are provided with equity to staff, students and the wider community Role in Service provision The Services Unit provides University wide services in: Campus Services (Administration, Security, Site, Grounds, Engineering) cafeteria contracts car parking cleaning/waste copyright corporate photocopiers corporate postage Document Services - printing and reproduction services freedom of information inter-campus courier records management student accommodation security transportation University vehicles Contractors Induction Kit Section 1 - November 2002

14 UniSA Car Parking and Use of Vehicles on University Grounds No parking for Contractors vehicles or their representatives is available on site. The Contractor shall make separate arrangements in respect to this matter. Contractors and their personnel must observe all parking, road markings, directional and control signs within University grounds. Pedestrians always have right of way and specified speed limits on University grounds must be strictly obeyed at all times. Please refer to Contractor Parking Protocols for further site specific information. (Located in Section 6, UniSA Policies and Procedures). Parking infringement notices will be issued upon any vehicles parked illegally within University grounds by Chubb Security Services. Fines will not be waived in such circumstances Parking or driving across footpaths and grassed or landscaped areas is prohibited. In instances where the nature of works makes it essential to locate a vehicle on landscaped areas the following steps shall apply: The Contractor shall notify the Contract Supervisor of specified works within five (5) working days The Campus Facilities Manager shall advise the Contract Supervisor and or Contractor of approved pathway and location for parking. Contractors Induction Kit Section 2 - November 2002 Vehicles delivering materials and tools to the work site, and displaying a current parking permit, may park in allocated loading zones. These are not intended for all-day parking, with a general provision of 30 minutes maximum stay. Vehicles failing to display a current parking permit, or parked in an incorrect area, will receive a parking infringement notice.

15 Security Services UniSA Security is a part of Campus Services and plays a very important role University-wide, helping to provide a safe and secure work environment for employees and to protect University assets. Security operates over a 24-hour shift, seven days per week and Contractors shall follow any reasonable directive from Security Services Officers. Contacting Security Services in an Emergency Each campus has a number of strategically placed security call points and direct-link security phones that connect straight to the duty Security Officer. These call points/phones are distinguishable by use of reflex blue security signage as determined in the UniSA Campus Signage Manual. No welding or other heat or dust producing work is to be carried out in any internal area before the fire alarm detectors are isolated. It is a requirement of all such works that a Contractor s Permit To Work (Form No: OHSW27) be completed indicating any/all Hot Work activities. Failure to comply with this requirement may result in a false alarm calling out the South Australian Metropolitan Fire Service (SAMFS) and the relevant Service Provider, the cost of which will be invoiced to the Contractor. Security Services and the Contract Supervisor shall be notified of modifications to the hydrant system requiring interruption to the fire water supply not less than five (5) working days prior to the modification work taking place. Further information relating to emergency evacuation procedures can be found in Section 3, OHSW&IM and Section 6, Policies and Procedures. Contractors Induction Kit Section 2 - November 2002 When contacting Security in an emergency the following information must be provided: location of emergency, ie building, floor, room number type of emergency, and your name and extension or telephone number, if requested. Isolation of Fire & Security Alarms It is the Contractors responsibility to contact the University of South Australia s Security Services to arrange for the isolation of fire and smoke detectors and security alarms as required to prevent false alarms.

16 Contractor s Basic Responsibilities UniSA The Contractor must, so far as is reasonably practicable, provide and maintain a working environment in which people are not exposed to hazards. In particular, contractors must: ensure their own safety provide a workplace and safe system of work so that, as far as practicable, employees, students or staff are not exposed to hazards provide employees with information, instruction, training and supervision to enable them to work in a safe manner consult and cooperate with their health and safety representatives in matters related to safety and health in the workplace provide appropriate protective clothing and equipment as required by particular types of work and/or work carried out in particular locations or conditions practice good site housekeeping to minimise the risk of avoidable accidents immediately correct any hazard that they are aware of or, if unable, contact the relevant Contract Supervisor during working hours, or Security Services after hours immediately contact Emergency Services in the first instance and then Security Services for incidents that are considered serious and or life threatening Site Safety Plan Safe Work Procedures Certificates for Plan Certificate of Operations Licences ie Hot Work, Confined Space Hazard Management Procedures Reporting incidents to UniSA Compliance with Environmental Protection Agency (EPA) Code of Practice Site Safety Inspection for Construction Schedule Training Records Induction The Contractor and their subcontractors shall allow time to conduct induction and briefing sessions with the appropriate Property and or Services Unit staff on the main aspects of the Electrical, Mechanical and Hydraulics scope of work executed at Practical Completion. Supervision The Contractor must provide adequate supervision to workers to the satisfaction of UniSA. Directions and explanations given by the Principal Consultant to the Principal Contractor shall be deemed to have been given to sub-contractors and their personnel. Contractors Induction Kit Section 2 - November 2002 Contractors must instruct their employees regarding Occupational Health, Safety & Welfare matters and ensure appropriate measures are undertaken ie information and training. The Contractor must also ensure employees are familiar with their own safety plan and UniSA OHSW&IM Policy and Procedures. The Contract Supervisor may at any time request copies of such records to ensure compliance with OHSW legislation. UniSA may upon request review information relating to the Contractors OHS&W systems of work. This information may consist of any of the following: Continued Occupation The Contractor is advised that UniSA or persons authorised by the University will continue in possession and occupation of the whole of the existing building and areas adjacent to the site. The Contractor shall allow for liaison with occupants and coordinate their activities in such a manner to minimise disruption to normal operations of the building s occupants. If a situation arises where work of a disruptive or noisy nature disturbs normal activities, this work will be stopped immediately at no cost to the University.

17 UniSA Compliance may result in (but not be restricted to) delaying noisy or disruptive activities until a more suitable time and taking steps to minimise the effects of future noisy and/or disruptive activities. Safety Inspections / Breaches UniSA treats instances of safety negligence very seriously. Failure to wear protective clothing or safety equipment when it is necessary is an example of safety negligence. Another example is the incorrect use or handling of hazardous materials. Contractors are advised that the UniSA s Occupational Health, Safety and Welfare Officer may carry out periodic inspections covering all aspects of safety, of all work sites on UniSA premises. The Contractors Safety Officer shall also accompany the UniSA inspection during this process. Contractors shall take immediate remedial action on any safety hazard, defect or any other issue associated with Occupational Health, Safety & Welfare matters identified during such inspections. Contractors shall comply with any written instructions issued by the Contract Supervisor relating to Occupational Health, Safety & Welfare. If repeat incidents are observed, the Contractor may be instructed to cease work until the situation has been rectified and the work site and/or operational procedures are deemed safe. Reporting Incidents Any accident or injury that results in lost time by the Contractor s employee shall be reported immediately to the Contract Supervisor. This shall be followed up with a full written report detailing the incident, actions taken and recommendations to avoid a re-occurrence. Refer Incident Reporting and Investigation Procedure and Incident Report (Form No: OHSW9) located in Section 6, Policies & Procedures. Cleaning The Contractor shall maintain a clean site throughout the Contract Period. The Contractor shall ensure that the site is cleared of all rubbish, refuse and completed materials at the end of each day. On completion of the Contracted Works, the Contractor is required to clean and clear away from the site all debris, rubbish, surplus building materials etc to the satisfaction of the Contract Supervisor and to leave the site in a condition suitable for occupation. Should the University need to arrange additional cleaning to satisfy the requirements of this clause, the Contractor will be invoiced. Publicity & Advertising Publicity, construction signboards and advertising by the Contractor or subcontractors in relation to the Contracted Works is not permitted. Information, publication, documentation or article for publication in any media relating to the work under contract will not be permitted without prior approval of the Contract Supervisor. Contractors Induction Kit Section 2 - November 2002

18 UniSA Smoke-Free Work Environment UniSA operates in a Smoke-Free environment. Smoking is prohibited in: University buildings, (including those leased by the University for University purposes) areas adjacent to University buildings where tobacco smoke may accumulate or drift back into buildings, such as doorways, vestibules, proximity to windows or air conditioning intakes, and University vehicles. The sale or advertisement of tobacco products is prohibited in and on University premises. Independent contractors and hirers of University facilities are required to adhere to the UniSA Smoke-Free Work Environment Procedure. (Refer Section 6 Policies and Procedures.) Equal Opportunity & Sexual Harassment The Contractor must ensure that their conduct and that of their subcontractors during the Contracted Works does not compromise or infringe the rights of the University s staff and students in accordance with the Equal Opportunity Act 1984, and its amendments and the University s Sexual Harassment Policy and Grievances Procedure. (Refer Section 6, Policies and Procedures, UniSA Equal Opportunity Discrimination and Harassment Complaint Procedure.) Ethical Standards Contractors are required to note that it is the expectation of the University that its relationship with the Contractor is based on, among other things, ethical standards that are above reproach. A copy of the University s Code of Ethical Conduct is appended in Section 6, Policies and Procedures. It is expected that any Contractor conducting business with UniSA would share and promote similar standards, for mutual benefit. Contractors Induction Kit Section 2 - November 2002 Inappropriate Language and Harassing Behaviour Inappropriate language and harassing behaviour of any nature are unacceptable and will not be condoned on campus. Offensive behaviour and/or language includes all behaviour that reinforces inappropriate, demeaning or discriminatory attitudes or assumptions about persons based on race, sex, sexual orientation, transgender status, marital status or disability. In the event of any evidence being presented that ethical standards have been compromised, the university reserves the right to take all necessary action, including legal, to sever existing arrangements with the Contractor concerned.

19 OCCUPATIONAL HEALTH, SAFETY, WELFARE AND INJURY MANAGEMENT 3

20 Restricted Areas UniSA The Contractor shall advise the Contract Supervisor of entry requirements to a restricted area no less than five (5) working days prior to commencement of intended works. Restricted areas may include but are not restricted to: PC2 and PC3 biohazard laboratories Chemical stores Radiation stores Biohazard rooms Microwave dishes Non-ionising radiation risk (Refer Standard Operating Procedure) High voltage substations Roof access Contractors or their employees must not enter a restricted area (refer signage examples) without permission from the Contract Supervisor, Campus Facilities Manager and or Senior Academic responsible for that area. Before work proceeds in a restricted area, the relevant UniSA personnel will provide specialist advice on requirements for entry and work procedures ie School Safety Manual or Rules of Entry etc. It is imperative that standard operating procedures are followed by Contractors requiring roof access and or are working in close proximity to microwave dishes. Information Strategy and Technology Services (ISTS) or the Contract Supervisor will provide copies of the standard operating procedures for works on a project by project basis. The location of said microwave dishes will also be provided in Section 8, Project Specific Information if relevant to the project. The Contractor must obtain written permission prior to accessing any high voltage sub-station and shall abide by the following criteria: Obtain a Contractors Permit to Work (Form No: OHSW27) from the Contract Supervisor Regulations under The Electricity Act 1996 AS3000 Wiring Rules Occupational Health, Safety and Welfare Regulations 1995, Division 2.5 Electrical Electrical Workers and Contractors Licensing Act, 1965 All electrical work completed by a Contractor shall have an Electrical Certificate of Compliance completed and forwarded to the Contract Supervisor. Isolation of Fume Cupboards Fume Cupboards or chemical store ventilation may only be isolated by prior arrangement with the Campus Facilities Manager. Fume extraction fans must not be isolated before all affected laboratory fume hoods are tagged / locked out to prevent their use. The Contract Supervisor and Contractor(s) must personally confirm that they are about to start work on a fume hood system. The Contract Supervisor will advise if standard operating procedures for Roof Access apply to specified works. Refer Section 6, Policies and Procedures and Section 8, Project Specific Information if required. The Contractor shall advise the Contractor Supervisor of isolation requirements no less than five (5) working days prior to commencement of intended works. Approval must be confirmed before access is granted. Contractors Induction Kit Section 3 - November 2002

21 Safety Issues UniSA Safety Signage Safety signage is placed on the University campuses to protect the health and safety of University staff and visitors. Safety signs of different colours and shapes mean different things. Examples of such safety signage are indicated below. Signage used by Contractors shall comply with AS1319 Safety signs for the occupational environment. Examples of some safety signage is provided below: A yellow triangle warns of a danger, or risk to health. Caution Risk of Fire Contractors Induction Kit Section 3 - November 2002 A red circle with a line through it indicates activities that are forbidden in the designated areas. Caution Risk of Ionising Radiation No Admittance No Smoking Caution Toxic Hazard

22 UniSA Safety Equipment All Contractors and their employees shall make themselves aware of specific areas of construction, demolition and other potentially hazardous operations where safety equipment and/or personal protective clothing shall be provided and worn. Contractors shall provide all necessary personal protective equipment and ensure such items are worn when necessary and to comply with OHS&W Regulations 1995, Division 2.12 Personal Protection. Safety Gloves A blue sign indicates that appropriate safety equipment must be worn, depending on the nature of work undertaken and the hazards involved. Safety Boots Contractors Induction Kit Section 3 - November 2002 Eye Protection Protective Clothing Hard Hat Face Shield Respirator Contractors will ensure that safety barriers are erected for all site works to keep unauthorised persons out of the work area. Safety barriers will be maintained in a good condition at all times and may include but not be restricted to such items as a waterfilled barrier, signage and lighting.

23 Other OHSW&IM issues UniSA Comfort & Safety Where work is arranged within existing buildings, the work shall be arranged to minimise nuisance to the occupants and to ensure their safety at all times. This provision shall include protection against weather, dust, water, fumes or other nuisances, by means of temporary screens, exhaust equipment or other measures, as may be deemed necessary and to the approval of the Contract Supervisor. Facilities All Contractors shall provide amenities and First Aid equipment in accordance with Occupational Health Safety & Welfare provisions of the Construction Safety Regulations, prior to undertaking work on any UniSA campus. Enforcement Notices A Contractor shall immediately inform the Contract Supervisor in the event of either an improvement, prohibition or Default Notice being issued. No extension of time will be granted where a Notice has been issued due to the Contractor s negligence. Manual Handling All manual handling tasks must be assessed and reasonable steps taken to ensure that risks identified will not cause injury. Pursuant to Subsection 63 (1) South Australian OHS&W Act 1986, the Approved Code of Practice for Manual Handling must be complied with at all times. Noise Levels Noise from equipment being used must not exceed prescribed levels for hearing conservation or recommended levels for areas of occupancy. Where high noise levels are expected to be produced by certain operations, consideration must be given to carrying out the process during a time outside normal occupancy times. Adherence to the following standards and codes of practice must apply in the workplace: OHS&W Regulations 1995, Division 2.10 Noise AS1270 Acoustics hearing protectors (Approved Code of Practice) Additional information may also be obtained by referencing WorkCover Guidelines for Control of Workplace Noise. Use of Hazardous Substances The use of any chemicals for work carried out on or around University grounds must be approved by the Contract Supervisor prior to commencement. Current Material Safety Data Sheets (MSDS) for all hazardous substance used on campus must be present at all times and stored in a manner which ensures that they are readily available to workers and for use in the event of an emergency. All chemicals shall be used in accordance with OHS&W Regulations 1995, Part 4 Hazardous Substances. Contractors Induction Kit Section 3 - November 2002 Motors and Machinery The use of stationery internal combustion engines is not permitted in buildings or enclosed areas unless an attached extraction unit is operating and capable of ensuring that no residue fumes remain in the area. Caution must be exercised when positioning the extraction system to ensure that fumes are not drawn into air handling or air conditioning intakes.

24 UniSA Use of Hazardous Materials The Contractor must submit a Material Safety Data Sheet (MSDS) for each hazardous substance that is to be brought onto University grounds, and maintain a copy at the work site. All hazardous materials brought onto University grounds must be clearly labelled, and safe handling and storage instructions as outlined on the product labels must be complied with at all times. Chemicals must be stored in reliable, tightly sealed containers and must be stored indoors on an impervious floor with enough bunding to contain any spill. If chemical storage is short term, the Contract Supervisor or Security Services must be contacted for approval of outdoor storage. Clean-up materials must be provided in case of spillages. Liquid spills may be mopped up with rags, sawdust or commercially available absorbent products. The Contractor must ensure that the cleanup materials are appropriate for the chemicals used and that at least one person on the site at any time is trained to clean up a spill. This includes ensuring an adequate supply of clean-up materials is available and easily accessible at all times. Chemical Spills In the event of a chemical spill, the following steps should be observed: 1. Contain the spill if it is safe to do so prevent further spillage contain what has been spilt follow MSDS information block stormwater drain inlets 2. Report the spill inform the Contract Supervisor and or Security Services immediately (Refer Contact List in Section 5, Contact Information and Campus Maps in case of a large or dangerous spill, contact the Fire Brigade on 000 (or 0 followed by 000 if using a University phone) 3. Clean up clean up shall be conducted by a competent person(s) with knowledge of spilled substance clean up as quickly as possible to reduce the risk of pollution beyond the site DO NOT wash chemicals or other hazardous substances down the drain (either inside or outside), or pour chemicals onto the ground use absorbent material to contain the spill wrap up used absorbent material and dispose of in general waste bins, or as directed by instructions on the product label or in the product Material Safety Data Sheet (MSDS). Hazardous or Dangerous Materials If the Contractor should become aware of any of the following hazardous materials impacting on the works that is not scheduled for removal, the Contractor shall immediately cease work and notify the Principal Consultant and the Contract Supervisor immediately: Asbestos Flammable or explosive liquids or gases Toxic, infective or contaminated materials Radiation from radioactive materials Noxious or explosive chemicals Tanks or other containers which have been used for storage of explosive, toxic, infective or contaminated substances Contractors Induction Kit Section 3 - November 2002

25 UniSA Copies of the Asbestos Register & Asbestos Management Policy are located on the Property Unit website. Please refer to Section 3 Hazardous Works, Asbestos, and Section 6 Policies and Procedures for further information. The Contract Supervisor should be contacted for any specific asbestos information. Storage of Materials The Contractor is responsible for providing safe, adequate storage on site for all unfixed materials and equipment. Should items become lost or damaged, the Contractor shall be responsible to replace with an identical item without cost to the University. Salvaged Materials Unless otherwise specified or directed by the Property Unit, materials, plant, equipment and other items salvaged from the Works shall become the property of the University. Where possible, the Contractor shall nominate a Site Warden. In instances where the Contractor has not nominated a Site Warden, Security Services personnel shall act in this capacity. The Contract Supervisor shall be advised prior to the first site meeting of the name and contact details of the Site Warden. It shall be the Site Warden s responsibility to check the site area(s) in the event of a fire alarm to ensure that the Contractor s representatives have evacuated the area, in accordance with UniSA Emergency Evacuation Procedures. (Refer Section 6, Policies and Procedures.) Security (all hours) free call. Internal, all campuses City East City West Magill Mawson Lakes Underdale Whyalla (08) Contractors Induction Kit Section 3 - November 2002 Fire Evacuation Procedures In the event of the fire alarm sounding, the Contractor and their representatives must evacuate the site, following exit signage and the directions of UniSA s Fire Wardens to the assembly point nominated. Contractors shall also be provided with campus/building plans indicating evacuation areas in case of emergency. Refer Section, Contact Information and Campus Maps. The contractor s representatives must not re-enter the building until advised by the Fire Wardens that it is safe to do so. It is the Contract Supervisor s responsibility to ensure that all contractors and their employees are advised of the UniSA Emergency Evacuation Procedures. (Refer Section 6, Policies and Procedures.) This does not dissolve the responsibility of the Contractor to ensure employees are provided with adequate information in relation to emergency evacuation procedures. Fire Extinguishers In some cases where contractors are required to provide fire extinguishers they shall comply with AS1841 Portable fire extinguishers. Supply and installation shall meet AS2444 Portable fire extinguishers and fire blankets. Fire extinguishers need to be regularly inspected and maintained in accordance with AS1851 Maintenance of fire protection equipment Portable fire extinguishers and fire blankets. Located in University buildings, fire extinguishers and associated hose reels are identifiable by triangular signs in the corridors. Fire extinguisher types shall be used to suit intended purpose. To allow for instant recognition of the most suitable fire extinguisher, identification discs are displayed on the can to indicate the particular types of fire it can be used on.

26 Equipment, Plant and Tools UniSA Maintenance of Equipment, Plant and Tools Contractors shall conform to the OHS&W Regulations 1995, Part 3 Plant and relevant Australian Standards for all plant, equipment and tools used on UniSA campuses. Scaffolding and Hoardings Contractors shall ensure that all scaffolding on any UniSA campus is erected and maintained in accordance with and comply to: OHS&W Regulations 1995, Division Scaffolds AS1576 Scaffolding General requirements (Approved Code of Practice) AS1577 Scaffold Planks (Approved Code of Practice) Electrical All hand held electrical appliances must be operated and maintained in accordance with OHS&W Regulations 1995, Division 2.5 Electrical, Residual Current Devices (RCD s). All extension leads, power tools and associated portable electrical equipment must have a current test tag attached prior to use on any University site. Use of reduced plugs by filing from 15amp plugs to fit 10amp is strictly prohibited. Electrical equipment includes: Portable, hand held and stationary appliances, designed for connection to the low voltage (greater than 50 Volts) supply by a flexible cord; cord extension sets and Electrical Portable Outlet Devices (epods-power Boards) Flexible cords connected to fixed equipment in certain environments Portable isolation transformers Residual Current Devices (rcds) portable type (PRCD), socket type outlet and fixed switchboard type Unless double insulated, all electrical equipment is to be connected to an approved Residual Current Device (RCD). Electrical leads must: be tested and tagged in accordance with statutory requirements be supported clear of floors or under protective covers, and connected to the nearest power outlet be removed from the power outlet when not in use not pass through doorways unprotected or use piggyback lead and double adaptors Contractors must comply with the following electrical standards, legislation, guidelines and statutory requirements: OHSW Regulations 1995, Division 2.5 Electrical AS3760 In-Service safety inspection and testing of electrical equipment NOHSC Safety Guidelines for Electrical Workers (1994) NOHSC Electrical Safety for Construction Work (1993) UniSA OHSW Procedure - Energy Isolation Tags and Lock-Off UniSA OHSW Procedure - Electrical Equipment Inspection and Testing Electrical Welding A UniSA Contractors Permit To Work (Form No: OHSW27) must be approved by the Contract Supervisor prior to any hot work procedures being conducted on campus. Appropriate warning signage must be displayed and aprons, leather sleeves, gauntlet gloves, eye protection, welding spats (or flame-proof overalls) must be worn by welders and assistants where there is danger of injury from hot material. Insulated footwear must be worn by welders when working in places so damp that danger of electric shock exists. Welding screens must be used to prevent sparks from flying into adjacent areas, and to screen other workers. Contractors Induction Kit Section 3 - November 2002

27 UniSA Any person conducting or assisting in electrical welding procedures must be a competent person experienced in that area of work. UniSA may as part of their internal auditing processes request a copy of current training records to ensure compliance of this requirement. Welding cables must be inspected weekly and maintained in good condition. Particular care must be taken to ensure that there are no bare wires, and to ensure that connections are solidly made so that no sparking or hot spots occur. Contractors will ensure that satisfactory safety barriers are erected and maintained in good condition for all electrical welding works to keep unauthorised persons out of the work area. Machine Guarding All hand tools, machinery or other equipment must be operated with effective guards. Non-guarded equipment must be removed from the work site and stored in a safe location. Contractors must comply with the following documentation: OHSW Regulations 1995, Part 3 Plant AS Safe guarding of machinery General principles UniSA OHSW Procedure - Energy Isolation Tags and Lock-Off Hand Tools Tools such as picks, shovels, axes, crowbars, hammers, wrenches, files, screwdrivers and similar must be checked regularly. Where damaged or defected tools are present, these items must be removed from site and repaired or disposed of in an appropriate manner. An Out-Of-Service Tag must be placed on all hand tools that do not conform to safety standards. An example of said tags is provided in the following pages of this document. Refer UniSA OHSW Procedure Energy Isolation Tags and Lock-Off. Use of an approved wrist-stop or lanyard to secure the tool shall be used if there is a risk of it falling and injuring people below. Lasers Lasers may only be used by licenced persons. Lasers must be used with the following precautions: Up to Class 3A only to be used on the construction site Positioned so as not to be at eye level of employees in the area Warning signs must be erected Contractors Induction Kit Section 3 - November 2002

28 UniSA Explosive Power Tools All explosive charges for explosive powered tools must be kept in an approved, locked box. All operators of explosive powered tools must be qualified as required by statutory authorities. A warning sign must be displayed at each location the tools are used. Suitable protection must be worn when using the tools. Wear suitable eye protection to guard against airborne substances; ear protection where excessive noise is likely to occur and/or respiratory protection where dust is present. Never, under any circumstances, should a just of air be directed towards the body of any person. Contractors Induction Kit Section 3 - November 2002 Mobile Mechanical Plant All mobile equipment such as front-end loaders, dozers, backhoes, forklifts, etc, must be have keys removed, blades and buckets lowered onto the ground and must be chocked/blocked when not in use. Compressed Air Equipment Always use care when working with compressed air. If compressed air enters the blood stream through a break in the skin it can be fatal. This equipment includes scabblers, water/airjets, impact wrenches, grinding tools, etc.

29 UniSA Danger and Out of Service tags Contractors must ensure that they and their employees use appropriate tagging systems where applicable. Refer UniSA OHSW Procedures as follows: UniSA OHSW Procedure - Energy Isolation Tags and Lock-Off UniSA OHSW Procedure - Electrical Equipment Inspection and Testing The following is an example of a Danger Tag. Contractors Induction Kit Section 3 - November 2002 The following is an example of a Out of Service Tag.

30 UniSA Barricades and Fencing To ensure the safety of all persons on the work site or passing by, Contractors must supply and erect any necessary barricades and fencing including signage appropriate to the work they are undertaking. Particular care must be taken to check and secure the barricades and fences whenever contract staff leave the work area. This may include providing temporary lighting on the site, if deemed necessary by the Contractor or if directed by the Contract Supervisor. Interruption of Services Where a Contractor s work involves a requirement to isolate energy services (electricity, gas, telephone, communications, or water supply) to all or part of a building; or part of a campus, appropriate notice of no less than five (5) working days must be given to the Contract Supervisor to ensure affected University staff can be advised in a timely fashion. Should services be shut down accidentally, the Contractor must advise the Contract Supervisor and Security Services immediately. Refer also Services Isolation, Section 2, General Information and Section 3 OHSW&IM Hazardous Works, Isolation of Services. Contractors Induction Kit Section 3 - November 2002

31 Hazardous Works UniSA Asbestos The University of South Australia has an ongoing commitment to the identification and removal of asbestos and asbestos products from its premises. Contractors shall refer to OHSW Regulations 1995, and UniSA Asbestos Management Policy for Policy and Standard Operating Procedures in the event where asbestos is identified on a working site. The Property Unit, on behalf of UniSA manages the development and maintenance of the UniSA Asbestos Management Policy and campus based Asbestos Register. The Asbestos Register is a working document and therefore is constantly being updated. Information relating to asbestos included in this kit will be the most current available and will be specific to the campus or area of a campus where the Contractor has been engaged to undertake works. This information will be provided as applicable under Section 8, Project Specific Information. It is the responsibility of the Contractor to ensure that up-to-date information is available for their employees prior to any works being conducted in relation to asbestos. In the event that asbestos material not previously identified in documentation provided is found in the course of works being undertaken, the Contractor must cease work around the area where asbestos is suspected to be present and must immediately advise the Contracts Manager: Maintenance who will take appropriate action. Drilling, cutting, removing or modifying asbestos products is governed by strict Workplace Services guidelines and must not be undertaken without the prior approval of the Property Unit. Trenching and Excavation Any excavation work on University grounds must be carried out in accordance with the provisions of the Occupational Health, Safety & Welfare Regulations, 1995 Division 5.5 Excavation Work. All trenches over 1.5 meters in depth must be protected against collapse, and handrails or barricades must be erected around the trench and kept in place at all times. Trenching works shall comply with SA Water Corporation Booklet: Trenching and Ground Support Systems. A freecall number is available to assist with trenching and ground support systems. Further assistance may be obtained from the Dial Before You Dig Hotline on Telephone Number : Underground surveys should be undertaken by the Contractor unless otherwise specified by the Contract Supervisor to identify any underground obstacles, prior to commencing excavation. Any underground obstacles identified must be brought to the attention of the Contract Supervisor before proceeding with the work, to assess the necessary course of action. Isolation of Services When undertaking work that requires trenching or excavation, the Contractor must: seek approval from the Contract Supervisor before commencing trenching or excavation to ensure identification of underground services ensure careful checking of trenching and excavation work areas to ensure that the safety measures taken comply with statutory requirements Contractors Induction Kit Section 3 - November 2002

32 UniSA When undertaking work that requires trenching or excavation, the Contract Supervisor must: formally notify Contractor of any underground services include identified underground installations and or obstacles as part of the contract in as built drawings provided to the Contract Supervisor on completion of the work As noted in Services Isolation, Section 2 General Information, and Section 3, OHSW&IM Interruption of Services, any instances where emergency shut off is required, the Contractor shall contact Security Services and the Contract Supervisor to advise of situation. Working in Confined Spaces Confined space is defined as an enclosed or partially enclosed space which: is at atmospheric pressure during occupancy; is not intended or designed primarily as a place of work may have restricted means for entry and exist; and may: have an atmosphere which contains potentially harmful levels of contaminant; not have a safe oxygen level; or cause engulfment Confined spaces may include but are not limited to: Storage tanks, tanks cars, process vessels, boilers, pressure vessels, silos and other tank-like compartments; Open-topped spaces such as pits or degreasers; Pipes, sewers, shafts, ducts and similar structures; and Any shipboard spaces entered through a small hatchway or access point, cargo tanks, cellular double bottom tanks, duct keels, ballast and oil tanks, and void spaces, but not including dry cargo holds When working in confined spaces, Contractors and their employees must comply with OHS&W Regulations 1995, Division 2.4 Confined Spaces. Particular emphasis is placed on risk assessment, control of risks, entry permits, rescue arrangements and training and competency. Other areas of compliance include: AS/NZS 2865 Safe Working in a confined space (Approved Code of Practice) UniSA OHSW Procedure Confined Space Entry UniSA OHSW Procedure Record Keeping The Contractor must ensure that all staff working in or on confined space are trained to meet safety standards and will be required by the University to provide proof of training. When working in enclosed areas, care should be taken to ventilate the area well if petrol or diesel motor driven equipment is being used. The Contractor must ensure that fume evacuation, airflow and exchanges of air are maintained. Confined space gas detection equipment must be used to test the environment. Contractors Induction Kit Section 3 - November 2002

33 UniSA Suitable personal protective equipment (PPE) shall be used if entering a confined space with unsafe atmospheric levels. Refer AS1715 Selection, use and maintenance of respiratory protective devices and AS1716 Respiratory protective devices. Continuous ventilation testing units shall be in place at all times during confined space entry. The Property Unit is responsible for identifying all confined spaces and maintains a register of confined spaces and subsequent risk assessments. Copies of confined space permits and hot work permits can be obtained by contacting your Contract Supervisor who will arrange allocation of permits by an authorised competent person. Copies of all permits are kept in accordance with the UniSA OHSW Record Keeping Procedure. The Contractor shall contact the Services Unit to apply for Confined Space Entry prior to commencement of works for the following categories: Restricted Areas: a space that with respect to atmospheric hazards has minimal potential to contain a hazard capable of causing death or serious physical harm. Examples of Restricted Area category confined spaces are plant rooms and electrical distribution rooms and like spaces. Entry is permitted by competent persons without a permit when carrying out inspection and emergency type work only. Confined Space Entry Permit - Low- Risk (Form No: OHSW36): a space that, with respect to atmospheric hazards, has been assessed as having a LOW potential to contain a hazard capable of causing death or serious harm. Examples of Low Risk confined spaces are, tunnel areas (sections with forced ventilation), ceiling spaces (with various ceiling tiles removed), service ducts (with ventilation) and the like. Confined Space Entry Permit - High Risk (Form No: OHSW37): a space that, with respect to atmospheric hazards, has been assessed as having a HIGH potential to contain a hazard capable of causing death or serious harm. Examples of HIGH Risk confined spaces are, sump pump pits, pressure vessels, air receivers, air conditioning air handling filter units, storm water roadside entry pits and the like. Hot Work Authorisation must be obtained from the Contract Supervisor five (5) working days prior to commencing any hot work such as welding, brazing or removal of paint by heat gun or burner. Adequate fire protection must be present, with suitable fire extinguishers attached to, or near each welding plant. Welders must use screens to protect all personnel from welding flashes and any hot waste produced during the welding process. Workers undertaking the welding should wear the correct personal protective equipment. The Contractors Permit to Work (Form No: OHSW27) must specify and approve Hot Work processes being conducted by the contractor. Hot work being conducted in or on an occupied confined space requires an additional Hot Work Permit For Confined Spaces (Form No: OHSW38). Refer OHSW Procedure - Confined Space Entry. Contractors Induction Kit Section 3 - November 2002

34 OUR ENVIRONMENT 4

35 Our Environment UniSA The Environment Protection Act governs environment protection where the effects on land, air and water are considered simultaneously. This legislation is the result of the streamlined integration of six Acts of Parliament and the abolition of the associated statutory authorities. Copies of legislation, regulations and policies under the EP Act are available at Other information available on this website includes but is not restricted to: Codes of Practice and Guidelines Technical Bulletins Consultancy Reports Information Sheets Other Links Commitment To Our Environment A commitment by UniSA has been made to the Commonwealth Greenhouse Challenge Program which is a voluntary program targeted at businesses and aimed at improving energy efficiency, environmental credentials and developing a competitive advantage through better business performance. In addition, the Property Unit has developed Sustainable Development Guidelines to define overall objectives, strategies and targets that outline UniSA's expectations for consultants and contractors involved in project and programs. This information is located at and is is also included in the Design and Construction Guidelines. Contractor s Basic Responsibilities Each individual has a duty of care towards the environment, which entails due diligence. Due diligence means that employers and employees alike need to: take all reasonable steps to prevent pollution and protect the environment show that everything that could have been done to prevent an incident from happening, has been done ensure that all necessary pollution control measures are in place and are regularly checked and maintained to minimise the risk of an environmental incident. Individuals and Corporations may be fined or imprisoned for up to seven (7) years, for seriously polluting the environment. Smaller incidents of environmental pollution can incur fines and or penalties by littering or accidentally polluting the environment. In these instances, ignorance is not considered to be an excuse. Contractors working on University grounds are required to comply with all legislative requirements in this area. Reporting Environmental Problems Under Section 25, of the Environmental Protection Act the following information applies to general environmental duty: (1) A person must not undertake an activity that pollutes, or might pollute, the environment unless the person takes all reasonable and practicable measures to prevent or minimise any resulting environmental harm. (2) In determining what measures are required to be taken under subsection (1), regard is to be had, amongst other things, to- (a) the nature of the pollution or potential pollution and the sensitivity of the receiving environment; and (b) the financial implications of the various measures that might be taken as those implications relate to the class of persons undertaking activities of the same or a similar kind; and Contractors Induction Kit Section 4 - November 2002

36 UniSA (c) the current state of technical knowledge and likelihood of successful application of the various measures that might be taken. (3) In any proceedings (civil or criminal), where it is alleged that a person failed to comply with the duty under this section by polluting the environment, it will be a defence- (a) if- (i) maximum pollution levels were fixed for the particular pollutant and form of pollution concerned by mandatory provisions of an environment protection policy or conditions of an environmental authorisation held by the person, or both; and (ii) it is proved that the person did not by so polluting the environment contravene the mandatory provisions or conditions; or (b) if- (i) an environment protection policy or conditions of an environmental authorisation provided that compliance with specified provisions of the policy or with specified conditions of the authorisation would satisfy the duty under this section in relation to the form of pollution concerned; and (ii) it is proved that the person complied with the provisions or with such conditions of an environmental authorisation held by the person. (4) Failure to comply with the duty under this section does not of itself constitute an offence, but- (a) compliance with the duty may be enforced by the issuing of an environment protection order; and (b) a clean-up order or clean-up authorisation may be issued, or an order may be made by the Environment Resources and Development Court under Part 11, in respect of non-compliance with the duty. In addition, to assist in the minimisation of harm to health and or the environment: Contractors are required to immediately notify the Contract Supervisor of any incidents that may cause environmental harm (eg chemical spills, oil leaks). In case of after hours emergencies Security Services should be contacted immediately. Containment kits suitable to contracted works shall be provided by the contractor for immediate environmental safety response. Contractors Induction Kit Section 4 - November 2002

37 UniSA Sanitary Provisions The Contractor shall have shared access to toilets on the campus on which the Works are being executed. The Contractor shall note these toilets will continue to be used by the wider University community. Consequently, the Contractor shall be responsible for using and maintaining these toilets in an appropriate and clean manner. Bins and Skips The Contractor is responsible for the supply and removal of bins/skips used specifically for the removal of debris and materials associated with the Works. A suitable location shall be coordinated with the Contract Supervisor at the relevant campus. Bins shall not restrict traffic in carriageways and must be illuminated at night. Waste Management The disposal of waste on University grounds is expressly forbidden. University rubbish bins must not be used for the disposal of construction and demolition waste. The University strongly encourages all contractors and employees to identify waste minimisation options at the start of each job by: working out costs and savings involved in minimising waste avoiding over-ordering of materials ensuring that subcontractors are aware of their responsibilities with regard to waste disposal recycling materials where possible purchasing materials with minimum packaging, or ask suppliers to accept their packaging back There are many opportunities for waste reduction and contractors should encourage their employees to adopt a team approach to this and to raise awareness as much as possible. Debris must not be stored within stairs, passages or exits. All debris shall be removed from the site and placed in bins/skips. The Contractor is to ensure the site is kept clean and tidy and bins are emptied on a regular basis. An industrial rubbish skip is required on most work sites. However, these skips should only be used for materials that cannot be recycled. Skips must have a lid in place when they are not being used, to prevent the rubbish from being blown away and to minimise any rainwater accumulating in the bin. Refrigerant Gases It is the contractor s responsibility to ensure that refrigerant gases are treated with appropriate caution to avoid contaminating the environment. Refrigerant gases must not be released into the atmosphere; they should be collected in specially sealed cylinders by a licensed disposal operator. Refer to the following Australian Standard and Code of Practice for further information: AS Gas recovery or combined recovery and recycling equipment Fluorocarbon refrigerants from commercial/domestic refrigeration and airconditioning systems HB40.1 The Australian Refrigeration and Airconditioning Code of Good Practice Reduction of emissions of fluorocarbon refrigerants in commercial and industrial refrigeration and airconditioning applications Contractors Induction Kit Section 4 - November 2002

38 UniSA Chemical Wastes Any chemical wastes must be stored in their original packaging and care must be taken to ensure that the containers are properly sealed. Chemical wastes must be disposed of by licensed disposal operators. Refer Ozone Protection Act It is expressly forbidden for chemical wastes to be tipped into sinks, onto the ground, or into sewers or stormwater drains ie paint, thinners, chemicals, paints, solvents detergents, oils etc. Metals Materials such as iron, steel, copper and lead must be disposed of only by licensed disposal contractors. Advice should be sought from the contractors with regard to correct labelling, packaging and storing of lead. Electrical / Transformer Oils These oils must be stored in special containers issued by licensed waste disposal companies. The containers must be collected only by such disposal companies. Electrical Wastes Electrical cables, fuses, devices such as switches and similar material must be disposed of by a licensed contractor. Contaminated Wastes Any pathological, biological and clinical wastes and sharps must be stored in purpose-built, specifically labelled, bright yellow contaminated waste bins. These bins must be serviced only by licensed hazardous waste contractors. It is expressly forbidden to dispose of oils by pouring down sinks, onto the ground, or into stormwater drains. Contaminated Soils Soil may become contaminated with oils, asbestos, cyanide, heavy metals or other toxic material. In the event when such contamination occurs or is discovered by a contractor, the contractor should inform the Contract Supervisor, so that the services of a licensed disposal contractor may be engaged for its safe removal. Contractors Induction Kit Section 4 - November 2002 It is expressly forbidden to dispose of contaminated waste in general purpose or recycling rubbish bins. For assistance in siting contaminated waste bins, contact the Contract Supervisor or Security Services. Soil must not be removed from University grounds without the prior approval of the Contract Supervisor. Recycling The University strongly encourages the recycling of appropriate materials, such as aluminium cans, glass and plastic, as well as paper and cardboard. Recycling bins for some materials are provided on each campus. Water Pollution It is against the law to place any material (other than clean water) in a position where it is likely to leak, fall or be blown into any drain or gutter that is used to collect rainwater.

39 UniSA Allowing this to occur may result in on-thespot fines or legal proceedings against businesses or individuals, by the Environmental Protection Authority (EPA) whether the pollution was accidental or not. To prevent this from happening, the footpath and gutter around the work site should be kept free of litter, soil and sand, particularly at the close of each working day. Litter, leaves or other debris should never be swept into drains or gutters and rubbish bins should be kept covered. Exhaust fumes - if a vehicle or a piece of machinery emits visible exhaust fumes continuously for 10 seconds, the owner is liable to incur an infringement notice from the Environmental Protection Authority (EPA). Vehicles and machinery should be regularly serviced so that air pollution emissions are kept to a minimum. Noise Pollution The University is a place of learning and research and the environment on campus must remain conducive to these and related activities at all times. Air Pollution Dust on and around a work site can cause health problems for workers and others on the campus. If a work site is generating dust, contractors should ensure that materials and stockpiles that are generating dust are kept covered sweepings are placed into bags or boxes and sealed before disposing of them into a skip to prevent dust from becoming airborne when the skip is emptied appropriate protective is worn by workers, such as face masks or respirators. Solvents release polluting vapours when containers are open. To prevent this from occurring, contractors should ensure that solvent containers are always sealed with a tight lid biodegradable or water-based products are used wherever possible. Fires must never be lit on University grounds. In the unusual situation where it is considered necessary to light a fire, this must only occur with the prior approval of the Contract Supervisor. The Contractor shall allow in their tender and include in their program for the following: noisy work may be defined for the purposed of this clause as noise, which results in a noise level exceeding 50dB within adjacent rooms unless otherwise advised, the Contractor shall ensure that noisy work associated with construction of the Works is conducted before 9:00 am or after 5:30 PM Monday to Friday the Contractor shall advise the Proprietor a minimum of 24 hours in advance of any noisy work to be scheduled the use of sound systems such as radios, CD players, recorded music or loud hailers on site is not permitted fitting of noise suppressors to machinery and ensuring regular maintenance programs are in place ensure that appropriate protective equipment is worn in a noisy working environment Contractors Induction Kit Section 4 - November 2002

40 CONTACT INFORMATION & CAMPUS MAPS 5

41 Contact information UniSA Emergency 000 Hospitals Royal Adelaide Hospital (08) Queen Elizabeth Hospital (08) University wide Lyell McEwin Hospital (08) Security Flinders Hospital (08) Property Unit Modbury Hospital (08) Services Unit City East Campus City West Campus Security Security Project Manager Project Manager Manager, Campus Services Manager, Campus Services Team Leader Team Leader Magill Campus Mawson Lakes Campus Security Security Project Manager Project Manager Campus Facilities Manager Campus Facilities Manager Team Leader Team Leader Underdale Campus Whyalla Campus Security Security Project Manager Project Manager Campus Facilities Manager Campus Services Manager Team Leader Contractors Induction Kit Section 5 - November 2002 Alternatively dial Security (all hours) (free call) Other Important Numbers: * Important note: When placing a call from a University telephone, 0 must be dialled in front of any external number to obtain an outside line. Internal University extensions can be called by dialling the last five (5) digits of the full number. As part of your induction process to each campus for the University of South Australia, information will be provided on the location of Security Phones and Call boxes.

42 UniSA Contractors Induction Kit Section 5 - November 2002

43 UniSA Contractors Induction Kit Section 5 - November 2002

44 UniSA Contractors Induction Kit Section 5 - November 2002

45 UniSA Contractors Induction Kit Section 5 - November 2002

46 UniSA Contractors Induction Kit Section 5 - November 2002

47 UniSA Contractors Induction Kit Section 5 - November 2002

48 POLICIES AND PROCEDURES 6

49 UniSA Policies and Procedures UniSA Document Document Title/Reference Number Approval Date Attached Yes/No OHSW&IM Procedures and Guidelines Action Plans 10 Dec 2001 Yes No Action plan performance review 10 Dec 2001 Yes No Auditing 15 Jan 2002 Yes No Children on campus 15 April 2002 Yes No Climatic conditions affecting work 14 April 2002 Yes No Communicable diseases 14 April 2002 Yes No Confined space entry 07 April 2002 Yes No Consultation/OHSW committee 07 April 2002 Yes No Contractor Management 11 Mar 2002 Yes No Critical Incident Management 20 Mar 2002 Yes No Design and construction of new and refurbished buildings 07 Apr 2002 Yes No Driving vehicles while working 14 Apr 2002 Yes No Drug and Alcohol 02 May 2002 Yes No Election of health and safety representatives 15 Jan 2002 Yes No Electrical equipment inspection and testing 15 Jan 2002 Yes No Employee Assistance Program 02 May 2002 Yes No Energy isolation tags and lock-off 15 Jan 2002 Yes No Ergonomics - Screen based workstations 26 Mar 2002 Yes No Fieldwork health & safety procedures 06 Mar 2002 Yes No First Aid 10 May 2002 Yes No Hazard management Feb 2002 Yes No Hazardous substances management Yes No Incident reporting and investigation 19 Dec 2001 Yes No Induction 15 Jan 2002 Yes No Injury Management 22 Feb 2002 Yes No Licence, Registrations & Certificates of Competence 22 Feb 2002 Yes No Manual handling 07 Apr 2022 Yes No Outstanding actions management 15 Jan 2002 Yes No Personal Protective equipment 07 Apr 2002 Yes No Psychological Health 06 Dec 2001 Yes No Record keeping 26 Feb 2002 Yes No Resolution of OHSW issues 14 Jan 2002 Yes No Signage of OHSW 14 Apr 2002 Yes No Standard operating procedure development 10 Dec 2001 Yes No Student Information Jun 2002 Yes No Smoke free work environment Jan 2002 Yes No Training needs and planning 10 Dec 2001 Yes No Travel - Managing Risk Overseas Aug 01 Yes No Working alone 01 Mar 2002 Yes No Working Offshore 02 May 2002 Yes No Worksite inspection 10 Dec 2001 Yes No Contractors Induction Kit Section 6 - November 2002

50 UniSA Document Document Title/Reference Number Approval Date Attached Yes/No Property Unit Documentation UniSA Asbestos Code of Practice June 2002 Yes No UniSA Asbestos Register - Yes No Sustainable Development Guidelines Aug Yes No Other UniSA Documentation Anti-Racism Policy Sept Yes No Car Parking Guidelines Jan Yes No Car Parking Policy Sept Yes No Code of Ethical Conduct Sept Yes No Contractor Parking Protocols - Yes No EO Discrimination and Harassment Complaint Procedure April 1997 Yes No Equal Opportunity Policy June 1991 Yes No Emergency Evacuation Procedure Nov Yes No Occupational Health, Safety, Welfare & Injury Management Policy Dec Yes No Additional Information Contractors Induction Kit Section 6 - November 2002 Please Note: This is a list of policies and procedures only. Relevant information is available on the UniSA Web or documentation will be provided in hard copy format as part of the agreed Contractor Induction Package.

51 81,9(56,7<2)6287+$8675$/,$ 2+6:352&('85( &21),1('63$&((175< 7KLVSURFHGXUHRXWOLQHVWKHUHTXLUHPHQWVIRUWKHPDQDJHPHQWRIHQWU\LQWRFRQILQHGVSDFHVLQ8QLYHUVLW\ ZRUNSODFHVZLWKWKHLQWHQWLRQRIPLQLPLVLQJULVNVWRKHDOWKDQGVDIHW\IURPDQ\SRWHQWLDOKD]DUGV DVVRFLDWHGZLWKWKHHQWU\7KLVSURFHGXUHDSSOLHVWRLGHQWLILHGFRQILQHGVSDFHVDWDOOZRUNSODFHVWR HPSOR\HHVDQGFRQWUDFWRUV '2&80(176) :±&RQILQHG6SDFH5LVN$VVHVVPHQW:RUNVKHHW 2+6:±&RQILQHG6SDFH(QWU\3HUPLW±/RZ5LVN 2+6:±&RQILQHG6SDFH(QWU\3HUPLW±+LJK5LVN 2+6:±+RW:RUN3HUPLWIRU&RQILQHG6SDFHV 2+6:±&RQILQHG6SDFHSHUPLW5HJLVWHU '(),1,7,216 $XWKRULVHGFRPSHWHQWSHUVRQLVDFRPSHWHQWSHUVRQDXWKRULVHGLQZULWLQJE\WKHUHOHYDQW/LQH 0DQDJHUWRVLJQSHUPLWVIRUZRUNLQFRQILQHGVSDFHV &RPSHWHQWSHUVRQLVDSHUVRQZKRKDVWKURXJKDFRPELQDWLRQRIWUDLQLQJHGXFDWLRQDQGH[SHULHQFH DFTXLUHGNQRZOHGJHDQGVNLOOVHQDEOLQJWKDWSHUVRQWRSHUIRUPFRUUHFWO\DVSHFLILHGWDVNLQUHODWLRQWR FRQILQHGVSDFHV &RQILQHGVSDFHLVGHILQHGDVDQHQFORVHGRUSDUWLDOO\HQFORVHGVSDFHDWDWPRVSKHULFSUHVVXUHGXULQJ RFFXSDQF\ZKLFKLVQRWLQWHQGHGRUGHVLJQHGSULPDULO\DVDSODFHRIZRUNPD\KDYHUHVWULFWHGPHDQVIRU HQWU\DQGH[LWDQGPD\ L KDYHDQDWPRVSKHUHZKLFKFRQWDLQVSRWHQWLDOO\KDUPIXOOHYHOVRIFRQWDPLQDQWRU LL QRWKDYHDVDIHR[\JHQOHYHORU LLL FDXVHHQJXOIPHQW &RQWUDFW6XSHUYLVRULVWKHSHUVRQQRPLQDWHGE\WKH/LQH0DQDJHUWRDGPLQLVWHUWKHFRQWUDFW +RWZRUNLVZHOGLQJWKHUPDORUR[\JHQFXWWLQJKHDWLQJLQFOXGLQJILUHSURGXFLQJRUVSDUNSURGXFLQJ RSHUDWLRQVWKDWPD\LQFUHDVHWKHULVNRIILUHRUH[SORVLRQ 5HOHYDQW/LQH0DQDJHULVWKH/LQH0DQDJHUIRUWKHZRUNSODFHRULQWKHFDVHRIEXLOGLQJVDQGVRPHSODQW WKH/LQH0DQDJHUUHVSRQVLEOHIRUFRQVWUXFWLRQRUPDLQWHQDQFH 52/(6$1'5(63216,%,/,7,(6 /LQH0DQDJHUVDUHUHVSRQVLEOHIRU œ WKHLPSOHPHQWDWLRQRIWKLVSURFHGXUHLQWKHLUDUHDRIUHVSRQVLELOLW\DQGDFFRXQWDELOLW\ œ SODQQLQJZRUNLQYROYLQJHQWU\LQWRDFRQILQHGVSDFH œ NHHSLQJDQGPDLQWDLQLQJFRQILQHGVSDFHHQWU\UHFRUGV œ SURYLGLQJWUDLQLQJIRUDOOHPSOR\HHVZKRFDUU\RXWFRQILQHGVSDFHZRUN œ HQVXULQJFRQWUDFWRUVZKRDUHUHTXLUHGWRHQWHUFRQILQHGVSDFHVDUHFRPSHWHQWWRGRVR

52 2+6:± (PSOR\HHVDUHUHVSRQVLEOHIRU œ QRWSODFLQJWKHPVHOYHVRURWKHUVDWULVNRILQMXU\ œ FRQIRUPLQJWRWKHUHTXLUHPHQWVRIWKLVSURFHGXUH œ FRQVXOWLQJZLWK/LQH0DQDJHUVDQGRWKHUHPSOR\HHVLQUHODWLRQWRDKD]DUGDQDO\VLVDVVRFLDWHGZLWK FRQILQHGVSDFHHQWU\UHTXLUHPHQWV 3URSHUW\8QLWLVUHVSRQVLEOHIRU œ LGHQWLI\LQJDOOFRQILQHGVSDFHVZLWKLQ8QLYHUVLW\ZRUNSODFHV œ PDLQWDLQLQJDUHJLVWHURIFRQILQHGVSDFHV œ FRQWDFWLQJDFRPSHWHQWDXWKRULVHGSHUVRQWRREWDLQFRQILQHGVSDFHSHUPLWVIRUDOOSHUVRQVHQWHULQJD FRQILQHGVSDFH 6HUYLFHV8QLWLVUHVSRQVLEOHIRU œ 6LWH7HDP/HDGHUDFWVDVDFRRUGLQDWLQJUROHRQFDPSXVDQGLVUHVSRQVLEOHIRUPDLQWDLQLQJFRSLHVRI FRQILQHGVSDFHSHUPLWV œ 6LWH7HDP/HDGHUVKDOOEHFRQWDFWHGSULRUWRDFFHVVRIFRQILQHGVSDFHDUHDVRQFDPSXV œ FRQWDFWLQJDFRPSHWHQWDXWKRULVHGSHUVRQWRREWDLQFRQILQHGVSDFHSHUPLWVIRUDOOSHUVRQVHQWHULQJD FRQILQHGVSDFH 352&('85( 2QO\FRPSHWHQWSHUVRQVVKDOOXQGHUWDNHFRQILQHGVSDFHHQWU\ &DWHJRULHVDQGVLJQDJH $OOFRQILQHGVSDFHVDW8QLYHUVLW\ZRUNSODFHVVKDOOEHLGHQWLILHGDQGFOHDUO\PDUNHGZLWKDSSURSULDWH ZDUQLQJVLJQVDQGFDWHJRULVHGDVIROORZV œ 5HVWULFWHG$UHDVDVSDFHWKDWZLWKUHVSHFWWRDWPRVSKHULFKD]DUGVKDVPLQLPDOSRWHQWLDOWRFRQWDLQ DKD]DUGFDSDEOHRIFDXVLQJGHDWKRUVHULRXVSK\VLFDOKDUP([DPSOHVRI5HVWULFWHG$UHDFDWHJRU\ FRQILQHGVSDFHVDUHSODQWURRPVDQGHOHFWULFDOGLVWULEXWLRQURRPVDQGOLNHVSDFHV(QWU\LVSHUPLWWHG E\FRPSHWHQWSHUVRQVZLWKRXWDSHUPLWZKHQFDUU\LQJRXWLQVSHFWLRQDQGHPHUJHQF\W\SHZRUNRQO\ œ /RZ5LVNUHTXLULQJ(QWU\3HUPLW)RUP2+6:DVSDFHWKDWZLWKUHVSHFWWRDWPRVSKHULF KD]DUGVKDVEHHQDVVHVVHGDVKDYLQJD/2:SRWHQWLDOWRFRQWDLQDKD]DUGFDSDEOHRIFDXVLQJGHDWK RUVHULRXVKDUP([DPSOHVRI/RZ5LVNFRQILQHGVSDFHVDUHWXQQHODUHDVVHFWLRQVZLWKIRUFHG YHQWLODWLRQFHLOLQJVSDFHVZLWKYDULRXVFHLOLQJWLOHVUHPRYHGVHUYLFHGXFWVZLWKYHQWLODWLRQDQGWKH OLNH œ +LJK5LVNUHTXLULQJ(QWU\3HUPLW)RUP2+6:DVSDFHWKDWZLWKUHVSHFWWRDWPRVSKHULF KD]DUGVKDVEHHQDVVHVVHGDVKDYLQJD+,*+SRWHQWLDOWRFRQWDLQDKD]DUGFDSDEOHRIFDXVLQJGHDWK RUVHULRXVKDUP([DPSOHVRI+,*+5LVNFRQILQHGVSDFHVDUHVXPSSXPSSLWVSUHVVXUHYHVVHOVDLU UHFHLYHUVDLUFRQGLWLRQLQJDLUKDQGOLQJILOWHUXQLWVVWRUPZDWHUURDGVLGHHQWU\SLWVDQGWKHOLNH )RUKRWZRUNLQRURQDQRFFXSLHGFRQILQHGVSDFHDQDGGLWLRQDOSHUPLW)RUP2+6:LVUHTXLUHG (QWU\3HUPLWV $SSURYDOWRHQWHUDFRQILQHGVSDFHRUFDUU\RXWKRWZRUNRQDQRFFXSLHGFRQILQHGVSDFHVKDOOEHREWDLQHG IURPDQDXWKRULVHGFRPSHWHQWSHUVRQEHIRUHZRUNLVFRPPHQFHG$SSURYDOVKDOOQRWEHJUDQWHGXQWLO œ DULVNDVVHVVPHQWRIWKHHQWU\WRWKHFRQILQHGVSDFHXVLQJ)RUP2+6:KDVEHHQFRPSOHWHGE\D FRPSHWHQWSHUVRQ œ PHDVXUHVWRFRQWUROWKHLGHQWLILHGULVNVLQUHJDUGWRWKHSDUWLFXODUHQWU\KDYHEHHQHVWDEOLVKHG œ WKHFRPSHWHQF\RIWKRVHUHTXLUHGWRHQWHUWKHVSDFHKDVEHHQYHULILHG œ DSSURSULDWHFRQILQHGVSDFHSHUPLWVLQUHVSHFWWRWKHHQWU\KDYHEHHQFRPSOHWHG œ HPHUJHQF\SURFHGXUHVKDYHEHHQGHWHUPLQHGLQUHVSHFWWRWKHSDUWLFXODUHQWU\

53 2+6:± 127(1RZRUNVKDOOEHFDUULHGRXWZLWKLQDFRQILQHGVSDFHRURQWKHRXWVLGHVXUIDFHRIDFRQILQHG VSDFHLIWKHZRUNRUDQ\SODQWLVOLNHO\WRFDXVHRUFUHDWHDULVN œ WRWKHKHDOWKDQGVDIHW\RIDSHUVRQLQWKHFRQILQHGVSDFHRU œ RIILUHRUH[SORVLRQ 7UDLQLQJ 7UDLQLQJIRUZRUNLQRURQFRQILQHGVSDFHPXVWLQVRIDUDVLVUHOHYDQWWRWKHSHUIRUPDQFHRIWKHSDUWLFXODU ZRUNDWOHDVWUHODWHWR œ WKHKD]DUGVDVVRFLDWHGZLWKFRQILQHGVSDFHV œ ULVNDVVHVVPHQWSURFHGXUHV œ FRQWUROPHDVXUHVIRUFRQILQHGVSDFHV œ WKHVHOHFWLRQXVHILWDQGPDLQWHQDQFHRIVDIHW\HTXLSPHQW 5HFRUGV 7KH3URSHUW\8QLWPDLQWDLQVD&RQILQHG6SDFH5HJLVWHUDQGLQLWLDOULVNDVVHVVPHQWV 7KH6HUYLFHV8QLWPDLQWDLQVFRQILQHGVSDFHSHUPLWV)RUPV2+6: DQGKRWZRUNSHUPLWV)RUP 2+6:DQGWKHVHVKDOOEHNHSWLQDFFRUGDQFHZLWK2+6:3URFHGXUH±5HFRUG.HHSLQJ 5HFRUGVRIWUDLQLQJPXVWEHNHSWIRUDSHULRGRIQRWOHVVWKDQ\HDUV 0RGLILFDWLRQV 0RGLILFDWLRQVWRFRQILQHGVSDFHVKDOOQRWGHWULPHQWDOO\DIIHFWWKHVDIHPHDQVRIHQWU\DQGH[LW 5()(5(1&(6 8QLYHUVLW\2+6:,03ROLF\ 8QLYHUVLW\2+6:,0$FWLRQ3ODQ 8QLYHUVLW\2+6:,00DQDJHPHQW6\VWHP 8QLYHUVLW\2+6:3URFHGXUH±5HFRUG.HHSLQJ 2FFXSDWLRQDO+HDOWK6DIHW\DQG:HOIDUH$FW 2FFXSDWLRQDO+HDOWK6DIHW\DQG:HOIDUH5HJXODWLRQV $61=62FFXSDWLRQDO+HDOWKDQG6DIHW\0DQDJHPHQW6\VWHPV±*HQHUDOJXLGHOLQHVRQ SULQFLSOHVV\VWHPVDQGVXSSRUWLQJWHFKQLTXHV $SSURYHG&RGHRI3UDFWLFH$XVWUDOLDQ6WDQGDUG$6±6DIHZRUNLQJLQDFRQILQHGVSDFH $XVWUDOLDQ6WDQGDUG$66DIHW\LQZHOGLQJDQGDOOLHGSURFHVVHV)LUHSUHFDXWLRQV 'DWHRI,VVXH$SULO 5HYLHZHG 1RYHPEHU 5HYLHZ'DWH 1RYHPEHU

54 81,9(56,7<2)6287+$8675$/,$ 2+6:352&('85( &21),1('63$&(5,6.$66(660(17:25.6+((7 2+6: :RUNSODFH /RFDWLRQ 1RWH&RPSOHWHDQGDWWDFKH[WUDVKHHWV,IWKHUHLVLQVXIILFLHQWVSDFH 'HVFULSWLRQRIWKHZRUNWREHXQGHUWDNHQ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 'HVFULEHWKHYDULRXVZD\VWKLV:RUN&28/'%(XQGHUWDNHQ 7KHSRWHQWLDOKD]DUGVSUHVHQWDWWKLVFRQILQHGVSDFH $WPRVSKHULF&KHPLFDO+D]DUGV (VWLPDWHG/HYHORI5,6. *DVHV'XVW)XPHV2[\JHQ'HILFLHQF\RUH[FHVVHWF /RZ +LJK +DUPIXOOHYHORIK\GURJHQVXOSKLGHIURPGLVWXUELQJVHGLPHQWV o o &RPEXVWLEOHJDVHVRUYDSRXUVIURPGHFRPSRVLWLRQRIRUJDQLFPDWHULDO o o,qilowudwlrqriiodppdeohpdwhuldovwkurxjkeurnhqvhfwlrqvruslshv o o 3RWHQWLDOO\H[SORVLYHGXVWV o o 2[\JHQGHILFLHQF\IURPUXVWLQJSURFHVVHV o o 3K\VLFDO$JHQWV 7KHUPDOH[WUHPHV o o 1RLVH o o :HOGLQJ o o &XWWLQJ o o *ULQGLQJ o o )ORRGLQJIURPIDLOXUHRIWKHRXWOHWSLSHDQGDVVRFLDWHGVWUXFWXUHV o o 'HWDLOVRIWKHDFWXDOPHWKRGWREHXVHGIRUWKHSDUWLFXODUZRUN BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 3URFHGXUHVIRUHPHUJHQF\DQGUHVFXH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6LJQHGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBB7LPHBBBBBDPSP $XWKRULVHG&RPSHWHQW3HUVRQ 7KLVDVVHVVPHQWPXVWEHUHYLVHGZKHQLWLVQRORQJHUYDOLG

55 81,9(56,7<2)6287+$8675$/,$ 2+6: 2+6:352&('85( &21),1('63$&((175<3(50,7±/2:5,6. 3DJHRI :RUNSODFH /RFDWLRQ 7KLVSHUPLWPXVWEHVLJQHGE\WKH$XWKRULVHG&RPSHWHQW3HUVRQEHIRUHWKHZRUNSURFHHGV 2QO\WKHZRUNOLVWHGPD\EHGRQH 1DPHRI3HUVRQV(QWHULQJ 1RQ8QLYHUVLW\HPSOR\HU V1DPHDQG$GGUHVV 'HVFULSWLRQRI:RUNLI+RW:RUNDOVRFRPSOHWH2+6:±+RW:RUN3HUPLWIRU&RQILQHG6SDFHV à à +RW:RUNSHUPLWUHTXLUHG <HVÃo 1RÃÃÃo 6DIHW\3HUVRQQHO1RWLILHG6HFXULW\1DPHBBBBBBBBBBBBBBBBB2WKHU1DPH 5DGLR&RPPXQLFDWLRQ&KHFN:RUNLQJ <HVÃo 1RÃÃÃoà 3XUJLQJRU9HQWLODWLRQà $XWRPDWLFo 3RUWDEOHÃoà 1$Ão 3HUVRQDO3URWHFWLYH(TXLSPHQWà 6DIHW\*ODVVHVÃà oã à +HDULQJ3URWHFWLRQà oã à 6DIHW\+HOPHWVà oã à %UHDWKLQJ$SSDUDWXVà oã 7\SHà à à 6DIHW\)RRWZHDUà oã à 3URWHFWLYH&ORWKLQJà oã à 2WKHU $VSHUULVNDVVHVVPHQWDQGKD]DUGLGHQWLILFDWLRQ $WPRVSKHULFWHVWLQJDVUHTXLUHG±7\SH&RQWLQXRXVà oã 3HULRGLF o 1$à o 7\SHRILQVWUXPHQWXVHG 1DPHRI&RPSHWHQW3HUVRQ&RQGXFWLQJ7HVWSOHDVHSULQW 7HVW5HVXOWV 0HWKDQH /(/ +\GURJHQ6XOILGH 330 2[\JHQ/HYHOV &DUERQ'LR[LGH 330 2WKHU $87+25,6$7,21)25(175< 7KHFRQILQHGVSDFHGHVFULEHGDERYHLVLQP\RSLQLRQVDIHIRUWKHZRUNGHWDLOHGLQWKH'HVFULSWLRQRI :RUNDERYHWREHFDUULHGRXWSURYLGHGWKDWWKHSUHFDXWLRQVOLVWHGDUHDGKHUHGWR à 6LJQDWXUH $XWKRULVHG&RPSHWHQW3HUVRQ 'DWHBBBBBBBBB7LPHBBBBBDPSP 3(50,79$/,'IURPDPSPWRDPSP'DWH

56 2+6:± 7$6.&203/(7(' œ $OOSHUVRQVHTXLSPHQWSODQW PDWHULDOVKDYHEHHQZLWKGUDZQ o œ :RUNKDVEHHQFRPSOHWHG o œ $FFHVVWRWKHFRQILQHGVSDFHKDVEHHQVHFXUHG o 6LJQDWXUH 'DWHBBBBBBBBB7LPHBBBBBDPSP $XWKRULVHG&RPSHWHQW3HUVRQ 5HWXUQWKHFRPSOHWHGIRUPWRWKHUHOHYDQW/LQH0DQDJHU

57 Ã 81,9(56,7<2)6287+$8675$/,$ 2+6: 2+6:352&('85( &21),1('63$&((175<3(50,7±+,*+5,6. 3DJHRI :RUNSODFH /RFDWLRQ 'DWH 7KLVSHUPLWPXVWEHVLJQHGE\WKH$XWKRULVHG&RPSHWHQW3HUVRQEHIRUHWKHZRUNSURFHHGV 2QO\WKHZRUNOLVWHGPD\EHGRQH (PSOR\HH1DPHSOHDVHSULQW 1RQ8QLYHUVLW\HPSOR\HU V1DPHDQG$GGUHVV (PHUJHQF\FRQWDFW1DPH SKRQH 1XPEHURI(PSOR\HHVQDPHGEHORZ BBBBBBBBBBBBBBBBBBB 1DPHRI&RPSHWHQW3HUVRQSOHDVHSULQW 'HVFULSWLRQRI&RQILQHG6SDFH '(6&5,37,212):25.LI+RWZRUNDOVRFRPSOHWH2+6:±+RW:RUN3HUPLWIRU&RQILQHG6SDFHV +RW:RUNSHUPLWUHTXLUHG <HVÃo 1RÃÃÃo 5HTXHVWHG%\ 3RVLWLRQ,62/$7,212)7+(&21),1('63$&(DVSHU$66HFWLRQV 7KHLWHPVWLFNHGEHORZKDYHEHHQLVRODWHGRUPDGHVDIH o >@6OXGJHV'HSRVLWV:DVWH >@(OHFWULFDO6HUYLFHV PHDQVRILVRODWLRQ o o o o o o

58 2+6:± $70263+(5,&7(675(48,5(0(176)LOOLQGHWDLOVRIWHVW,IWKHFRQILQHGVSDFHPXVWEHFOHDUHGRIFRQWDPLQDQWVWKHQXVHDVXLWDEOHSXUJLQJDJHQWDQGLIWKLVLVD JDVPL[WXUHLWVKDOOKDYHOHVVWKDQE\YROXPHRIR[\JHQRWKHUZLVHUHVSLUDWRU\HTXLSPHQWVKDOOEH SURYLGHG +DVWKHJDVGHWHFWRUEHHQFDOLEUDWHGLQWKHODVWPRQWKV" <HV1R 'XHGDWHIRUQH[WFDOLEUDWLRQBBBBBBBBBBBB 7HVW5HVXOWV 0HWKDQH /(/ +\GURJHQ6XOSKLGH 330 2[\JHQ/HYHOV &DUERQ'LR[LGH 330 2WKHU 7KHFRQFHQWUDWLRQRIDQ\IODPPDEOHFRQWDPLQDQWLQWKHDWPRVSKHUHRIWKHFRQILQHGVSDFHLV EHORZRILWV/(/± EHWZHHQDQGRILWVOHYHO±HQWHUFRQILQHGVSDFHRQO\ZLWKFRQWLQXRXVPRQLWRULQJDQGWKH XVHRIVXLWDEO\FDOLEUDWHGIODPPDEOHJDVGHWHFWRU o &21',7,2166$)(72(17(5" ZLWKVXSSOLHGDLUUHVSLUDWRU\GHYLFHQRFRPEXVWLEOHJDV o ZLWKDQDLUSXULI\LQJQRQDLUVXSSOLHGUHVSLUDWRU\SURWHFWLRQGHYLFH o ZLWKRXWVXSSOLHGDLUUHVSLUDWRU\GHYLFH o 3(5621$/3527(&7,9((48,30(17 7KHIROORZLQJSHUVRQDOSURWHFWLYHHTXLSPHQWWLFNHGVKDOOEHZRUQDVUHTXLUHG D6XSSOLHGDLUUHVSLUDWRUVF\OLQGHUVILOOHGUHIHUHQFHWRVDIHZRUNSURFHGXUHV o E$LUSXULI\LQJUHVSLUDWRU\SURWHFWLRQGHYLFHV o F6DIHW\KDUQHVVDQGRUVDIHW\OLQHRUOLIHOLQHUHVFXH o G(\HSURWHFWLRQHJVDIHW\JODVVHV o H+DQGSURWHFWLRQHJJORYHV o I)RRWSURWHFWLRQHJVDIHW\VKRHVRUERRWV o J3URWHFWLYHFORWKLQJHJRYHUDOOV o K+HDULQJSURWHFWLRQ o L6DIHW\KHOPHWV o o

59 2+6:± 67$1'%< 5(6&8(3(56211(/ D 6WDQGE\SHUVRQQHODUHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBDQGBBBBBBBBBBBBBBBBBBBBBBBBBBB E 5HVFXH HPHUJHQF\SURFHGXUHVKDYHEHHQLVVXHGDQGXQGHUVWRRG" <HV1R F 2SHQLQJVIRUHQWU\DQGH[LWWRSHUPLWUHVFXHRIDQ\SHUVRQZKRPD\HQWHUWKHFRQILQHGVSDFHRU SURYLVLRQRIVXLWDEOHDOWHUQDWLYHPHDQVRIUHVFXH G 3URFHGXUHVWRSUHYHQWREVWUXFWLRQRIWKHRSHQLQJVE\ILWWLQJVRUHTXLSPHQWZKLFKFRXOGLPSHGHUHVFXH +$=$5'6,'(17,),(':,7+7+,6&21),1('63$&($5( 35(&$87,2167KHIROORZLQJSUHFDXWLRQVKDYHEHHQLGHQWLILHG D $SSURSULDWHZDUQLQJVLJQVDQGEDUULHUVKDYHEHHQSODFHGFRUUHFWO\ o E 6PRNLQJKDVEHHQEDQQHGIURPWKHFRQILQHGVSDFHVLWH o F,JQLWLRQVRXUFHVKDYHEHHQUHPRYHGIURPZLWKLQPHWUHVRIWKHHQWU\H[LWSRLQW o G (TXLSPHQWIRUILUHSURWHFWLRQ o H )LUVW±DLGHTXLSPHQW o I 1RFKHPLFDODJHQWVRWKHUWKDQWKRVHOLVWHGEHORZVKDOOEHSHUPLWWHGLQWKHFRQILQHGVSDFH o H$Q\VSHFLDOSUHFDXWLRQVUHTXLUHG (175<3(56211(/,:HXQGHUVWDQGWKHVDIHW\SURFHGXUHVUHTXLUHGIRUHQWU\DQGH[LWIRUZRUNLQJLQDFRQILQHGVSDFH DQGWKHVDIHW\SURWHFWLYHHTXLSPHQWWREHXVHGDQGKDYHDZRUNLQJNQRZOHGJHRIWKHHTXLSPHQWWR EHXVHG (03/2<((61$0( 3OHDVH3ULQW (03/2<((6 6,*1$785( 75$,1(',1/$ '$7(2) (175<,1 7,0( <HV1R <HV1R <HV1R <HV1R 287 7,0(

60 2+6:± $87+25,6$7,21)25(175< 7KHFRQILQHGVSDFHGHVFULEHGDERYHLVLQP\RSLQLRQVDIHIRUWKHZRUNGHWDLOHGLQWKH'HVFULSWLRQRI :RUNDERYHWREHFDUULHGRXWSURYLGHGWKDWWKHSUHFDXWLRQVOLVWHGDUHDGKHUHGWR 127(1RZRUNVKDOOEHFDUULHGRXWZLWKLQDFRQILQHGVSDFHRURQWKHRXWVLGHVXUIDFHRIDFRQILQHG VSDFHLIWKHZRUNRUDQ\SODQWLVOLNHO\WRFDXVHRUFUHDWHDULVN œ WRWKHKHDOWKDQGVDIHW\RIDSHUVRQLQWKHFRQILQHGVSDFHRU œ RIILUHRUH[SORVLRQ 6LJQDWXUH $XWKRULVHG&RPSHWHQW3HUVRQ 'DWHBBBBBBBBB7LPHBBBBBDPSP 3(50,79$/,'IURPDPSPWRDPSP'DWH 7$6.&203/(7(' œ $OOSHUVRQVHTXLSPHQWSODQW PDWHULDOVKDYHEHHQZLWKGUDZQ o œ :RUNKDVEHHQFRPSOHWHG o œ $FFHVVWRWKHFRQILQHGVSDFHKDVEHHQVHFXUHG o 6LJQDWXUH 'DWHBBBBBBBBB7LPHBBBBBDPSP $XWKRULVHG&RPSHWHQW3HUVRQ 5HWXUQWKHFRPSOHWHGIRUPWRWKH3URSHUW\8QLW

61 81,9(56,7<2)6287+$8675$/,$ 2+6: 2+6:352&('85( +27:25.3(50,7)25&21),1('63$&( 3DJHRI :RUNSODFH /RFDWLRQ 'DWH 7KHSUHFDXWLRQVWLFNHGEHORZPXVWEHIXOO\REVHUYHG 7KHDUHDLVFOHDQDQGIUHHRIDOOUHDGLO\FRPEXVWLEOHPDWHULDOVZLWKLQPHWUHV $OOGUDLQVZLWKLQPHWUHVDUHFRYHUHGZLWKDZHWILUHSURRIEODQNHW $SSURSULDWHILUHH[WLQJXLVKHUVDUHRQVLWHDQGQHDUWKHVRXUFHRILJQLWLRQ o o o $ZDWHUKRVHLVUXQWRWKHMREVLWHWHVWHGOHIWUXQQLQJ o $OOVSDUNVIURPZRUNFRQGXFWHGPRUHWKDQPHWUHVDERYHJURXQGPXVWEHFRQWDLQHGFRPSOHWHO\ E\WKHXVHRIDVXLWDEOHHQFORVXUHWKDWVKDOOEHLQVSHFWHGEHIRUHFRPPHQFLQJZRUN o :HOGLQJPDFKLQHJDVF\OLQGHUVDUHORFDWHGWKH\PXVWQRWEHZLWKLQPHWUHVRIDQ\GUDLQ :HOGLQJPDFKLQHPXVWEHHDUWKHGGLUHFWO\WRWKHHTXLSPHQWWKDWLVEHLQJZHOGHGDVFORVHWRWKH ZHOGLQJSRLQWDVSUDFWLFDO 3RZHUOHDGVDUHQRWGUDSHGDFURVVSLSHOLQHVRUDFFHVVZD\V o o o (OHFWULFDOWUDFHVRQSLSHVDUHLVRODWHG $Q\VSHFLDOFRQGLWLRQV",KDYHUHDGDQGIXOO\XQGHUVWDQGWKHSUHFDXWLRQVOLVWHGRQWKHDWWDFKPHQWWRWKLVSHUPLW 6LJQDWXUH 'DWHBBBBBBBBB7LPHBBBBBDPSP &RPSHWHQW3HUVRQVHQWHULQJ $87+25,6$7,21 7KHKRWZRUNLQRURQWKHRFFXSLHGFRQILQHGVSDFHGHVFULEHGDERYHDQGRQWKHDVVRFLDWHG&RQILQHG 6SDFH(QWU\3HUPLWLVLQP\RSLQLRQVDIHIRUWKHZRUNWREHFDUULHGRXWSURYLGHGWKDWWKHSUHFDXWLRQV OLVWHGDUHDGKHUHGWR 6LJQDWXUH $XWKRULVHG&RPSHWHQW3HUVRQ o 'DWHBBBBBBBBB7LPHBBBBBDPSP 3(50,79$/,'IURPDPSPWRDPSP'DWH 7$6.&203/(7('7KLVVLJQRIIPXVWEHFRPSOHWHGZLWKWKHDVVRFLDWHG&RQILQHG6SDFH(QWU\3HUPLW 6LJQDWXUH 'DWHBBBBBBBBB7LPHBBBBBDPSP $XWKRULVHG&RPSHWHQW3HUVRQ 5HWXUQWKHFRPSOHWHGIRUPWRWKH3URSHUW\8QLW$WWDFKPHQWWR+RW:RUN3HUPLWIRU&RQILQHG6SDFH

62 2+6:± 35(&$87,216 5(&200(1'$7,216)25+27:25.,1&21),1('63$&(6 *(1(5$/ 6SHFLDOFDUHLVQHFHVVDU\ZKHQ+RW:RUNLVXQGHUWDNHQLQRURQDFRQILQHGVSDFH+RWZRUNLVGHILQHGLQ $XVWUDOLDQ6WDQGDUGDVZHOGLQJWKHUPDORUR[\JHQFXWWLQJKHDWLQJDQGRWKHUILUHSURGXFLQJRU VSDUNSURGXFLQJRSHUDWLRQV 3(50,76 +RWZRUNLQRURQWKHH[WHULRUVXUIDFHVRIDQRFFXSLHGFRQILQHGVSDFHVKDOOQRWEHFRPPHQFHGXQWLODKRW ZRUNSHUPLWKDVEHHQLVVXHG7KHKRWZRUNSHUPLWVKDOOFHUWLI\WKDWDSSURSULDWHSUHFDXWLRQVKDYHEHHQ FDUULHGRXWDQGVKDOOOLVWDQ\WHVWVQHFHVVDU\WRHQVXUHWKDWVDIHFRQGLWLRQVDUHPDLQWDLQHG $VSHFWVWREHWDNHQLQWRDFFRXQWZKHQFRQVLGHULQJWKHLVVXHRIDSHUPLWLQFOXGHWKHIROORZLQJ :KHQDFRQILQHGVSDFHRUDVSDFHDGMDFHQWWKHUHWRKDVFRQWDLQHGDIODPPDEOHRUFRPEXVWLEOH VXEVWDQFHWKHSHUPLWVKDOOEHLVVXHGRQO\DIWHULQVSHFWLRQDQGWHVWLQJKDYHHQVXUHGWKDWWKHIROORZLQJ UHTXLUHPHQWVKDYHEHHQDFKLHYHG D 7KHFRQFHQWUDWLRQRIIODPPDEOHYDSRXUVRUJDVHVLQWKHDWPRVSKHUHLVEHORZRIWKH/(/ E 7KHOLTXLGDQGVROLGUHVLGXHVKDYHEHHQUHPRYHGDVQHFHVVDU\WRSUHYHQWWKHUHOHDVHRI IODPPDEOHYDSRXUVRUJDVHVWKDWZLOOUDLVHWKHFRQFHQWUDWLRQDERYHRIWKH/(/ F $OOSLSLQJZLWKLQWKHFRQILQHGVSDFHKDVEHHQIRXQGE\WHVWLQJQRWWRFRQWDLQFRQFHQWUDWLRQVRI IODPPDEOHYDSRXURUJDVDERYHRIWKH/(/,QDFRQILQHGVSDFHKDYLQJODVWFRQWDLQHGGU\PDWHULDOWKDWFUHDWHVDH[SORVLYHDWPRVSKHUHZKHQ GLVSHUVHGLQDLUWKHSHUPLWVKDOOEHLVVXHGRQO\DIWHULQVSHFWLRQKDVHQVXUHGWKDWORRVHGXVWKDVEHHQ UHPRYHGIURPWKHFRQILQHGVSDFHDQGDOODSSURSULDWHVXUIDFHVKDYHEHHQFOHDQHG :KHUHIL[HGILUH H[WLQJXLVKLQJHTXLSPHQWKDYLQJHLWKHUPDQXDORUDXWRPDWLFDFWLYDWLRQFRQWUROVSURWHFWVWKHFRQILQHG VSDFHVXFKHTXLSPHQWVKDOOEHSRVLWLYHO\LVRODWHGZKHQWKHFRQILQHGVSDFHLVRFFXSLHG,QVXFKFDVHV DOWHUQDWLYHILUHSURWHFWLRQVKDOOSURYLGHGLQWKHFRQILQHGVSDFHE\DGHTXDWHQXPEHUVRIWKHDSSURSULDWH VL]HDQGW\SHRISRUWDEOHILUHH[WLQJXLVKHUV ),5(35(9(17,21 7KHIROORZLQJILUHSUHYHQWDWLYHPHDVXUHVVKDOOEHWDNHQ $OOFRPEXVWLEOHVLQFOXGLQJDQ\GU\UHVLGXHVLQWKHYLFLQLW\RIWKHKRWZRUNVKDOOEHUHPRYHGWRDVDIH SODFH,IWKH\FDQQRWEHPRYHGVXFKLWHPVVKDOOEHFRYHUHGE\DQRQFRPEXVWLEOHEODQNHWIODPH UHVLVWDQWWDUSDXOLQRURWKHUPHDQVWRSUHYHQWLJQLWLRQIURPKHDWVSDUNVDQGVODJ :KHQKRWZRUNLVLQYROYHGFRQVLGHUDWLRQVKDOOEHJLYHQWRWKHDVVLJQPHQWRIDILUHZDWFKZKLOHWKHKRW ZRUNLVEHLQJSHUIRUPHGDQGIRUDSHULRGRIDOHDVWPLQXWHVDIWHUFRPSOHWLRQRIVXFKKRWZRUN :KHQZHOGLQJRUFXWWLQJZLOOEHSHUIRUPHGRQDWDQNVKHOORUDFRQGXFWLYHERXQGDU\RIDFRQILQHG VSDFHWKHVDPHSUHFDXWLRQVVKDOOEHH[HUFLVHGLQVLGHDQGRXWVLGHWKHVSDFHZKHUHWKHKRWZRUNLV EHLQJSHUIRUPHG 127(6SDUNVIURPGLUHFWSHQHWUDWLRQRUKHDWWUDQVIHUPD\DOVRFUHDWHDQH[SORVLRQRUILUHKD]DUGLQ WKHDGMDFHQWVSDFHVRXWVLGHWKHFRQILQHGVSDFH %HIRUHKRWZRUNLVVWDUWHGRQDVXUIDFHFRYHUHGZLWKDSUHVHUYDWLYHRURWKHUSURWHFWLYHFRDWLQJWKH IODPPDELOLW\DQGWKHUPDOGHFRPSRVLWLRQSURGXFWVRIWKHFRDWLQJVKDOOEHFRQVLGHUHG:KHUHVXFKD FRDWLQJLVIODPPDEOHLWVKDOOEHVWULSSHGIURPWKHDUHDRIKRWZRUNWRSUHYHQWLJQLWLRQ$SUHVVXULVHG ILUHKRVHDQGDVXLWDEOHQR]]OHRURWKHUH[WLQJXLVKLQJHTXLSPHQWRUERWKVKDOOEHDYDLODEOH :KHQDUFZHOGLQJLVVXVSHQGHGIRUDVXEVWDQWLDOSHULRGRIWLPHVXFKDVGXULQJOXQFKSHULRGVRU RYHUQLJKWWKHSRZHUVRXUFHWRWKHHTXLSPHQWVKDOOEHGHHQHUJLVHGDOOHOHFWURGHVUHPRYHGIURP KROGHUVDQGWKHKROGHUVSODFHGVRWKDWDFFLGHQWDOFRQWDFWRUDUFLQJFDQQRWRFFXU :KHQJDVZHOGLQJRUFXWWLQJLVVXVSHQGHGIRUDVXEVWDQWLDOSHULRGRIWLPHVXFKDVGXULQJOXQFK SHULRGVRURYHUQLJKWWKHWRUFKDQGF\OLQGHUYDOYHVVKDOOEHFORVHG:KHUHSUDFWLFDEOHWKHWRUFKDQG KRVHVKDOOEHUHPRYHGIURPWKHDUHDDQGGHSUHVVXULVHGRXWVLGHWKHFRQILQHGVSDFH

63 2+6:± :KHUHSUDFWLFDEOHQRFRPSUHVVHGJDVF\OLQGHUVRUDVVRFLDWHGPDQLIROGRWKHUWKDQWKRVHXVHGIRU VHOIFRQWDLQHGEUHDWKLQJDSSDUDWXVVKDOOEHORFDWHGLQVLGHWKHFRQILQHGVSDFH &21752/2))80(6 )XPHVVKDOOEHFRQWUROOHGDVIROORZV %HIRUHKRWZRUNLVVWDUWHGRQDPHWDOVXUIDFHZKLFKLVFRDWHGWKHDWPRVSKHUHLQWKHFRQILQHGVSDFH VKDOOEHWHVWHGWRHQVXUHWKDWIODPPDEOHYDSRXUVRUJDVIURPFRDWLQJVZLWKIODVKSRLQWVEHORZWKH DPELHQWWHPSHUDWXUHGRQRWH[FHHGRIWKH/(/ 'XULQJVXFKKRWZRUNSHULRGLFWHVWVVKDOOEHFRQGXFWHGWRHQVXUHWKDWWKHVHOLPLWVDUHQRWH[FHHGHG,QDFRQILQHGVSDFHDOOVXUIDFHVFRYHUHGZLWKFRDWLQJVWKDWZRXOGGHFRPSRVHRUYRODWLOLVHXQGHUKRW ZRUNLQWRWR[LFFRUURVLYHRULUULWDQWFRPSRQHQWVVKDOOEHVWULSSHGIURPWKHDUHDRIKHDWDSSOLFDWLRQ &RDWLQJVVKDOODOVREHUHPRYHGIRUDVXIILFLHQWGLVWDQFHIURPWKHDUHDWREHKHDWHGLQRUGHUWR PLQLPLVHWKHWHPSHUDWXUHLQFUHDVHRIWKHXQVWULSSHGPHWDO$GGLWLRQDOO\DUWLILFLDOFRROLQJRIWKHPHWDO VXUURXQGLQJWKHKRWZRUNDUHDPD\EHQHFHVVDU\WROLPLWWKHVL]HRIWKHDUHDUHTXLUHGWREHFOHDQHG :KHUHVXFKVWULSSLQJLVQRWSUDFWLFDEOHDOOSHUVRQVLQWKHFRQILQHGVSDFHVKDOOZHDUVXLWDEOH UHVSLUDWRU\SURWHFWLYHGHYLFHVDQGRWKHUSHUVRQDOSURWHFWLYHHTXLSPHQWDVDSSURSULDWH0HDQVVKDOO EHSURYLGHGWRH[KDXVWFRQWDPLQDWHGDLUIURPWKHFRQILQHGVSDFH6XFKH[KDXVWVKDOOEHGLUHFWHGWRD ORFDWLRQZKHUHLWSUHVHQWVQRKD]DUGWRDQ\SHUVRQVRUHTXLSPHQWDQGZLOOQRWDFFLGHQWDOO\EH UHFLUFXODWHGLQWRWKHFRQILQHGVSDFH

64 81,9(56,7<2)6287+$8675$/,$ 2+6:352&('85( 2+6: &21),1('63$&(3(50,75(*,67(5 3DJHRI :RUNSODFH /RFDWLRQ 'DWH 3(50,712 '$7( 3(5621(17(5,1*7+(&21),1('63$&( +,*+25 /2:5,6. 3(50,7 (175<7,0( (;,77,0(

65 UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE CONTRACTOR MANAGEMENT This procedure outlines the requirements for the management of health and safety in relation to contractors working at University workplaces. The intention is to minimise risks to health and safety of contractors and University employees from the work activities of contractors engaged to carry out work on behalf of the University. DOCUMENTS/FORMS Contractor OHSW Requirements OHSW27 Contractor s Permit to Work OHSW28 Contractor OHSW Induction Checklist DEFINITIONS Contractor a person, organisation, their employees or a nominated representative engaged to carry out work for the University in a contract for service arrangement. Contract for Service is likely to apply where: the nature of the engagement involves a profession or trade, the contractor has the power to recruit and dismiss their employees, the contractor provides plant, equipment and materials to complete the work, the contractor has the right to have another person perform the work, the University does not have direct supervision over the person performing the work, the University does not have responsibility for deducting income tax from any payments. Contract Supervisor is the person nominated by the Line Manager to administer the contract. ROLES AND RESPONSIBILITIES Contract Supervisors are responsible for: the implementation of this procedure in their area of responsibility and accountability the ensuring the induction of the contractor or the contractor s nominated representative in accordance with the OHSW Procedure OHSW Induction the management of contractors in relation to site specific hazards and ensuring contractors proposed work methods do not place University employees at risk advising the relevant Line Manager when the work will be conducted in the workplace of another Line Manager. University employees are responsible for: not placing themselves or others at risk of injury reporting work methods of contractors that place University employees at risk.

66 Contractors are responsible for: not placing themselves or others at risk of injury working in accordance with relevant University OHSW procedures providing OHSW information to the University that is relevant to the contract when requested developing site-specific procedures relevant to site hazards and work activities at the site completing the Contractor Permit to Work in accordance with this procedure. PROCEDURE Contract Supervisors shall ensure that all contractors who come on site establish systems at worksites for the implementation of this procedure. This procedure shall be included in all tender documents or with orders for work on site. Contractors shall be provided with this procedure and specific information relevant to worksite hazards prior to commencing work on site and will be required to acknowledge in writing that this procedure has been read and understood and agreed to as a condition of contract. The contractor shall complete the Contractor s Permit to Work (Form OHSW 27) attached to this procedure and develop safe work methods for the work to be undertaken prior to the commencement of work. The Contractor s Permit to Work shall be authorised by the relevant Contract Supervisor responsible for the work activities of the contractor. The Contract Supervisor shall ensure that the Contractor or the Contractor s nominated representative is inducted in accordance with the OHSW Procedure OHSW Induction and the Form OHSW28 Contractor Induction is completed before work commences. The Contract Supervisor shall conduct regular site inspections of the work to ensure compliance with OHSW requirements and report any identified unsafe work methods to the Contractor. Any employee that identifies that a Contractor or the contractor s employees are operating in an unsafe manner, is responsible for reporting the unsafe practice to the Manager Campus Services ( ) or the Facilities Maintenance Coordinator ( ) immediately advising them of the unsafe practice being undertaken. REFERENCES Occupational Health Safety and Welfare Act 1986 Occupational Health Safety and Welfare Regulations 1995 Date of Issue: 11 March 2002 Review Date: April 2003

67 UNIVERSITY OF SOUTH AUSTALIA CONTRACTOR OHSW REQUIREMENTS CONTENTS 1. LEGISLATION 2. WORKSITE INDUCTION 3. SECURITY 4. SAFE WORK PROCEDURES 5. RISK ASSESSMENTS 6. PORTABLE ELECTRICAL EQUIPMENT 7. RESIDUALCURRENT DEVICES (RCD S) 8. WORK OF A HAZARDOUS NATURE 9. POTENTIAL HAZARDS 10. USE OF CHEMICALS (hazardous substances) 11. DELIVERY OF MATERIALS (hazardous substances) 12. PERSONAL PROTECTIVE EQUIPMENT 13. PROTECTIVE SCREENS 14. EXPLOSIVE POWER TOOLS 15. HOUSEKEEPING 16. FIRE PREVENTION (including Hot Work) 17. EMERGENCY EVACUATION AND FIRE PROCEDURE 18. ENERGY ISOLATION TAG & LOCK-OFF PROCEDURE 19. REPORTING AND INVESTIGATING INCIDENTS AND DANGEROUS OCCURRENCES 20. WORKSITE INSPECTIONS 21. HEALTH, SAFETY OR WELFARE NOTICES 22. SMOKING 23. ALCOHOL AND OTHER DRUGS 24. VEHICLES AND MOBILE PLANT 25. MOTORS, MACHINERY AND EQUIPMENT 26. NOISE LEVELS 27. ASBESTOS 28. WORKING ALONE 29. EXCAVATIONS AND TRENCHES 30. WORKING AT HEIGHTS 31. WORKING IN CONFINED SPACES 1. LEGISLATION Contractors, Sub-Contractors and their employees while working on University worksites shall meet the requirements of all relevant Occupational Health Safety & Welfare legislation. 2. WORKSITE INDUCTION Prior to commencement of work at University worksites, the Contractor shall report to the University s Contract Supervisor for OHSW induction. The Contractor shall give this induction to all employees and Sub-Contractors of the Contractor who will be working at the site before commencing work on the site. The Contractor shall keep records of the participants and the induction process. 3. SECURITY Any Contractor or person associated with the contract may be asked by Campus Security at any time to open and disclose the contents of any bag, package, toolbox, or vehicle in their possession or control when entering, leaving or whilst on University premises. Contractors are responsible for security arrangements in relation to plant, tools and equipment and materials required on site during the contract.

68 Contractor OHSW Requirements - Page 2 of 4 4. SAFE WORK PROCEDURES Contractors shall provide a safe system of work for the duration of the contract. They may be required to produce evidence of safe work procedures, training records and their occupational health and safety policies. All personnel on site will be expected to follow safe work procedures and comply with all relevant safety legislation. 5. RISK ASSESSMENTS As required by the Occupational Health Safety & Welfare legislation all items of plant, hazardous substances and electrical equipment must be subject to a risk assessment to minimise the risk of injury. 6. PORTABLE ELECTRICAL EQUIPMENT All contractors portable electrical equipment is to be tested and tagged in accordance with Australian Standard AS 3760 prior to use on University worksites. Testing and tagging of portable electrical equipment is the responsibility of the contractor. 7. RESIDUALCURRENT DEVICES (RCD S) Contractors who use electrical power tools and other portable electrical equipment on University worksites shall do so in conjunction with a Portable Residual Current Device (RCD) tested and maintained in accordance with OHSW Regulations. 8. WORK OF A HAZARDOUS NATURE Contractors are required to implement safe working systems and may be required to produce documentary evidence of: safe work procedures, training records, competency accreditation and licences relevant to specific hazards associated with the contract. All personnel on site will be expected to follow safe work procedures. 9. POTENTIAL HAZARDS The Contract Supervisor shall inform and provide relevant information to the Contractor of any potential hazard or hazardous activity being carried out in the vicinity of the workplace where the Contractor, its employees, sub-contractors and employees are performing work or services in relation to the contract. Contractors and/or their representatives are to immediately report any hazards identified so that appropriate actions can be implemented to reduce the risk of injury or risks to health. 10. USE OF CHEMICALS (hazardous substances) The Contract Supervisor must approve the use of any chemicals (hazardous substances) in or around University premises. Material Safety Data Sheets (MSDS) must be on site for every substance used. The MSDS must be readily available for use in any emergency. An assessment of the use of the substance must be undertaken and the substance used in the least hazardous manner for the work practice and working environment. 11. DELIVERY OF MATERIALS (hazardous substances) Contractors who are expecting deliveries of hazardous substances shall advise the Contract Supervisor of the approximate time and location of the delivery, the name of the organisation making the delivery and the type of goods being delivered. 12. PERSONAL PROTECTIVE EQUIPMENT Contractors must issue their employees with appropriate personal protective equipment for the work being undertaken. The Contractor is responsible for ensuring the correct use of personal protective equipment. 13. PROTECTIVE SCREENS When grinding, sanding and welding, a protective screen must be used to protect and exclude personnel and equipment from hazards. 14. EXPLOSIVE POWER TOOLS Subject to the written approval of the Contract Supervisor and compliance with Government regulations, the use of low velocity tools may be permitted. When in use suitable warning signs must be displayed. Approval will not be granted for the use of high velocity tools. All operators of explosive power tools must have an authorised, current certificate and be over the age of 18.

69 Contractor OHSW Requirements - Page 3 of HOUSEKEEPING The Contractor shall ensure that all means of access and egress in the vicinity of the site are free from obstruction. Any surplus or scrap material must be regularly removed from site in a manner that will not harm the environment. In the event of any spillage of any substance in the vicinity of the workplace, the contractor shall take immediate appropriate action. The contractor shall ensure that at all times there is free and unobstructed access and egress around the worksite. 16. FIRE PREVENTION (including Hot Work) To guard against the risk of fire it is essential to shut off all oxy/acetylene, welding and heating equipment at least thirty minutes prior to leaving the worksite. Prior to vacating the worksite a visual check around the worksite must be undertaken. Suitable fire extinguishers of sufficient capacity must be provided when undertaking any work involving welding, grinding, heat treatment or any work requiring the use of flame. All combustible materials that are not part of the work must be removed from site at the end of each workday. 17. EMERGENCY EVACUATION AND FIRE PROCEDURE In the event of an evacuation (real or for practice purposes) Contractors and their employees are required to follow instructions from the University s designated warden at the site. If no warden is present evacuation will be via the nearest emergency exit. The building will not be re-entered until the all clear is given by the warden or the emergency services. 18. ENERGY ISOLATION TAG & LOCK-OFF PROCEDURE If a Danger Tag or Out of Service tag is fixed to plant, equipment or machinery the equipment shall not be used. Contractors are to strictly adhere to University OHSW Procedure - Energy Isolation Tag and Lock-Off where there is a need to isolate sources of energy in relation to work on University sites. 19. REPORTING AND INVESTIGATING INCIDENTS AND DANGEROUS OCCURRENCES The Contractor is responsible for reporting all incidents occurring at a University worksite which result in injury to a person or damage to property immediately to the Contract. The Contractor shall also keep detailed and timely records of any accidents and shall make those records available to the Contract Supervisor when requested (and copied if necessary). 20. WORKSITE INSPECTIONS The Contractor shall grant the Contract Supervisor access to the contractor s work or services for the purpose of conducting a site OHSW inspection. Where the Contract Supervisor brings to the attention of the Contractor any activity or omission of the Contractor which the Contract Supervisor considers to be a breach of procedures, the Contractor shall immediately take all necessary steps to rectify such breach. 21. HEALTH, SAFETY OR WELFARE NOTICES The Contractor must immediately notify the Contract Supervisor of an Improvement Notice, Prohibition Notice or a Default Notice being issued in relation to the work. In the case of a Prohibition Notice or a Default Notice, any specified work activities must cease until such time as the issuing party is satisfied that adequate measures have been taken to avert, eliminate or minimise any risk to health or safety. 22. SMOKING Smoking of any type is prohibited in all University buildings, including those rented by the University for University purposes, access areas such as lifts, stairwells, corridors and entrance lobbies, storage areas, toilet areas, and lunch rooms, areas adjacent to University buildings where tobacco smoke may accumulate or drift back into buildings, eg doorways, vestibules, proximity to windows or air conditioning intakes. Contractors are to strictly adhere to University OHSW Procedure Smoke Free Work Environment.

70 Contractor OHSW Requirements - Page 4 of ALCOHOL AND OTHER DRUGS Contractors are responsible for ensuring that they or their employees are not, by the consumption of alcohol or a drug, in such a state as to endanger their own health and safety at work or the health and safety of University employees Contractors are to strictly adhere to University OHSW Procedure Alcohol and Drugs in the workplace. 24. VEHICLES AND MOBILE PLANT All motor vehicles brought onto University worksite(s) shall be parked in spaces identified during the induction process. The drivers of all motor vehicles are to observe the speed restrictions, road signs, traffic flows and pedestrian traffic requirements for that worksite. All operators of vehicles on the worksite are to hold appropriate licences. 25. MOTORS, MACHINERY AND EQUIPMENT Stationary internal combustion engines shall not be used within buildings or enclosed areas unless an attached extraction unit is operating and is capable of ensuring that no residual fumes remain in the area. Care must be exercised when positioning the extraction system to ensure that fumes are not drawn into air handling or air conditioning intakes. 26. NOISE LEVELS Noise from equipment being used shall not exceed prescribed levels for hearing conservation (Division 2.10, OHSW Regulations 1995) or recommended levels for areas of occupancy in buildings (refer Australian Standard AS 2107 Acoustics - Recommended design sound levels and reverberation times for building interiors ). Where high noise levels will be produced by certain contractor work operations, consideration shall be given to carrying out the process during a time outside normal occupancy times. 27. ASBESTOS Contractors who encounter during work or suspect that asbestos is present and not contained shall cease work immediately and inform the Contract Supervisor who will arrange for verification of the product and safe removal if necessary. Asbestos and asbestos products are to be removed only by approved persons in accordance with Division 4.2 of the OHSW Regulations, 1995 and Approved Code of Practice. The University Property Unit maintains Asbestos registers. The Asbestos registers are available in hard copy from the Property Unit or are accessible via the Property unit web-site WORKING ALONE If any employees of the contractor are required to work alone, it is the responsibility of the contractor to provide suitable systems of communication to ensure that assistance can be provided should an emergency occur. Also refer to Division 2.14 of the OHSW Regulations, EXCAVATIONS AND TRENCHES Excavation and trenching work shall be carried out in accordance with Division 5.5 of the OHSW Regulations, WORKING AT HEIGHTS Working at Heights shall be carried out in accordance with Division 2.13 of the OHSW Regulations WORKING IN CONFINED SPACES Working in Confined Spaces shall be carried out in accordance with Division 2.4 of the OHSW Regulations, 1995, Australian Standard AS2865 Safe Working in a confined Space and OHSW Procedure Confined Space Entry.

71 UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE CONTRACTOR S PERMIT TO WORK OHSW27 Page 1 of 2 TO BE COMPLETED BY THE CONTRACTOR Contractor Company Name: Contractor Name: Contract Supervisor Name: Campus/Worksite: Location of the Work: Date: Period of work Ph: Expiry Date SAFE WORK METHOD Work Description Please indicate with a tick ( ) WILL YOU BE: Working on the roof Spray painting Window cleaning Asbestos work Working in confined spaces Abrasive blasting Using power tools Welding or abrasive cutting Trenching Demolishing Erecting scaffolding Using chemicals Working at heights Explosives Confined Space Other specify Access to high voltage workstation Hot work Note: A work permit (which may be required by OHSW Legislation) and specific to the work activity that will be carried out is to be forwarded to the Contract Supervisor along with any other relevant work permits. Do you have a safe work method(s) to undertake the work indicated above? Please circle Have you been trained and are you competent in the safe work method(s)? Please circle yes / no yes / no Hazard Identification What are the hazards relating to this task, what could go wrong? If more than one provide separate list Risk Assessment How likely is this hazard? Very Likely Likely Unlikely What could be the outcome? Death Serious Injury First Aid Hazard Control How will you control this hazard? Detail your safe work method here (attach extra pages if needed).

72 UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE CONTRACTOR S PERMIT TO WORK OHSW27 Page 2 of 2 I. of Contractor Name please print Company Name declare that I/We a) understand the obligations under the Occupational Health Safety & Welfare Act, 1986, Regulations, approved Codes of Practice and Australian Standards that are applicable to the work being undertaken and to the circumstances in which the contract will be effected b) Have received a copy of and understand the requirements of the UniSA Contractors Induction kit and will abide by the universities safety rules as stated in the UniSA OHSW Procedure Contractor Management. c) have certification and qualifications that are required by legislation d) will cease working, make safe the workplace and contact the Contract Supervisor if I become aware of danger to myself or others during the period of the contract e) have a current Workers Compensation and Rehabilitation Insurance Policy in place f) agree to the Contractor OHSW Requirements in the University OHSW Procedure Contractor Management. Signed: Contractor Date / / TO BE COMPLETED BY THE CONTRACT SUPERVISOR The contractor has been admitted to the University site to provide the services as detailed in the contract. An additional Hazardous Work Permit has / has not been issued. Contractor OHSW Site Induction has been arranged before work will commence on the site Signed: Contract Supervisor Date / /

73 UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE CONTRACTOR OHSW INDUCTION CHECKLIST Workplace: Location: Date: Name of Contractor s Commencement Date representative: Contract Work: Contract Supervisor OHSW28 Work area Orientation Emergency Procedure Emergency exits Fire extinguisher location Parking requirements Occupational Health & Safety Licenses/certification requirements Smoke Free Work Environment Resolution of Issues Incident Reporting Procedures Hazards present in work area Type of hazard Safe practices to be followed Work practices for particular work Asbestos Emergency Procedures Fire Bomb threat Building evacuation Fire warden(s) Clean up FOLLOW-UP AFTER ONE WEEK Review work practices & procedures with contractor or contractor s representative Answer contractor s questions Contract Supervisor signature: Date: Speed limits Washing and toilet facilities Drinking water facilities Restricted areas Standard Operating Procedures Material Safety Data Sheets (MSDS) Location of MSDS Training in MSDS (if necessary) Confined spaces Hot work Danger & Out of Service Tags/Locks Roof Access First Aid First Aid Officer First Aid kit location Record Provide a copy of this completed checklist to the Contractor and retain this original with Your OHSW records Contractor s Representative signature: Date:

74 UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE ENERGY ISOLATION TAGS AND LOCK-OFF This procedure outlines the requirements for the management of energy isolation through a tag and lock off system at University of South Australia workplaces. The intention is to minimise risks to health and safety from any potential accidental or unexpected start-up of machinery or plant, movement of materials during servicing or any other interaction or contact with or exposure to hazardous energy. DOCUMENTS/FORMS Examples of Danger Tag and Out of Service Tag DEFINITIONS Energy electricity, gas, oil, water and other fluids, air, steam, oxygen, or other stored energy source, flywheel, mechanical, gravitational, kinetic, chemical, the level or intensity of which could pose a threat to a person(s) safety. Isolator a device that physically prevents the transmission or release of potentially damaging energy. Isolated the condition into which equipment or plant is placed when all sources of potentially damaging energy are prevented or blocked by the operation of isolators. De-isolation the restoration of the plant, equipment or process to operational condition. Non-positive Isolator a device such as a valve, push button, emergency stop, wedge, controller etc that does not directly or positively prevent or block the source of potentially damaging energy. Personal Lock a lock identified as a personal lock and being used by the protected person for personal protection. Working on the plant, equipment or a process means carrying out repairs, cleaning or making adjustments to the plant, equipment or process. Danger Tag is a RED & BLACK tag used to indicate the isolation of an energy source, to identify the person to be protected by the isolation and the status of equipment and machinery regarded as unsafe in normal usage conditions. Out of Service Tag is a BLACK & YELLOW tag used to prevent damage to plant and equipment, and/or prevent people from using or operating equipment that is faulty and in need of repair. ROLES AND RESPONSIBILITIES Line Managers are responsible for: the implementation of this procedure in their area of responsibility and accountability. consulting with and coaching employees in relation to the implementation of this procedure monitoring employee conformance to the requirements of this procedure. Employees are responsible for: not placing themselves or others at risk of injury. conforming to the requirements of this procedure. consulting with Line Managers and other employees in relation to a hazard analysis associated with energy isolations and out of service requirements.

75 PROCEDURE Energy Isolation Prior to starting work where a person could be endangered by the operation of plant or equipment or the release of stored energy, the plant, equipment or process must be properly isolated, stored energy released, the source of energy isolated and a Danger Tag and Personal Lock affixed to the main isolator(s). The following steps shall be followed by the person carrying out the isolation in consultation with the person responsible for the plant, equipment or process to be isolated: 1. The person responsible for the plant, equipment or process shall be notified as to the reason and duration of the isolation 2. The person responsible for the plant, equipment or process is to notify all affected personnel 3. The person responsible for the plant, equipment or process and the person(s) carrying out the isolation shall complete a hazard analysis by, identifying the type and magnitude of the energy source, understanding the hazards associated with the energy source and ensuring the isolation controls the hazard(s) 4. Identify the type and location of every energy source control and isolation point 5. Place the isolators in a safe position 6. The person(s) who are to work on the plant, equipment or process shall place a personal lock on each isolation point 7. The person responsible for the plant and the person(s) who are to work on the plant, equipment or process shall confirm that the correct isolator(s) have been identified and placed in a safe position 8. Verify that the isolation is effective by trying to start the plant or equipment or process 9. Following verification of the isolation a personal Danger Tag shall be affixed to each personal lock by all personnel who are to work on the plant, equipment or process. De-isolation The restoration of the plant, equipment or process to operating condition is to be carried out by the person who is responsible for completing the work on the plant, equipment or process. De-isolation shall be achieved by: checking the plant, equipment or process for operational integrity, including the completion of all work and the removal of non-essential items, tools and equipment from around the work area verifying that operation controls for the plant, equipment or process are in the Off or Neutral position. removing Personal Lock(s) and Danger Tag(s) from isolation point(s) and placing the isolations in the required position. Danger Tags and Personal Locks must only be removed by the person(s) who affixed them and who are to be protected by their use. A local procedure is to be developed for the removal of Danger Tags and Personal Locks in circumstances where the owner cannot be contacted to effect removal. Notifying the person responsible for the plant, equipment or process that work is completed and the plant, equipment or process is restored to operational condition.

76 Out of Service Tags Out of Service Tags shall be attached to an item of plant, equipment or process which is taken out of service due to a fault, damage or malfunction or is not safe. Out of Service Tags shall be used when repairs, cleaning or the adjustment of an item of plant, equipment or process is not completed and is still unserviceable or unsafe. The Out of Service Tag shall be securely fixed to the isolator with the appropriate details completed on the tag explaining the reason for the out of service condition. When the initial reason for the placement of the Out of Service Tag no longer exists, the Out of Service Tag may be removed by the person who attached the tag, the Line Manager or Supervisor responsible for the operation of the plant, equipment or process or the person who affected repairs. Supply of Danger Tags and Out of Service Tags Local worksites are to ensure that a supply of Danger Tags and Out of Service Tags is maintained in locations accessible to users. Danger Tags and Out of Service Tags shall be the form as indicated in the attachment to this procedure. REFERENCES University OHSW&IM Policy University OHSW&IM 2001/2003 Action Plan University OHSW&IM Management System Occupational Health Safety and Welfare Act 1986 Occupational Health Safety and Welfare Regulations 1995 AS/NZS 4804: 1997 Occupational Health and Safety Management Systems General guidelines on principles, systems and supporting techniques. Date of Issue: 15 January 2001 Review Date: January 2003

77 UNIVERSITY OF SOUTH AUSTRALIA Danger Tag EXAMPLES OF DANGER TAG AND OUT OF SERVICE TAG Out of Service Tag

78 UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE INCIDENT REPORTING AND INVESTIGATION This procedure outlines the requirements for the investigation and reporting of incidents that occur at the University. It also outlines the requirements for statutory reporting of notifiable work-related injuries and dangerous occurrences, a mandatory requirement under the Occupational Health Safety and Welfare Act DOCUMENTS/FORMS OHSW9 Incident Report DEFINITIONS Accident means an unplanned occurrence or incident that causes or contributes to personal injury or damage to property. Incident an event that causes or could cause harm (illness, injury or damage) to persons, plant, material or the environment. Incident includes a near miss, that is an event that caused no harm or damage but had the potential to do so. Hazard a situation that has the potential to harm a person, the environment or damage property. ROLES AND RESPONSIBILITIES Line Managers are responsible for: the implementation of this procedure in their area of responsibility and accountability the investigation and reporting of incidents in their area of responsibility and accountability, the completion of incident report forms within 24 hours of incidents occurring using Form OHSW9 Incident Report the implementation of appropriate risk control measures identified to prevent recurrence of incidents consulting with employees in relation to measures to prevent recurrence of incidents. Employees are responsible for: not placing themselves or others at risk of injury reporting incidents to their manager or health and safety representative as soon as possible after the event participating in the development of appropriate risk control measures to prevent recurrence of incidents using control measures as required and any other action taken, which is designed to protect health and safety. Health and Safety Representatives are responsible for: participating in the investigation of incidents and assisting with the development of measures to prevent recurrence of incidents. PROCEDURE All incidents shall be investigated and reported on the Incident Report (Form OHSW9).

79 Incidents resulting in lost time injury shall be investigated as soon as possible after the occurrence. Within 24 hours, the completed Incident Report and a Workers Compensation Claim Form if applicable shall be forwarded to the Line Manager and OHSW Services. Immediately notifiable work related injuries or a dangerous occurrence must be reported to the Department of Administrative and Information Services (DAIS) Workplace Services, by telephone or facsimile as soon as practicable after their occurrence. Immediately notifiable work related injuries are: any death: any injury that has acute symptoms associated with exposure to a substance at work any injury that requires treatment as an in-patient in a hospital immediately after the injury. A notifiable dangerous occurrence is any incident or event which arises from operations carried on at a workplace and which causes an immediate and significant risk to a person, the specific dangerous occurrences which must be reported are; the collapse, overturning or failure of the load bearing of any scaffolding, lift, crane, hoist or mine-winding equipment. damage to or malfunction of any other major plant; the unintended collapse or failure of an excavation more than 1.5 metres deep (including any shoring): the unintended collapse or partial collapse of a building or structure; the unintended collapse of the floor, wall or ceiling of a building being used as a workplace; an uncontrolled explosion, fire or escape of gas, hazardous substance or steam. an electrical short circuit, malfunction or explosion; an unintended event involving a flood of water, rock burst, rock fall or collapse of ground; breathing apparatus malfunctioning to the extent that the user's health is endangered; any other unintended or uncontrolled incident or event arising from operations carried on at a workplace REFERENCES University OHSW&IM Policy University OHSW&IM 2001/2003 Action Plan University OHSW&IM Management System Occupational Health Safety and Welfare Act 1986 Occupational Health Safety and Welfare Regulations 1995 Workers Rehabilitation and Compensation Act 1986 AS/NZS 4804: 1997 Occupational Health and Safety Management Systems General guidelines on principles, systems and supporting techniques. AS Workplace Injuries and Disease Recording Standard. Date of Issue: 10 December 2001 Review Date: December 2002

80 Workplace: UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE INCIDENT REPORT Date: OHSW9 Page 1of 2 NOTES: Complete all parts of this form - incomplete forms WILL be returned to the relevant person. If this is a lost time incident the Line Manager and the OHSW Services shall be advised within 24 hours of the incident occurring. All other incidents shall be advised within 72 hours of the incident EMPLOYEE DETAILS Family name: Other Name: Sex: M F Contact Phone No: (w) (h) Date of Birth Occupation: Payroll No: Current Classification: Employment Status: Full Time Part time Casual Student Contractor Usual Work Location: INCIDENT DETAILS Visitor Other (Please Describe)... Date: / / Time of Incident: am / pm Location where Incident occurred: What happened? (Describe what happened, and include the events that led to the occurrence of this incident) This incident resulted in: Injury No injury Property damage Hazard Near miss This incident was reported to (Supervisor) on / /. INJURY/DAMAGE DETAILS If injury was sustained, what part of the body was affected OR if damage occurred what was damaged? MEDICAL TREATMENT Was any medical treatment sought/provided? When / / at am / pm From whom? Has any time been lost from work? (More than 1 complete shift) Yes No If so, have you returned to work? Yes No Have/will medical expenses been incurred? Yes No Uncertain at this time # If MEDICAL EXPENSES are incurred a WorkCover "Worker Report Form" must be completed. Were there witnesses? If so, name of witness(s): Contact Phone: Employee signature Date:

81 Workplace: UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE INCIDENT REPORT Date: OHSW9 Page 2 of 2 INVESTIGATION: Is the responsibility of the Supervisor/Line Manager, and is to be completed in consultation with the employee and the health and safety representative. Please describe the events and contributing factors that led to the incident occurring: Did any of the following factors contribute to the incident/accident? No written procedure Incorrect method used Outdated Method No training provided Inadequate training provided Needs on-going training Lack of equipment Equipment fault Lack of maintenance Equipment not available Inappropriate equipment used Inadequate ventilation / lighting Inadequate space Inadequate storage Poor access Unsuitable work area Possible lack of attention Excessive workload RISK CONTROL: Supervisor/Line Manager should complete in consultation with the Health & Safety Representative and the Injured/Reporting Employee Recommendation to prevent recurrence of this incident/accident Change in induction program Proposed Taken Change in on-going training Proposed Taken Equipment/machinery modifications Proposed Taken Change to work procedure Proposed Taken Change to work environment Proposed Taken Equipment/machinery maintenance Proposed Taken Other job redesign Proposed Taken Other preventative action Proposed Taken Post trauma counselling Proposed Taken Exacerbation of a previous injury No change proposed Rehabilitation required Yes No Rehabilitation Consultant advised Date: SUPERVISOR S ACTION - The Supervisor is responsible and accountable for ensuring that the appropriate action has been taken to minimise or eliminate the possible risk of injury or re-occurrence. I have taken the following action to reduce/ eliminate the risk of re-injury or re-occurrence: Referred to Line Manager Placed issue on Local Action Plan Consulted employees Advised Senior Manager Advised Senior Consultant, OHSW Advised Rehabilitation Consultant Estimated cost: $ Name: Signed: Date:

82 UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE RECORD KEEPING This procedure outlines the preferred requirements and practices for keeping of OHSW records in accordance with OHSW legislative requirements and the requirements of the University OHSW&IM Management System at all workplaces. The records also assist with the auditing of systems and meet Self-Insurer Performance Standards requirements. RESPONSIBILITIES AND/OR AUTHORITIES Line Managers and Supervisors are responsible for maintaining OHSW&IM records relevant to the operations in their area of responsibility. OHSW Services is responsible for ensuring systems are provided to assist the process of maintaining records. PROCEDURE Records (or copies where appropriate) shall be readily accessible, periodically reviewed and updated as necessary. This procedure should be read in conjunction with the following University OHSW Procedures which include forms for record keeping or require minuting: Action Plans Action Plan Performance Review Auditing Confined Space Entry Consultation/OHSW Committees Contractor Management Election of Health and Safety Representatives Electrical Equipment Inspection and Testing Energy isolation tags and lock-off Ergonomics, Screen-based Workstation Fieldwork Health and Safety First Aid Hazard Management Hazardous Substances Management Incident Reporting and Investigation Injury Management Licences, Registrations and Certificates of Competency Manual Handling OHSW Induction Outstanding Actions Management Signage Standard Operating Procedure Development Training Needs and Planning Working from Home Worksite Inspection

83 Additional procedures may be added between revisions of this document CROSS REFERENCES University OHSW&IM Policy University OHSW&IM 2001/2003 Action Plan University OHSW&IM Management System Occupational Health, Safety & Welfare Act, 1986 Occupational Health, Safety & Welfare Regulations, 1995 FURTHER ASSISTANCE Further advice and assistance on keeping OHSW&IM records is available from OHSW Services, contact (08) Date of Issue: 26 February 2002 Review Date: March 2003

84 Records Line Managers shall maintain the following records. RECORD FORM RETENTION Check 1. Records relevant to the OHSW & IM Management System Action Plans Workplace Action Plan OHSW3 Records of OHSW Action Plans must be kept for at least two years from the expiry date of the plan. Action Plan Performance Report OHSW7 Records of OHSW Action Plan performance reports are to be maintained for at least two years. Auditing Legislative Compliance Audit OHSW6 Records of OHSW Legislative audits must be kept for at least seven years from the date of the report. Auditing Workplace Management Audit OHSW4 Records of OHSW Management Audits must be kept for at least seven years from the date of the report. Confined Space Register and copies of completed confined space entry permits. Register maintained by Property Unit OHSW35-38 Records of training in relation to confined spaces must be kept for at least 5 years from the date of training. Entry permits for confined space must be kept for at least 1 year. Risk assessments must be kept for 5 years. Contractor Permit to Work and Induction OHSW27, 28 Confined Space Entry Permits must be kept for at least one year. Electrical Equipment Register and Residual Current Devices Register OHSW25 & 26 Records of each test result for RCD s (Residual Current Devices) and the electrical testing and tagging of moveable electrical equipment, must be kept for a period of at least 5 years. Ergonomic Workstation Assessments OHSW45 Records of Ergonomic Workstatrion Assessments must be kept for at least 5 years from the date of the assessment. First Aid Incident Register Located in each First Aid Kit Records of First Aid Incident reports must be kept for at least seven years. Fieldwork activity acknowledgment OHSW39 The Fieldwork acknowledgment form is to be kept for two years. Health and Safety Representatives OHSW22 and WorkCover Notification Health and Safety representatives nomination and election forms must be retained for at least one year.

85 RECORD FORM RETENTION Check Hazard Register and associated risk assessments completed for plant, equipment and other identified hazards Hazardous Substances Register and associated risk assessments Incident Reports and evidence of reporting notifiable injury and dangerous occurrences to DAIS Workplace Services Inspectors. Licence and Certificate of Competency Register, DAIS Plant Register, Licensed Dangerous Substance Register, Radioactive Sources Registers OHSW1, 2, 40 & 41 Risk assessments of any plant, tests, maintenance, inspection, commissioning or alteration must be kept for the currency of that assessment and for at least 5 years. This applies to the following: registered plant (OHSW Reg Sch4 Pt2), concrete placing units industrial lift trucks, mobile cranes, hoists, boom type elevating work platforms, presence sensing safeguarding systems, vehicle hoists, gantry cranes greater than 5 tonnes, bridge cranes greater than 10 tonnes, mast climbing work platforms, abrasive blasting. OHSW10-12 Risk assessments in respect to hazardous substances used in the workplace must be reviewed at intervals not exceeding 5 years and kept for at least 5 years. Assessment reports indicating a need for atmospheric monitoring or health surveillance and the results of monitoring or health surveillance must be kept for at least 30 years. An asbestos register must be maintained identifying the type, condition and location of asbestos in relation to any buildings or plant. (This is maintained by the Property Unit and is available on their website.) OHSW9 Work-related injury records must be kept for a least 3 years. OHSW30-34 License and Certificate of Competency records must be maintained for 30 years. The Plant Register is to be maintained as a permanent record. The Dangerous Substances register must be maintained for a period of not less than 40 years. The Radioactive Sources substance register must be maintained for a period of not less than 40 years. Manual Handling Risk Checklist OHSW46 Records of Manual Handling Risk Assessment checklists must be kept for 7 years from the date of the assessment. OHSW Induction Checklists OHSW23 OHSW Inductions checklists are to be maintained for seven years. Outstanding Actions Management OHSW24 The Outstanding Actions Management register is to be maintained for one year after the last entry. Safety Sign Requirements OHSW48 Records of signage requirements are to be retained for 5 years.

86 RECORD FORM RETENTION Check Standard Operating Procedures relevant copies Training needs analysis, Training Plan and the Training Attendance Register Worksite Inspections General Environment or Laboratory Minutes of meetings dealing with OHSW issues OHSW8 or Manufacturer s Operator s Manual OHSW13, 14 & 15 Standard Operating Procedures are to be retained for 45 years Records of training in relation to confined spaces must be kept for at least 5 years from the date of training. OHSW16 & 17 Worksite Inspection checklists are to be retained for a period of not less than seven years. Health and safety committee minutes must be kept for at least 3 years. 2. Other Records prescribed by regulation

87 81,9(56,7<2)6287+$8675$/,$ 2+6:352&('85( 602.()5((:25.(19,5210(17 7KLVSURFHGXUHRXWOLQHVWKH8QLYHUVLW\ VUHTXLUHPHQWVDQGSUDFWLFHVIRUDVPRNHIUHHZRUN HQYLURQPHQWDWDOO8QLYHUVLW\ZRUNSODFHV 7KH8QLYHUVLW\DFFHSWVWKHYDVWERG\RIHYLGHQFHWKDWWKHVPRNLQJRIWREDFFRLVKDUPIXOWR KHDOWK0HGLFDOHYLGHQFHFRQFOXVLYHO\OLQNVVPRNLQJZLWKYDULRXVGLVHDVHVDQGLOOKHDOWK LQFOXGLQJOXQJFDQFHUEURQFKLWLVHPSK\VHPDDQGFDUGLRYDVFXODUGLVHDVH 7KHUHLVDOVRQRZPRXQWLQJHYLGHQFHWKDWFKURQLFLQKDODWLRQRIVLGHVWUHDPDQGH[KDOHG WREDFFRVPRNHLQFRQILQHGVSDFHVSUHVHQWVDPHDVXUDEO\LQFUHDVHGKHDOWKULVNWRQRQ VPRNHUVDQGLVDVRXUFHRIGLVFRPIRUWWRPDQ\ 5(63216,%,/,7,(6$1'25$87+25,7,(6 /LQH0DQDJHUV6XSHUYLVRUVDUHUHVSRQVLEOHIRU œ WKHLPSOHPHQWDWLRQRIWKLVSURFHGXUHZLWKWKHLUVWDIIYLVLWRUVFOLHQWVVWXGHQWVDQG FRQWUDFWRUV œ SURYLGLQJDVVLVWDQFHWRWKRVHVWDIIPHPEHUVZKRJHQXLQHO\UHTXHVWVXSSRUWWRDWWHQG VSHFLILFUHPHGLDOSURJUDPV (PSOR\HHVDUHUHVSRQVLEOHIRU œ FRPSO\LQJZLWKWKHVPRNHIUHHZRUNSODFHSURFHGXUH œ LQIRUPLQJLQYLWHGPHPEHUVRIWKHSXEOLFWR8QLYHUVLW\SUHPLVHVRIWKH8QLYHUVLW\VPRNLQJ SROLF\ 352&('85( 7KH8QLYHUVLW\UHTXLUHVWKDWVPRNLQJLVSURKLELWHGLQ œ DOO8QLYHUVLW\EXLOGLQJVLQFOXGLQJWKRVHUHQWHGIRU8QLYHUVLW\SXUSRVHV7KLVLQFOXGHV DFFHVVDUHDVVXFKDVOLIWVVWDLUZHOOVFRUULGRUVDQGHQWUDQFHOREELHVVWRUDJHDUHDVWRLOHW DUHDVDQGOXQFKURRPV œ DUHDVDGMDFHQWWR8QLYHUVLW\EXLOGLQJVZKHUHWREDFFRVPRNHPD\DFFXPXODWHRUGULIWEDFN LQWREXLOGLQJVHJGRRUZD\VYHVWLEXOHVSUR[LPLW\WRZLQGRZVRUDLUFRQGLWLRQLQJLQWDNHV œ 8QLYHUVLW\YHKLFOHV 7KLVSURKLELWLRQDSSOLHVWRDOO8QLYHUVLW\VWDIIDQGWRDOOFRQWUDFWRUVYLVLWRUVFOLHQWVVWXGHQWV DQGDQ\RWKHUSHRSOHHQWHULQJRUXVLQJDQ\RIWKH8QLYHUVLW\VZRUNVLWHVYHKLFOHVRUIDFLOLWLHV,WVKRXOGEHQRWHGWKDWVPRNLQJLVSURKLELWHGE\ODZLQFHUWDLQSODFHVIRUH[DPSOHZKHUH WKHUHLVDULVNRIILUHRUH[SORVLRQRULQIRRGSUHSDUDWLRQKDQGOLQJDQGVHUYLQJDUHDV 1R6PRNLQJ6LJQVVWDWLQJWKDWVPRNLQJLVSURKLELWHGLQEXLOGLQJVZLOOEHSODFHGDWDOO HQWUDQFHVWREXLOGLQJ 5HFHSWDFOHVIRUWKHH[WLQJXLVKLQJRIWREDFFRSURGXFWVZLOOEHSURYLGHGQHDUHQWU\SRLQWVWR 8QLYHUVLW\EXLOGLQJV 7KH8QLYHUVLW\ZLOOVXSSRUWWKRVHHPSOR\HHVZKRZLVKWRFHDVHVPRNLQJE\PDNLQJSURYLVLRQ IRUDWWHQGDQFHDWDSSURYHGVPRNLQJFHVVDWLRQSURJUDPVLQZRUNWLPH1RUPDOO\WKH PD[LPXPDPRXQWRIWLPHDOORZHGLVKRXUVSDLGOHDYH

88 7KH8QLYHUVLW\ZLOODUUDQJHZKHUHGHPDQGLVVKRZQIRUVWXGHQWVWRDWWHQGVPRNLQJ FHVVDWLRQSURJUDPV7KHVHSURJUDPVVKRXOGEHDUUDQJHGDIWHUKRXUVRUGXULQJOXQFKKRXUVWR IDFLOLWDWHVWXGHQWLQYROYHPHQW (PSOR\HHVZKRIDLOWRFRPSO\ZLWKWKHSURFHGXUHPD\EHFRXQVHOOHGRUVXEMHFWWRHVWDEOLVKHG GLVFLSOLQDU\SURFHGXUHV 5()(5(1&(6 8QLYHUVLW\2+6:,03ROLF\ 8QLYHUVLW\2+6:,0$FWLRQ3ODQ 8QLYHUVLW\2+6:,00DQDJHPHQW6\VWHP 2FFXSDWLRQDO+HDOWK6DIHW\ :HOIDUH$FW2FFXSDWLRQDO+HDOWK6DIHW\ :HOIDUH 5HJXODWLRQV %\/DZRIWKH8QLYHUVLW\RI6RXWK$XVWUDOLD$FW )857+(5$66,67$1&(,QIRUPDWLRQSDFNDJHVDQGDVVLVWDQFHRQVPRNLQJFHVVDWLRQSURJUDPVZLOOEHDYDLODEOHXSRQ UHTXHVWIURP2+6:6HUYLFHV 'DWHRI,VVXH-DQXDU\ 5HYLHZ'DWH -DQXDU\

89 University of South Australia Asbestos Management Policy University of South Australia 6 June 2002 A Partnership between PPK E&I Pty Ltd and A Parsons Brinckerhoff International (Australia) Pty Ltd Asbestos Code of Practice for University of South Australia Parsons Brinckerhoff Companies

90 PPK Environment & Infrastructure [2002] This document is the property of PPK Environment & Infrastructure ("PPK"). This document and the information contained in it are solely for the use of the authorised recipient and this document may not be used, copied or reproduced in whole or part for any purpose other than that for which it was supplied by PPK. PPK makes no representation, undertakes no duty and accepts no responsibility to any third party who may use or rely upon this document or the information contained in it. Author:... Reviewer:... Approved by:... Signed:... Date:... Distribution:... T:\IAN\WEB SITE FILES\POLICIES AND PROCEDURES\ASBESTOS MANAGEMENT POLICY.DOC

91 Contents Section 1 - Introduction 4 UniSA Asbestos Policy 5 Consultation 5 Information and Training 5 Assessment and Register 5 Control 5 Standard Operating Procedures 5 Section 2 - Responsibilities 6 Director: Property 6 Asset Manager 6 Contract Supervisor 6 Line Manager 7 University Employees 7 Maintenance Staff and Contractors 7 Section 3 - Standard Operating Procedures 8 Index Of Standard Operating Procedures 8 SOP-001 Personnel Entering Asbestos Contaminated Roof & Ceiling Spaces 9 SOP-002 Vinyl Floor Tiles (VFT s) 12 SOP-003 Asbestos Backed Vinyl Flooring (ABVF) 16 SOP-004 Asbestos Fibre Cement Products (AFCP) 20 SOP-005 Asbestos Containing Fire Doors (ACFD) 24 SOP-006 ZELEMITE Asbestos Electrical Backing Boards (AEBB) 28 SOP-007 Cleaning & Maintenance of Personal Protective Equipment (PPE) 32 SOP-008 Unexpected Occurrences of Suspected Asbestos Containing Materials 37 Section 4 Standard Forms 40 Index of Standard Forms 40 PRO Asbestos Permit to Work Form 41 PRO Environmental Air Monitoring Report Form 42 PRO Asbestos Works Awareness Form 43 PRO Personal Protective Equipment Inspection Log Form (not currently available) 44 T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 3 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

92 Section 1 - Introduction It is well recognised that adverse health effects, including lung cancer and mesothelium, can arise from inhalation of airborne asbestos fibres. The risk of such disease increases as the degree of exposure to airborne asbestos fibres increases. Asbestos-containing building materials have been used in the past in a large number of applications, especially in the 1950s to mid 1970s. Consequently, many University buildings contain asbestos products. These products do not pose risk to health unless the material is disturbed, leading to the release of airborne asbestos fibres. In April 1991, legislation was introduced in South Australia under the Occupational Health Safety & Welfare Act (1986) specifically pertaining to the management of asbestos in the work place. The South Australian Asbestos Code of Practice establishes duties of building owners and other persons in possession of plant or buildings that contains or has asbestos on it. (This asbestos is referred to as installed as it has been put into place in or on a building, structure or plant as a building material or cladding, to provide insulation or fireproofing, or for some other similar purpose). UniSA, as part of its Occupational Health, Safety and Welfare Program is committed to the protection of staff, students and contractors from potentially hazardous substances. UniSA has an ongoing program of asbestos management, that will continue (until as far as reasonably practicable to do so) until all asbestos is eliminated from UniSA occupied buildings. UniSA has developed this Code of Practice and Standard Operating Procedures to ensure that staff, students and contractors are not exposed to airborne asbestos fibres, particularly during any maintenance or building work activities within USA properties and workplaces. Section 2 of this code details the responsibilities of individual Line Managers, employees and contractors. Section 3 lists all of the relevant Standard Operating Procedures (SOP s). T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 4 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

93 The aim of this Asbestos Policy is to: UniSA Asbestos Policy provide all staff, students and contractors with a safe working environment in accordance with South Australian Asbestos Regulations 1995 and other relevant South Australian statutory requirements of the Occupational Health Safety & Welfare Act 1986; prevent adverse health effects that may result from exposure to airborne asbestos fibres; continue working towards an asbestos-free working environment for all staff, students and contractors. The University of South Australia (UniSA) recognises that the achievement of an asbestosfree working environment is a long-term goal. Until this is achieved, UniSA will provide: Consultation Ensure full and proper consultation at all stages of policy implementation, and any subsequent reviews that are undertaken. Information and Training Ensure that all relevant UniSA maintenance staff and contractors are provided with information and training on the health risks of asbestos, the operation of this Asbestos Policy and the implementation of the Safe Work Procures. Assessment and Register Ensure that any assessment or potential health risks from asbestos-containing materials in the UniSA workplace is undertaken by competent personnel. Develop and maintain an Asbestos Materials Register, that documents the location, type and condition of any asbestos-containing materials found to be present within UniSA buildings. This will include updating of the Register on an annual basis. Control Remove all asbestos-containing materials from the UniSA workplaces where the assessment has deemed the asbestos materials to constitute a risk to health. Label any known asbestos-containing materials and implement an appropriate Standard Operating Procedure to control any work that may lead to disturbance of these materials. Where practicable to do so no further asbestos-containing materials will be purchased for use in any UniSA workplace. All heads of schools and units shall advise the Property Unit of any asbestos containing products and/or equipment brought onto University sites. Standard Operating Procedures. Standard Operating Procedures Develop, implement and regularly review Standard Operating Procedures including training and monitoring, for work undertaken by UniSA personnel and contractors, that has the potential for causing exposure to airborne asbestos fibres. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 5 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

94 Section 2 - Responsibilities Director: Property The Director: Property is responsible for establishing, maintaining and continuously improving a pro-active Asbestos Management System that includes the: preparation of an annually updated Asbestos Register of all UniSA buildings and structures containing asbestos products, in compliance with the Asbestos Regulations 1995 (as amended), Section ; establishment of an asbestos management plan; development and implementation of Standard Operating Procedures to ensure that asbestos is handled in a way to minimise the potential for release of asbestos fibres to atmosphere when working with or around asbestos; and appropriate procedures for the removal and disposal of asbestos contaminated material in accordance with legislative requirements. Asset Manager The Asset Manager is responsible for: Ensuring copies of the Asbestos Register, Asbestos Management Plan and SOP s are provided to all Project Managers for any/all campus specific activities. Ensuring that any work in the building or on plant and equipment that may disturb asbestos is only undertaken in strict accordance with the SOP s, the requirements of South Australian Occupational Health Safety & Welfare Act 1986 and the Asbestos Regulations (as amended) Ensuring the appropriate Line Manager advises the Contracts Manager: Maintenance of all alterations or changes made to installed asbestos containing materials through appropriate documentation Ensuring the Contracts Manager: Maintenance records all alterations or changes made to installed asbestos containing materials on the UniSA Asbestos Register. Ensuring that no further asbestos containing materials will be purchased for use in any UniSA workplace where practicable to do so. Implementing appropriate asbestos hazard control methods, including the use of qualified consultants and licensed asbestos removal contractors. Ensuring that UniSA maintenance staff and/or contractors who are required to undertake work that may disturb asbestos (excluding asbestos removal) are trained in the use of SOP s. Contract Supervisor The Contract Supervisor is the person nominated by the Line Manager to administer the contract. Contract Supervisors are responsible for: the implementation of this procedure in their area of responsibility and accountability ensuring the induction of the contractor or the contractor s nominated representative in accordance with the OHSW Procedure OHSW Induction the management of contractors in relation to site specific hazards and ensuring contractors proposed work methods do not place University employees at risk advising the relevant Line Manager when the work will be conducted in the workplace of another Line Manager. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 6 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

95 Line Manager The Line Manager is responsible for consulting with staff and/or health and safety representatives on OHSW matters and participating in consultative forums designed to contribute to the improvement of workplace health and safety. University Employees University employees are responsible for: not placing themselves or others at risk of injury reporting work methods of contractors that place University employees at risk. Maintenance Staff and Contractors All maintenance staff and or Contractors internal and external to UniSA who engage in any Asbestos related works shall: Adhere strictly to the Asbestos Management System and SOP s for buildings, plant and equipment in which they work including, and in particular, the requirements of this Code of Practice, South Australian Occupational Health Safety & Welfare Act 1986 and the Asbestos Regulations (as amended) Notify the designated Contract Supervisor of the specified works immediately, of any potential or actual asbestos hazard, that may have not been previously identified, or any deterioration in the condition of asbestos products included in the Asbestos Register. Not undertake work that may disturb asbestos products unless authorised to do so, in accordance with the Asbestos Management System and the requirements of the South Australian Occupational Health Safety & Welfare Act 1986 and the Asbestos Regulations (as amended) T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 7 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

96 Section 3 - Standard Operating Procedures Index Of Standard Operating Procedures SOP1 Personnel Entering Asbestos Contaminated Roof & Ceiling Spaces Procedure SOP2 Vinyl Floor Tiles (VFT s) Procedure SOP3 Asbestos Backed Vinyl Flooring (ABVF) Procedure SOP4 Asbestos Fibre Cement Products (AFCP) Procedure SOP5 Asbestos Containing Fire Doors (ACFD) Procedure SOP6 Asbestos Electrical Backing Boards Zelemite (AEBB) Procedure SOP7 Cleaning & Maintenance of Personal Protective Equipment (PPE) Procedure SOP8 Unexpected Occurrences of Suspected Asbestos Containing Materials Procedure T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 8 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

97 SOP-001 Personnel Entering Asbestos Contaminated Roof & Ceiling Spaces 1. Introduction This SOP has been developed in response to the possible presence of residual asbestos contamination in the ceiling space of the Reid Building, City East Campus. This has resulted in the need to provide and maintain a safe system of work for all maintenance and contractor personnel when working in an environment that has residual asbestos contamination or installed asbestos materials. Residual asbestos contamination has the potential to be found throughout ceiling space in a number of ways (but not limited to): adhering to the tops of the ceiling T bar grid; adhering to the underside of the soffit and structural steel/timber; This SOP forms part of the University of South Australia Asbestos Management Plan and the University of South Australia Policies and Procedures. 2. Purpose In April 1991, legislation was introduced in South Australia under the Occupational Health Safety & Welfare Act (1986) specifically addressing the management of asbestos in the workplace and establishes the duties of employer, employees and building owners to ensure work is carried out in a safe manner in relation to installed asbestos materials. The purpose of this SOP is to ensure that all personnel who are required to undertake work in an environment that has the potential to cause exposure to asbestos are provided with a safe system of work and safe working environment. 3. Locations The SOP is to be implemented prior or upon entry in to the ceiling space in the following building: Reid Building City East Campus 4. Risk Assessment The risk from exposure to airborne asbestos fibres from residual asbestos when left undisturbed is in general terms very low. However, the degree of the risk should be considered depending on the nature of the work to be undertaken. This includes the proximity of the area and personnel to the residual or installed asbestos and the potential for the residual asbestos to be accidentally and or deliberately disturbed during the course of the work. If the person supervising the work is unsure of the level of risk, then arrangements should be made to consult with the Contracts Manager: Maintenance or a suitably qualified Asbestos Management Consultant. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 9 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

98 5. Activity The following activities may disturb the residual asbestos materials: Access to the roof or ceiling space to undertake any form of maintenance work; Installation or modification to electrical or optic fibre cables; Removal and replacement of above ceiling and surface mounted light fittings ; Drilling or cutting holes to gain access into the ceiling space; Removal and modifications of ceiling mounted A/C Registers layout 6. Standard Operating Procedures General This SOP must be referred to if any work activity is to be undertaken within a roof or ceiling space of buildings (but not limited to) as documented in Section 3 of SOP No 1. This is to be done as follows: 6.1. Before commencing work, the Asbestos Register, that documents the location, type and condition of all known asbestos containing products, must be reviewed to determine if asbestos containing materials are in the proposed work area or building. The Contracts Manager: Maintenance holds copies of asbestos registers for all properties owned by UniSA. However, for ease of use for UniSA maintenance staff and contractors, the asbestos registers are available on the Intranet as a read only document. Project Managers for each Campus also hold copies of asbestos registers. If the register confirms the presence of asbestos in the area, then the person responsible for organising the work is to assess the risk which will be dependant on the type and duration of work. The responsible party shall then complete a UniSA Asbestos Work Permit that details the requirements for the work to proceed. However, if it is suspected that an area not identified in the Asbestos Register contains asbestos, the Contract Supervisor must be notified so that necessary arrangements can be made to clarify the situation. 6.2 External contractors employed by UniSA will be responsible for the provision of appropriate personal protective safety equipment for their employees and regular maintenance of the personal protective safety equipment in accordance with the Australian Standards. 6.3 The Contract Supervisor is to make arrangements for environmental air monitoring to be carried out by either an approved accredited organisation such as NATA or a company that has been approved by DAIS. Refer to Section All personnel working in an asbestos related environment must wear a half face respirator with a P1 particulate filter together with a hooded disposable overalls and protective footwear. Campus Services Staff can obtain the P1 particulate filter and disposable overalls from their Campus Services Team Leader 6.5 Plastic waste disposal bags and an approved vacuum cleaner can also be obtained from their Campus Services Team Leader 6.6 All work undertaken is to be planned so that as far as reasonably practicable the residual asbestos is not disturbed or disturbance is minimised. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 10 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

99 6.7 Cleanup & Decontamination Upon leaving the area or completing the work the following procedure is to be followed: Using the approved vacuum cleaner, decontaminate the face respirator and disposable overalls Remove the hooded disposable overalls and place into the waste disposal bag and seal up the bag Remove the half face respirator and place into a plastic storage bag. The respirators can be cleaned and disinfected later. (Refer to SOP7, Cleaning & Maintenance of Personal Protective Equipment SOP7) Dispose of the waste disposal bag in the asbestos storage bins and return the vacuum cleaner to the Campus Services Team Leader. 7. Environmental Air Monitoring For the purpose of determining the levels of airborne asbestos fibres during the works, it is a requirement of this SOP that the person who is responsible for organising the work is to make arrangements for environmental air monitoring to be carried out. The monitoring shall be carried out by an approved accredited organisation such as NATA or a company that has been approved by DAIS. Monitoring will be conducted when there is a possibility the work activity will result in the asbestos being disturbed and will be conducted during and after the work period. In accordance with the requirements of Section (5) (a) of the OHSW Regulations 1995, environmental air monitoring does not have to be carried out if the exposure to airborne asbestos fibres is no more than trivial, infrequent and of short duration. 8. Applicable Legislation South Australian OHS & Welfare Act Sections 19 & 21. South Australian OHS & Welfare Regulations 1995 Div 4.2. Approved Codes of Practice Safe Removal of Asbestos. Approved Codes of Practice Asbestos Work (excluding asbestos removal). 9. Records Management The Contract Supervisor will be responsible for distributing a copy of the Asbestos Work Permit and air monitoring result sheets to the Contracts Manager: Maintenance who will update the Asbestos Register accordingly. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 11 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

100 SOP-002 Vinyl Floor Tiles (VFT s) 1. Introduction This SOP has been developed in response to the presence of asbestos containing Vinyl Floor Tiles (referred to in this procedure as VFT) throughout a large number of UniSA properties. This has resulted in the need to provide and maintain a safe system of work for all maintenance and contractor personnel when working in an environment that has installed asbestos containing VFT s. Asbestos containing VFT s can be found in a variety of locations throughout a building but are mainly limited to floor and wall tiles. This SOP forms part of the University of South Australia's Asbestos Management Plan and UniSA Policies and Procedures. 2. Purpose In April 1991, legislation was introduced in South Australia under the Occupational Health Safety & Welfare Act (1986) specifically addressing the management of asbestos in the workplace and establishes the duties of employer, employees and building owners to ensure work is carried out in a safe manner in relation to installed asbestos materials. The purpose of this SOP is to ensure that all personnel who are required to undertake work in an environment that has the potential to cause exposure to asbestos are provided with a safe system of work and safe working environment. 3. Risk Assessment The risk from exposure to airborne asbestos fibres from asbestos containing VFT s in general terms is very low. The asbestos fibre (usually Chrysotile or commonly called white asbestos) is bound up in the matrix of the VFT s and is unlikely to become airborne even when worked upon ie: cut, sawn, drilled or sanded. VFT s usually contain no more that 3-5% asbestos. VFT s may also have been applied as wall tiles to some areas. Despite the low risks associated with VFT s the degree of the risk should be considered depending on the nature of the work to be undertaken. This includes the proximity of the area and personnel to the installed asbestos VFT and the potential for asbestos fibres to be released during the course of the work. If the person supervising the work is unsure of the level of risk, then arrangements should be made to consult with the Contracts Manager: Maintenance or a suitably qualified Asbestos Management Consultant. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 12 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

101 4. Activity This SOP is to be implemented when any one of the following activities is carried out: Removal of a small section of VFT s or wall tiles (less than 200 m 2 ) to gain access to the sub-base for maintenance purposes only. Drilling or cutting into the VFT s. Cutting or drilling penetration holes to give access to a floor slab for the installation of services. Cutting or drilling penetration holes in walls for the installation of services. Notes: For removal of VFT s of more than 200 m 2, the Contract Supervisor will make arrangements to engage a licensed asbestos removal contractor to undertake the work. Workplace Services are currently reviewing the minium amount of non-friable asbestos materials (such as VFT s) that can be removed (currently less than 200 m²) without a licence. The Contracts Manager: Maintenance will notify all relevant personnel of any changes made to the statutory requirements in this regard. The above activities are unlikely to release asbestos fibres into the work environment. However all work carried out must be undertaken in a manner that the potential for release of asbestos fibres is minimised. 5. Standard Operating Procedure This SOP is to be referred to if any work with or on VFT s that contain asbestos is undertaken. 5.1 Before commencing work, the Asbestos Register, that documents the location, type and condition of all known asbestos containing products, must be checked to determine if asbestos containing materials are in the proposed work area or building. The Contracts Manager: Maintenance holds copies of the asbestos registers for all UniSA properties. However, for the ease of use for contractors, the asbestos registers are also available on the Intranet as a read only document. Project Managers for each Campus also hold copies of asbestos registers. If the register confirms the presence of asbestos in the area, then the person responsible for organising the work is to assess the risk and complete the UniSA Asbestos Work Permit, that details the requirements for the work to proceed. However, if it is suspected that an area not identified in the Asbestos Register contains asbestos, the Contract Supervisor must be notified so that necessary arrangements can be made to clarify the situation. If the register does not list the VFT and the VFT is suspected of containing asbestos, then the Contract Supervisor responsible for organising the work will make the necessary arrangements for the VFT to be sampled and sent for analysis. If the sample analysis results confirm that the VFT contains asbestos, the Contract Supervisor will notify the Contracts Manager: Maintenance who will update the information on the asbestos register. 5.2 External contractors employed by UniSA will be responsible for the provision of appropriate personal protective safety equipment for their employees and regular maintenance of the personal protective safety equipment in accordance with the Australian Standards. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 13 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

102 5.3 All maintenance staff internal to UniSA must wear a half face respirator with a P1 particulate filter together with a hooded disposable overall that can be obtained from the Campus Services Team Leader. Plastic waste disposal bags and a vacuum cleaner approved for this purpose can also be obtained from the Campus Services Team Leader. 5.4 The Contracts Supervisor is to make arrangements for environmental air monitoring to be carried out by an approved accredited organisation such as NATA. Refer to Item 6, Environmental Air Monitoring. 5.5 The work is to be planned to minimise disruption to the occupants of the area/building. 5.6 Close off all doors to the area and close all windows. The area is to be barricaded off and warning signs are to be placed at the entry points to the work area. If there are no partitions or dividing walls then 200-micron plastic sheeting is to be erected as a protective screen. The work on the VFT s is to be undertaken in a manner that disturbance of the VFT s is kept to minimum. 5.7 Removal of a section of the VFT s can be undertaken in one or more of the following ways: Mechanical scraper and use of approved vacuum cleaner. Manual scraper and use of approved vacuum cleaner. Applied heat followed by scraping and use of approved vacuum cleaner. 5.8 If the VFT s have to be cut or drilled, then the use of non-powered hand tools is recommended. Electrical or battery powered tool can be used so long as they have the capability to run at a very low operating speed of approximately 500 rpm. 5.9 To assist the process of dust minimisation, the nozzle of an approved vacuum cleaner can be held close to the point of dust generation Cleanup & Decontamination Upon leaving the area or completing the work the following procedure is to be followed to ensure the area is safe for occupation Using an approved vacuum cleaner, decontaminate the face respirator and disposable overalls Remove the hooded disposable overalls, place into the waste disposal bag and seal up the bag Remove the half face respirator and place into a plastic storage bag. The respirators can be cleaned and disinfected later. (Refer to SOP7 Cleaning & Maintenance of Personal Protective Equipment) Place all VFT off cuts and fragments that were too big to be vacuumed, into the waste disposal bag and seal up the bag Dispose of the waste disposal bag in the asbestos storage bins provided by the Campus Services Team Leader T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 14 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

103 6. Environmental Air Monitoring For the purpose of determining the levels of airborne asbestos fibres during the works, it is a requirement of this SOP that the Contract Supervisor make arrangements for environmental air monitoring to be carried out. The monitoring shall be carried out by an approved accredited organisation such as NATA or a company that has been approved by DAIS. Monitoring will be conducted when there is a possibility the work activity will result in the asbestos being disturbed and will be conducted during and after the work period. In accordance with the requirements of Section (5) (a) of the OHSW Regulations 1995, environmental air monitoring does not have to be carried out if the exposure to airborne asbestos fibres is no more that trivial, infrequent and of short duration. 7. Applicable Legislation South Australian OHS & Welfare Act Sections 19 & 21. South Australian OHS & Welfare Regulations 1995 Div 4.2. Approved Codes of Practice Safe Removal of Asbestos. Approved Codes of Practice Asbestos Work (excluding asbestos removal). 8. Records Management The Contract Supervisor will be responsible for distributing a copy of the Asbestos Work Permit and air monitoring result sheets to the Contracts Manager: Maintenance who will update asbestos register accordingly. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 15 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

104 SOP-003 Asbestos Backed Vinyl Flooring (ABVF) 1. Introduction This SOP has been developed in response to the presence of Asbestos Backed Vinyl Flooring, (referred to in this Standard Operating Procedure as ABVF) material throughout a number of the UniSA buildings. This has resulted in the need to provide and maintain a safe system of work for all maintenance and contractor personnel when working in an environment that has installed ABVF. The majority of ABVF was manufactured by Armstrong Nylex until approximately The ABVF was usually applied in sheet form (as opposed to tiles) and has a Terrazzo type pattern look to the surface. This SOP forms part of the University of South Australia Asbestos Management Plan and the UniSA Policies and Procedures. 2. Purpose In April 1991, legislation was introduced in South Australia under the Occupational Health Safety & Welfare Act (1986) specifically addressing the management of asbestos in the workplace and establishes the duties of employer, employees and building owners to ensure work is carried out in a safe manner in relation to installed asbestos materials. The purpose of this SOP is to ensure that all personnel who are required to undertake work in an environment that has the potential to cause exposure to asbestos are provided with a safe system of work and safe working environment. 3. Risk Assessment The risk from exposure to airborne asbestos fibres from ABVF is considered to be low unless the material is disturbed or worked upon. The asbestos backing material (usually Chrysotile or commonly called white asbestos) is located on the underside of the base flooring material and is bonded to the back of the base material. ABVF may also have been applied to work bench tops in some areas and usually contains % asbestos. ABVF is classified as friable, however the degree of the risk should be considered depending on the nature of the work to be undertaken. This includes the proximity of the area and personnel to the installed ABVF and the potential for asbestos fibres to be released during the course of the work. If the person supervising the work is unsure of the level of risk, then arrangements should be made to consult with the Contracts Manager: Maintenance as a suitably qualified Asbestos Management Consultant. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 16 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

105 4. Activity This SOP is to be implemented when any one of the following activities is carried out: Removal of a small section of ABVF (less than 2 m 2 ) to gain access to the subbase. Drilling or cutting into the ABVF. Cutting or drilling penetration holes to give access to a floor slab for the installation of services. Cutting or drilling penetration holes in walls for the installation of services. Removal, cutting or drilling of ABVF applied to bench tops The above activities are unlikely to release asbestos fibres into the work environment. However all work carried out must be undertaken in a manner that the potential release of asbestos fibres is minimised. 5. Standard Operating Procedures - General Maintenance Activities This SOP is to be referred to if any work with or on ABVF that contain asbestos is undertaken. 5.1 Before commencing work, the Asbestos Register, that documents the location, type and condition of all known asbestos containing products, must be checked to determine if asbestos containing materials are in the proposed work area or building. The Contracts Manager: Maintenance holds copies of the asbestos registers for all UniSA properties. However, for the ease of use for contractors, the asbestos registers are also available on the Intranet as a read only document. Project Managers for each Campus also hold copies of the asbestos registers. If the register confirms the presence of asbestos in the area, then the person responsible for organising the work is to assess the risk and complete the UniSA Asbestos Work Permit, that details the requirements for the work to proceed. However, if it is suspected that the area not identified in the Asbestos Register contains asbestos, the Contract Supervisor is to be notified so that necessary arrangements can be made to clarify the situation. If the register does not list the ABVF and the ABVF is suspected of containing asbestos, then the Contract Supervisor will make the necessary arrangements for the ABVF to be sampled and sent for analysis. If the sample analysis results confirm that the ABVF contains asbestos, the Contract Supervisor will notify the Contracts Manager: Maintenance who will update information on the asbestos register. 5.2 External contractors employed by UniSA will be responsible for the provision of appropriate personal protective safety equipment for their employees and regular maintenance of the personal protective safety equipment in accordance with the Australian Standards. 5.3 All maintenance staff internal to UniSA must wear a half face respirator with a P1 particulate filter together with a hooded disposable overall that can be obtained from the Campus Services Team Leader. Plastic waste disposal bags and an approved vacuum cleaner can also be obtained from the Campus Services Team Leader 5.4 The work is to be planned to minimise disruption to the occupants of the area/building. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 17 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

106 5.5 The Contract Supervisor is to make arrangements for environmental air monitoring to be carried out by an approved accredited organisation such as NATA. Refer to Item 6, Environmental Air Monitoring. For removal of ABVF of more than 2 m 2, the Contract Supervisor will make arrangements to engage a licensed asbestos removal contractor to undertake the work. 5.6 Close off all doors to the area and close all windows. 5.7 The area is to be barricaded off and warning signs are to be placed at the entry points to the work area. If there are no partitions or dividing walls then 200-micron plastic sheeting is to be erected as a protective screen. 5.8 The work on the ABVF is to be undertaken in a manner that disturbance of the ABVF is kept to a minimum. 5.9 If the ABVF has been placed onto hard board or particle board, the board shall be removed as well as the ABVF and disposed of as asbestos waste Removal of a section of the ABVF can be undertaken in one or more of the following ways: Mechanical scraper and use of approved vacuum cleaner. Manual scraper and use of approved vacuum cleaner Applied heat followed by scrapping and use of approved vacuum cleaner For general maintenance work where only very small sections of the ABVF (less than 2m²) (and a licensed asbestos removal contractor is not engaged to carry out the work), has to be worked upon, a fine water spray or mist can be applied to assist in the control and minimisation of asbestos fibres If the ABVF has to be cut or drilled, then the use of non-powered hand tools is recommended. Electrical or battery powered tool can be used so long as they have the capability to run at a very low operating speed of approximately 500 rpm To assist the process of dust minimisation, the nozzle of an approved vacuum cleaner can be held up close to the point of dust generation To assist the process of dust minimisation, the nozzle of an approved vacuum cleaner can be held up close to the point of dust generation Place all ABVF and fragments into the asbestos waste bag The floor or wall area is to be wet wiped with a damp cloth or is to be vacuumed with an approved vacuum cleaner. This task also applies to all horizontal and vertical surfaces. It may be prudent to seal the edges of the ABVF with tape and apply a small amount of PVA sealant to lockdown any minor traces of asbestos fibres. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 18 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

107 5.17 Cleanup & Decontamination Upon leaving the area or completing the work the following procedure is to be followed: Using an approved vacuum cleaner, decontaminate the face respirator and disposable overalls Remove the hooded disposable overalls and place into the waste disposal bag and seal up the bag Remove the half face respirator and place into a plastic storage bag. The respirators can be cleaned and disinfected later. (Refer to SOP7 Cleaning & Maintenance of Personal Protective Equipment) Remove the hooded disposable overalls and place into the waste disposal bag and seal up the bag Dispose of the waste disposal bag in the asbestos storage provided by the Campus Services Team Leader. 6. Environmental Air Monitoring For the purpose of determining the levels of airborne asbestos fibres during the works, it is a requirement of this SOP that the Contract Supervisor is to make arrangements for environmental air monitoring to be carried out. The monitoring shall be carried out by an approved accredited organisation such as NATA or a company that has been approved by DAIS. Monitoring will be conducted when there is a possibility the work activity will result in the asbestos being disturbed and will be conducted during and after the work period. In accordance with the requirements of Section (5) (a) of the OHSW Regulations 1995, environmental air monitoring does not have to be carried out if the exposure to airborne asbestos fibres is no more that trivial, infrequent and of short duration. 7. Applicable Legislation South Australian OHS & Welfare Act Sections 19 & 21. South Australian OHS & Welfare Regulations 1995 Div 4.2. Approved Codes of Practice Safe Removal of Asbestos. Approved Codes of Practice Asbestos Work (excluding asbestos removal). 8. Records Management The Contract Supervisor will be responsible for distributing a copy of the Asbestos Work Permit and air monitoring result sheets to the Contracts Manager: Maintenance who will update the asbestos register accordingly. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 19 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

108 SOP-004 Asbestos Fibre Cement Products (AFCP) 1. Introduction This SOP has been developed in response to the presence of Asbestos Fibre Cement Products (referred to in this procedure as AFCP) throughout a number of UniSA properties. This has resulted in the need to provide and maintain a safe system of work for all maintenance and contractor personnel when working in an environment that has installed AFCP. AFCP can be found in a variety of locations throughout a building and in one or more of the following forms (but not limited to): Corrugated roof and wall cladding. Flat sheeting to ceilings of rooms and/or laboratory areas. Flat sheeting to verandah walls and ceilings. Flat sheeting to wet areas such as toilets and laundries. Laboratory bench tops. AFCP can also be found in the form of: Formed mouldings. Vent pipes. Pipes for water and drainage. Exhaust flues. Laboratory equipment such as ovens etc. This SOP forms part of the University of South Australia Asbestos Management Plan and the UniSA Policies and Procedures. 2. Purpose In April 1991, legislation was introduced in South Australia under the Occupational Health Safety & Welfare Act (1986) specifically addressing the management of asbestos in the workplace and establishes the duties of employer, employees and building owners to ensure work is carried out in a safe manner in relation to installed asbestos materials. The purpose of this SOP is to ensure that all personnel who are required to undertake work in an environment that has the potential to cause exposure to asbestos are provided with a safe system of work and safe working environment. 3. Risk Assessment The risk from exposure to airborne asbestos fibres from AFCP in general terms is low unless the material is disturbed or worked upon. The hardness and structure (non friable) of AFCP and its relatively low asbestos content (in most cases) means that it is less likely to generate airborne asbestos fibres that say friable asbestos pipe lagging. Generally these AFCP s are in good condition and often sealed with paint. There is a negligible health risk associated with these products so long as they are not subjected to cutting, drilling or other types of operations that could possibly generate airborne asbestos fibres. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 20 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

109 However, the degree of the risk should be considered depending on the nature of the work to be undertaken. This includes the proximity of the area and personnel to the installed AFCP and the potential for asbestos fibres to be released during the course of the work. If the person supervising the work is unsure of the level of risk, then arrangements should be made to consult with the Contracts Manager: Maintenance or a suitably qualified Asbestos Management Consultant. 4. Activity This SOP is to be implemented when any one of the following activities is carried out: Drilling or cutting into AFCP. Sanding or drilling into AFCP. The above activities are likely to release asbestos fibres into the work environment. Therefore all work carried out must be undertaken in a manner that the potential release of asbestos fibres is minimised 5. Standard Operating Procedure - General Maintenance Activities This SOP is to be referred to if any work is required to be undertaken on or with AFCP. 5.1 Before commencing work, the Asbestos Register, that documents the location, type and condition of all known asbestos containing products, must be checked to determine if asbestos containing materials are in the proposed work area or building. The Contracts Manager: Maintenance holds copies of all asbestos registers for UniSA properties. However, for the ease of use for contractors, the asbestos registers are also available on the Intranet as a read only document. The Project Manager for each Campus also holds copies of the asbestos registers. If the register confirms the presence of asbestos in the area, then the person responsible for organising the work is to assess the risk and complete the UniSA Asbestos Work Permit, that details the requirements for the work to proceed. However, if it is suspected that the area not identified in the Asbestos Register contains asbestos, the Contract Supervisor is to be notified so that necessary arrangements can be made to clarify the situation. If the register does not list the AFCP and the AFCP is suspected of containing asbestos, then the Contract Supervisor responsible for organising the work will make the necessary arrangements for the AFCP to be sampled and sent for analysis. If the sample analysis results confirm that the AFCP contains asbestos, the Contract Supervisor will notify the Contracts Manager: Maintenance who will update information on the asbestos register. 5.2 External contractors employed by UniSA will be responsible for the provision of appropriate personal protective safety equipment for their employees and regular maintenance of the personal protective safety equipment in accordance with the Australian Standards. 5.3 UniSA employees must wear a half face respirator with a P1 particulate filter together with a hooded disposable overalls that can be obtained from the Campus Services Team Leader. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 21 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

110 5.4 Plastic waste disposal bags and an approved vacuum cleaner can also be obtained from the Campus Services Team Leader 5.5 The work is to be planned to minimise disruption to the occupants of the area/building. Notes: Workplace Services are currently reviewing the minium amount of non-friable asbestos materials (such as AFCP) that can be removed (currently less than 200 m²) without a licence. The Contracts Manager: Maintenance will notify all relevant personnel of any changes made to the statutory requirements in this regard. For removal of AFCP of more than 200 m 2 in total, the Contract Supervisor will make arrangements to engage a licensed asbestos removal contractor to undertake the work or for general maintenance work the following will apply: 5.6 If the work to be undertaken is inside a building then close off all doors to the area and close all windows. 5.7 The area is to be barricaded off and warning signs are to be placed at the entry points to the work area. 5.8 If there are no partitions or dividing walls then 200-micron plastic sheeting is to be erected as a protective screen. 5.9 The Contract Supervisor shall make arrangements for environmental air monitoring to be carried out by an approved accredited organisation such as NATA. (Refer to Item 6, Environmental Air Monitoring) Work on the AFCP is to be undertaken in a manner that disturbance of the AFCP is kept to minimum If the AFCP has to be cut or drilled, then the use of non-powered hand tools is recommended. Electrical or battery powered tool can be used so long as they have the capability to run at a very low operating speed of approximately 500 rpm For general maintenance work where only very small sections have to be worked upon, a fine water spray or mist can be applied to assist in the control and minimisation of asbestos fibres To assist the process of dust minimisation, the nozzle of an approved vacuum cleaner can be held up close to the point of dust generation. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 22 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

111 5.14 Cleanup and Decontamination Prior to leaving the work and upon completion of works the following tasks are to be carried out: Place all AFCP and fragments into the asbestos waste bag and wet wipe surrounding areas with a damp cloth. Alternatively, the affected area can be vacuumed with an approved vacuum cleaner. This task applies to all horizontal and vertical surfaces It may be prudent to seal the exposed edges of the AFCP with tape and apply a small amount of PVA sealant or paint to lockdown any minor traces of asbestos fibres. Upon leaving the area or completing the work then: Using an approved vacuum cleaner, decontaminate the face respirator and disposable overalls Remove the hooded disposable overalls and place into the waste disposal bag and seal up the bag Remove the half face respirator and place into a plastic storage bag. The respirators can be cleaned and disinfected later. (Refer to SOP7 for Cleaning & Maintenance of Personal Protective Equipment) Remove the hooded disposable overalls and place into the waste disposal bag and seal up the bag Dispose of the waste disposal bag in the asbestos storage bins provided by the Campus Services Team Leader. 6. Environmental Air Monitoring (as required) For the purpose of determining the levels of airborne asbestos fibres during works, it is a requirement of this SOP that the Contracts Supervisor is to make arrangements for environmental air monitoring to be carried out. The monitoring shall be carried out by an approved accredited organisation such as NATA or a company that has been approved by DAIS. Monitoring will be conducted when there is a possibility the work activity will result in the asbestos being disturbed and will be conducted during and after the work period. In accordance with the requirements of Section (5) (a) of the OHSW Regulations 1995, environmental air monitoring does not have to be carried out if the exposure to airborne asbestos fibres is no more that trivial, infrequent and of short duration. 7. Applicable Legislation South Australian OHS & Welfare Act Sections 19 & 21. South Australian OHS & Welfare Regulations 1995 Div 4.2. Approved Codes of Practice Safe Removal of Asbestos. Approved Codes of Practice Asbestos Work (excluding asbestos removal). 8. Records Management The Contract Supervisor will be responsible for distributing a copy of the Asbestos Work Permit and air monitoring result sheets to the Contracts Manager: Maintenance who will update the asbestos register accordingly. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 23 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

112 SOP-005 Asbestos Containing Fire Doors (ACFD) 1. Introduction This SOP has been developed in response to the presence of Asbestos Containing Fire Doors (referred to in this procedure as ACFD) throughout a number of the UniSA buildings. ACFD s can consist of either timber or metal encased types that have an asbestos core, sandwiched between the inner and outer cores of the door. The doors are utilised as a fire isolation barrier between fire zones. Almost all ACFD s have been identified and labelled with the appropriate caution labels. However, it is possible that not all ACFD s have been identified and labelled. In most cases, fire doors can be identified as being different from normal type doors due the difference in weight and they are also tagged on the doorframe. This has resulted in the need to provide and maintain a safe system of work for all maintenance and contractor personnel when working on or with ACFD s. This SOP forms part of the University of South Australia Asbestos Management Plan and UniSA Policies and Procedures. 2. Purpose In April 1991, legislation was introduced in South Australia under the Occupational Health Safety & Welfare Act (1986) specifically addressing the management of asbestos in the workplace and establishes the duties of employer, employees and building owners to ensure work is carried out in a safe manner in relation to installed asbestos materials. The purpose of this SOP is to ensure that all personnel who are required to undertake work in an environment that has the potential to cause exposure to asbestos are provided with a safe system of work and safe working environment. 3. Risk Assessment The risk from exposure to airborne asbestos fibres from the inner asbestos core of the ACFD in general terms is low unless the material is disturbed or worked upon. The outer timber or metal cover provides an effective barrier and will restrict the opportunity for the materials to generate airborne asbestos fibres. Generally the inner asbestos core is in good condition. There is a negligible health risk associated with this product so long as it is not subjected to cutting, drilling or other types of operations that could possibly generate airborne asbestos fibres. However, the degree of the risk should be considered depending on the nature of the work to be undertaken and the potential for asbestos fibres to be released during the course of the work. If the person supervising the work is unsure of the level of risk, then arrangements should be made to consult with the Contracts Manager: Maintenance or a suitably qualified Asbestos Management Consultant. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 24 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

113 4. Activity This SOP is to be implemented when any one of the following activities is carried out: Drilling or cutting into the timber of metal outer panels. Easing of the door margins. Affixing or removing the door hardware, closers etc. Removing or affixing the door hinges. Affixing or removing the door latch and handle. It is possible that the above activities could disturb the inner core and release asbestos fibres into the work environment. Therefore all work carried out must be undertaken in a manner that will minimise the potential release of asbestos fibres. 5. Standard Operating Procedure - General This SOP is to be referred to if any work with or on ACFD s is undertaken. 5.1 Before commencing work, the Asbestos Register, that documents the location, type and condition of all known asbestos containing products, must be checked to determine if asbestos containing materials are present within the fire door. The Contracts Manager: Maintenance holds copies of asbestos registers for all UniSA properties. However, for the ease of use for contractors, the asbestos register is also available on the Intranet as a read only document. Project Managers for each Campus also hold copies of asbestos registers. If the register confirms the presence of asbestos material in the fire door, then the person responsible for organising the work is to assess the risk and complete the UniSA Asbestos Work Permit that details the requirements for the work to proceed. However, if it is suspected that the fire door(s) not identified in the Asbestos Register contains asbestos, the Contract Supervisor is to be notified so that necessary arrangements can be made to clarify the situation. If the register does not list the fire door and is suspected of containing asbestos, then the person responsible for organising the work will make the necessary arrangements for the inner core of the fire door to be sampled and sent for laboratory analysis. If the sample analysis results confirm that the inner core contains asbestos, the Contract Supervisor will notify the Contracts Manager: Maintenance who will update the information onto the asbestos register. 5.2 External contractors employed by UniSA will be responsible for the provision of appropriate personal protective safety equipment for their employees and regular maintenance of the personal protective safety equipment in accordance with the Australian Standards. 5.5 UniSA personnel must wear a half face respirator with a P1 particulate filter together with a hooded disposable overall that can be obtained from the Campus Services Team Leader. 5.3 Plastic waste disposal bags and an approved vacuum cleaner can also be obtained from the Campus Services Team Leader 5.4 The work is to be planned to minimise disruption to the occupants of the area/building. 5.5 The work undertaken on the fire door must also be carried out in accordance with the Building Code of Australia with reference to the maintenance of Fire Doors. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 25 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

114 6. Standard Operating Procedure - Easing Door Margins If the fire door has a top or bottom edge timber insert that is in good condition and has a reasonable amount of timber that can be worked upon, the door can be planed to give the required clearance without having to implement the SOP. If the top or bottom edge exposes the asbestos core or the outer door panel is damaged beyond repair, then arrangements should be made to have the fire door removed and disposed of, off Campus, by a licensed asbestos contractor or arrange for the contractor to carry out the work under a controlled environment off Campus. 7. Standard Operating Procedure Door Locks, and Door Hardware 7.1 The Contract Supervisor shall make arrangements for environmental air monitoring to be carried out by an approved accredited organisation such as NATA. Refer to Item 8, Environmental Air Monitoring. 7.1 A plastic drop sheet (200mµ) should be placed and set up on the floor under the fire door. The plastic drop sheet should extend approximately 1 metre around the fire door to catch any small dust particles. 7.2 To assist the process of dust minimisation, the nozzle of an approved vacuum cleaner can be held up close to the point of dust generation. 7.6 A fine water spray or mist can be applied to assist in the control and minimisation of asbestos fibres. 7.8 The work on the fire door is to be undertaken in a manner that disturbance of the asbestos inner core is kept to minimum. 7.9 If the fire door inner core has to cut or drilled, then the use of non-powered hand tools is recommended. Electrical or battery powered tool can be used so long as they have the capability to run at a very low operating speed of approximately 500 rpm. Note: The cutting or drilling of a fire door may compromise its fire rating certification. If you are unsure, seek advice from the Contract Supervisor Cleanup & Decontamination Prior to leaving the work and upon completion of the work the following tasks are to be carried out: The surrounding area is to wet wiped with a damp cloth or is to be vacuumed with the approved vacuum cleaner Place all removed door locks etc into the asbestos waste bag along with the plastic drop sheet and any asbestos contaminated waste materials such as the damp cloth used to wet wipe the area. Upon leaving the area or completing the work then: Using an approved vacuum cleaner, decontaminate the face respirator and disposable overalls Remove the hooded disposable overalls and place into the waste disposal bag and seal up the bag Remove the half face respirator and place into a plastic storage bag. The respirators can be cleaned and disinfected later. (Refer to SOP7 Cleaning & Maintenance of Personal Protective Equipment) Remove the hooded disposable overalls and place into the waste disposal bag and seal up the bag. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 26 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

115 Dispose of the waste disposal bag in the asbestos storage bins and return the vacuum cleaner to the Campus Services Team Leader. 8. Environmental Air Monitoring For the purpose of determining the levels of airborne asbestos fibres during the works, it is a requirement of this SOP that the maintenance supervisor is to make arrangements for environmental air monitoring to be carried out. The monitoring shall be carried out by an approved accredited organisation such as NATA or an organisation approved by DAIS. Monitoring will be conducted when there is a possibility the work activity will result in the asbestos being disturbed and will be conducted during and after the work period. In accordance with the requirements of Section (5) (a) of the OHSW Regulations 1995, environmental air monitoring does not have to be carried out if the exposure to airborne asbestos fibres is no more that trivial, infrequent and of short duration. 9. Applicable Legislation South Australian OHS & Welfare Act Sections 19 & 21. South Australian OHS & Welfare Regulations 1995 Div 4.2. Approved Codes of Practice Safe Removal of Asbestos. Approved Codes of Practice Asbestos Work (excluding asbestos removal). 10. Records Management The Contract Supervisor will be responsible for distributing a copy of the Asbestos Work Permit and air monitoring result sheets to the Contracts Manager: Maintenance who will update the asbestos register accordingly. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 27 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

116 SOP-006 ZELEMITE Asbestos Electrical Backing Boards (AEBB) 1. Introduction This SOP has been developed in response to the presence of a large number of Zelemite AEBB throughout a number of UniSA buildings. This has resulted in the need to provide and maintain a safe system of work for all maintenance and contractor personnel when working on or with Zelemite AEBB. The Zelemite AEBB can be found in a variety of locations throughout a building and in one or more of the following forms (but not limited to): Electrical switch and meter cupboards. Plant room control panels Lift motor room control panels. This SOP forms part of the University of South Australia Asbestos Management Plan and UniSA Policies and Procedures. 2. Purpose In April 1991, legislation was introduced in South Australia under the Occupational Health Safety & Welfare Act (1986) specifically addressing the management of asbestos in the workplace and establishes the duties of employer, employees and building owners to ensure work is carried out in a safe manner in relation to installed asbestos materials. The purpose of this SOP is to ensure that all personnel who are required to undertake work in an environment that has the potential to cause exposure to asbestos are provided with a safe system of work and safe working environment. 3. Risk Assessment The risk from exposure to airborne asbestos fibres from Zelemite AEBB in general terms is low unless the material is disturbed or worked upon. The hardness and structure (non friable) of Zelemite AEBB and its relatively low asbestos content (in most cases) means that it is less likely to generate airborne asbestos fibres than friable asbestos pipe lagging. Generally these Zelemite AEBB are in good condition and often sealed with a tar like resin. There is a negligible health risk associated with these products so long as they are not subjected to cutting, drilling or other types of operations that could possibly generate airborne asbestos fibres. However, the degree of the risk should be considered depending on the nature of the work to be undertaken. This includes the proximity of the area and personnel to the installed Zelemite AEBB and the potential for asbestos fibres to be released during the course of the work. If the person supervising the work is unsure of the level of risk, then arrangements should be made to consult with the Contracts Manager: Maintenance or a suitably qualified Asbestos Management Consultant. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 28 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

117 4. Activity This SOP is to be implemented when the following activity is carried out: Drilling, cutting or sanding the Zelemite AEBB. The above activities are likely to release asbestos fibres into the work environment. Therefore all work carried out must be undertaken in a manner that the potential release of asbestos fibres is minimised. 5. Standard Operating Procedure - General Maintenance Activities This SOP is to be referred to if any work is required to be undertaken on or with Zelemite AEBB. 5.1 Before commencing work, the Asbestos Register, that documents the location, type and condition of all known asbestos containing products, must be checked to determine if asbestos containing materials are in the proposed work area or building. The Contracts Manager: Maintenance holds copies of the asbestos registers for all of the UniSA properties. However, for ease of use by contractors, the asbestos registers are also available on the Intranet as a read only document. The Project Manager for each Campus also holds copies of the asbestos registers. If the register confirms the presence of asbestos in the area, then the Contract Supervisor responsible for organising the work is to assess the risk and complete the UniSA Asbestos Work Permit, that details the requirements for the work to proceed. However, if it is suspected that the area not identified in the Asbestos Register contains asbestos, the Contract Supervisor is to be notified so that necessary arrangements can be made to clarify the situation. If the register does not list the Zelemite AEBB and the Zelemite AEBB is suspected of containing asbestos, then the Contract Supervisor responsible for organising the work will make the necessary arrangements for the Zelemite AEBB to be sampled and sent for laboratory analysis. If the sample analysis results confirm that the Zelemite AEBB contains asbestos, the Contract Supervisor will notify the Contracts Manager: Maintenance who will update the information onto the asbestos register. 5.2 External contractors employed by UniSA will be responsible for the provision of appropriate personal protective safety equipment for their employees and regular maintenance of the personal protective safety equipment in accordance with the Australian Standards. 5.3 UniSA personnel must wear a half face respirator with a P1 particulate filter together with a hooded disposable overalls and protective footwear that can be obtained from the Campus Services Team Leader. 5.4 Plastic waste disposal bags and an approved vacuum cleaner can also be obtained from the Campus Services Team Leader 5.5 The Contract Supervisor shall make arrangements for environmental air monitoring to be carried out by an approved accredited organisation such as NATA. Refer to Item 6, Environmental Air Monitoring. 5.6 The work is to be planned to minimise disruption to the occupants of the area/building. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 29 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

118 5.7 The area is to be barricaded off and warning signs are to be placed at the entry points to the work area. 5.8 The work on the Zelemite AEBB is to be undertaken in a manner that disturbance of the material is kept to minimum. 5.9 A plastic drop sheet (200mµ) should be placed and set up on the floor under area to worked upon. The plastic drop sheet should extend approximately 1 metre around the work area to catch any small dust particles If the Zelemite AEBB has to be cut or drilled, then the use of non-powered hand tools is recommended. Electrical or battery powered tool can be used so long as they have the capability to run at a very low operating speed of approximately 500 rpm To assist the process of dust minimisation, the nozzle of an approved vacuum cleaner can be held up close to the point of dust generation Cleanup & Decontamination Upon leaving the area or completing the work the following procedure is to be followed: Place all asbestos fragments and the plastic drop sheet into the asbestos waste bag The surrounding area is to wet wiped with a damp cloth or is to be vacuumed with the approved vacuum cleaner. This task also applies to all horizontal and vertical surfaces It may be prudent to seal the exposed edges by the application a small amount of PVA sealant or paint to lockdown any minor traces of asbestos fibres Remove the half face respirator and place into a plastic storage bag. The respirators can be cleaned and disinfected later. (Refer to SOP7 Cleaning & Maintenance of Personal Protective Equipment) Remove the hooded disposable overalls and place into the waste disposal bag and seal up the bag Dispose of the waste disposal bag in the asbestos storage bins and return the vacuum cleaner to the Campus Services Team Leader 6. Environmental Air Monitoring (as required) For the purpose of determining the levels of airborne asbestos fibres during the works, it is a requirement of this SOP that the Contract Supervisor is to make arrangements for environmental air monitoring to be carried out. The monitoring shall be carried out by an approved accredited organisation such as NATA or a company that has been approved by DAIS. Monitoring will be conducted when there is a possibility the work activity will result in the asbestos being disturbed and will be conducted during and after the work period. In accordance with the requirements of Section (5) (a) of the OHSW Regulations 1995, environmental air monitoring does not have to be carried out if the exposure to airborne asbestos fibres is no more that trivial, infrequent and of short duration. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 30 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

119 7. Applicable Legislation South Australian OHS & Welfare Act Sections 19 & 21. South Australian OHS & Welfare Regulations 1995 Div 4.2. Approved Codes of Practice Safe Removal of Asbestos. Approved Codes of Practice Asbestos Work (excluding asbestos removal). 8. Records Management The Contract Supervisor will be responsible for distributing a copy of the Asbestos Work Permit and air monitoring result sheets to the Contracts Manager: Maintenance who will update the asbestos register accordingly. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 31 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

120 SOP-007 Cleaning & Maintenance of Personal Protective Equipment (PPE) 1. Introduction This SOP has been developed in response to the presence of various types of Asbestos Containing Materials (ACM) located across UniSA occupied properties. This has resulted in the need to provide and maintain a safe system of work for all maintenance and contractor personnel when working in an environment that has installed ACM. As part of the safe system of work process and as documented in UniSA SOP s numbered 1 8, all personnel required to undertake any work on an item or work in an area that has installed ACM, are required to be provided with and wear PPE. This SOP forms part of the University of South Australia Asbestos Management Plan and UniSA Policies and Procedures. 2. Purpose In April 1991, legislation was introduced in South Australia under the Occupational Health Safety & Welfare Act (1986) specifically addressing the management of asbestos in the workplace and establishes the duties of employer, employees and building owners to ensure work is carried out in a safe manner in relation to installed asbestos materials. The purpose of this SOP is to ensure that all personnel who are required to undertake work in an environment that has the potential to cause exposure to asbestos are provided with a safe system of work and safe working environment. This includes the provision of, PPE in good working order including the cleaning and maintenance of said PPE. 3. Risk Assessment The risk from exposure to airborne asbestos fibres from most ACM in general terms is low unless the material is disturbed or worked upon. Generally these ACM are in good condition and often sealed with paint. There is a negligible health risk associated with these products so long as they are not subjected to cutting, drilling or other types of operations that could possibly generate airborne asbestos fibres. There are however, a number of areas within UniSA buildings where the ACM is in a friable condition. These areas have a greater risk potential from exposure to airborne asbestos fibres. All personnel who are required to work in an environment or on an asbestos containing materials that has the potential to generate air borne asbestos fibres, shall be provided with and required to wear the appropriate PPE. External contractors employed by UniSA will be responsible for the provision of appropriate personal protective safety equipment for their employees and regular maintenance of the personal protective safety equipment in accordance manufacturers guidelines and or relevant Australian Standards whichever is the higher. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 32 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

121 4. Standard Operating Procedure - General This SOP is to be referred to for the Cleaning and Maintenance of PPE owned by the University of South Australia. With the exception of disposable PPE filters, all PPE equipment as held by the Campus Services Team Leader for each Campus will be cleaned on a regular basis. The following method will apply for the Cleaning and Maintenance of PPE: 4.1 Remove the filters. The type of filter will depend on the type of respirator ie: single or double canister. Wash the respirator face piece with detergent and warm water. A soft brush is the most effective way to achieve this. Rinse with clean water and hang up the respirator to air dry. 4.2 When the respirator is dry, it can be disinfected by the use of a broad spectrum disinfectant or a disinfectant swab type. If a broad spectrum disinfectant is used make sure that the manufacturers instructions are followed. 4.3 The respirator should then be again rinsed with clean water and hung up to air dry. If required, an anti fog preparation can be applied. 4.4 For periods when the respirator is used for a short duration, cleaning and disinfection of the respirator with a disinfectant swab (Isowipes) would be sufficient. 4.5 Disposable respirators should be discarded at the completion of each work task and placed into the asbestos waster disposal bag along with any other asbestos contaminated waste materials. 5. Storage of Respirators 5.1 All UniSA owned PPE is held by the Campus Services Team Leader for each Campus and should be stored in a secured central location (preferably a storage cupboard that can be locked to prevent unauthorised access or use). In order to prevent tampering; remove filters from face pieces and store in a sealed container or sealable plastic bag. The date of last inspection of filters should be indicated on the container. Respirators are to be stored in a manner to prevent distortion of face pieces. In order to protect face pieces from dust, sunlight or corrosive substances store in sealed plastic bags in the secured PPE storage cupboard. 6. Inspections and Maintenance All UniSA owned PPE should be carefully inspected during the cleaning process and before and after each use. With the exception of disposable filters, the results of inspections are to be recorded in the inspection log form (Refer PPE Inspection Log, Section 4, Standard Forms). Disposable respirators should be inspected for: Physical damage such as holes in the filter. Deterioration of metal nose clips. Deterioration and reduced elasticity of straps. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 33 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

122 In the event that damage or deterioration is detected replace respirator completely or contact the manufacturer to obtain new straps. Components of half face and full face respirators should be inspected for damage and deterioration and the appropriate remedial action taken (Table 1). Table.1 Inspection of half face and full face respirators Component Inspect for Remedial Action Head straps Rubber face piece Filter elements Inhalation and exhalation valves Corrugated breathing tube Powered airpurifying respirators Breaks or tears Loss of elasticity Excessively worn serrations on the head harness that may potentially allow the face piece to slip Broken or non-functioning buckles Cracks, tears or holes Cracked, scratched or loose fitting lenses Dirt Distortion Increased filter resistance Missing or won gaskets Worn filter threads and face piece threads Cracks or dents in filter housing Ensure the appropriate recommended filter is in place for the hazard Ensure appropriate approval conditions where applicable Dust, dirt or detergent residue on valve or valve seat. Missing or defective valve cover Cracks, tears or distortion of the valve or valve seat. Cracks or holes in tube Missing or loose hose clamps Missing or broken end connectors Check assembly for leaks. Check flow rate prior to use. Check flow rate after use. Replace head harness Replace head harness Replace head harness Replace buckles Replace face piece Contact manufacturer to replace lenses or replace face piece Clean dirt from face piece Remove face piece from any constraints and allow to return to correct shape. If distortion remains, replace the face piece. Replace filter Contact manufacturer for replacement parts Replace appropriate component, filter or face piece Replace filter Remove residue with soap and water Contact manufacturer and obtain new valve cover Contact manufacturer for advice Replace tube Replace clamps Replace connectors Tighten filter clamps and replace any damaged components If flow rate is below manufactures specifications check battery and recharge if necessary If flow rate is below manufactures specifications replace filter. If still below check battery charge or other major faults T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 34 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

123 7. Replacement and disposal of filters Breathing resistance of particulate respirators will progressively increase with use as the filter becomes loaded with trapped particles. When breathing resistance becomes too high the filter should be replaced. Breathing resistance is considered to be too high when there is a perceived increase in resistance to breathing by the operator. The time taken for this situation to occur varies and will be determined by the characteristics of the filter and the nature and concentration of the particles. Clogging of the filters of power assisted air purifying respirators (full-face respirators) is indicated by a decrease in air flow rate. There is no general rule about when filters should be changed. Each situation should be assessed on a case by case basis. As a filter becomes clogged the efficiency of the filter does not decrease. The main purpose of changing filters is to assist breathing comfort. Used filters should be sealed in a waste disposal bag. The waste disposal bag should be returned to the Campus Services Team Leader who will make arrangements for final disposal. 8. Applicable Legislation South Australian OHS & Welfare Act Sections 19 & 21. South Australian OHS & Welfare Regulations 1995 Div 4.2. Approved Codes of Practice Safe Removal of Asbestos. Approved Codes of Practice Asbestos Work (excluding asbestos removal). T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 35 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

124 Table 2 PPE Maintenance Log Inspecti Inspect Component on Date ed by (name) inspected Head straps Rubber face piece Filter elements Inhalation and exhalation valves Corrugated breathing tube Powered airpurifying respirators Damage identified Remedial Action Taken T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 36 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

125 SOP-008 Unexpected Occurrences of Suspected Asbestos Containing Materials 1. Introduction This SOP has been developed in response to the presence of asbestos containing materials throughout a number of UniSA properties. This has resulted in the need to provide and maintain a safe system of work for all maintenance and contractor personnel when working in an environment that may potentially have asbestos containing materials. Asbestos can be found in a variety of locations throughout a building and in one or more of the following forms (but not limited to): Corrugated roof and wall cladding. Flat sheeting to ceilings of rooms and/or laboratory areas. Flat sheeting to verandah walls and ceilings. Flat sheeting to wet areas such as toilets and laundries. Laboratory bench tops. Formed mouldings. Vent pipes. Pipes for water and drainage and hot water pipe insulation. Exhaust flues. Laboratory equipment such as ovens etc. Residual asbestos contamination in roof and ceiling spaces or other enclosed spaces. Fragments sprayed on to structural steel beams as fireproofing. Vinyl floor tiles. Asbestos backed vinyl flooring. Asbestos Containing Fire Doors. Asbestos electrical backing boards. This SOP forms part of the University of South Australia Asbestos Management Plan and UniSA Policies and Procedures. 2. Purpose In April 1991, legislation was introduced in South Australia under the Occupational Health Safety & Welfare Act (1986) specifically addressing the management of asbestos in the workplace and establishes the duties of employer, employees and building owners to ensure work is carried out in a safe manner in relation to installed asbestos materials. The purpose of this SOP is to ensure that all personnel who are required to undertake work in an environment that has the potential to cause exposure to asbestos are provided with a safe system of work and safe working environment. 3. Risk Assessment The risk from exposure to airborne asbestos fibres from any of the above (Section 1) items in general terms is low unless the material is disturbed or worked upon. Generally these asbestos containing materials are in good condition and often sealed with paint. There is a negligible health risk associated with these products so long as they are not subjected to cutting, drilling or other types of operations that could possibly generate airborne asbestos fibres. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 37 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

126 However, the degree of the risk should be considered depending on the nature of the work to be undertaken. This includes the proximity of the area and personnel to the installed materials and the potential for asbestos fibres to be released during the course of the work. If the person supervising the work is unsure of the level of risk, then arrangements should be made to consult with the Contracts Manager: Maintenance as a suitably qualified Asbestos Management Consultant. 4. Activity The SOP is to be implemented when any one of the following activities is carried out: Prior to sanding, drilling or cutting into materials suspected of containing asbestos. Upon entering suspected contaminated roof spaces to undertake maintenance work; Work in Service risers and ducts; Work Under floor voids; Work in Wall cavities; Work in Service risers and ducts; and Work in Ceiling voids Although an inspection has been undertaken to identify (as far as reasonably practicable) all occurrences of asbestos containing materials with UniSA buildings, due to the nature of building construction practices, asbestos containing materials could be located anywhere with a building structure. 5. Standard Operating Procedure This SOP is to be referred to if any work is required to be undertaken on or with materials and in areas that are suspected of containing asbestos. If in doubt at any time as to whether or not materials may contain asbestos cease work activities and comply with the following procedures 5.1 Before commencing work, the Asbestos Register, that documents the location, type and condition of all known asbestos containing products, must be checked to determine if asbestos containing materials are in the proposed work area or building. The Contracts Manager: Maintenance holds copies of the asbestos registers for all of the UniSA properties. However, for the ease of use for contractors, the asbestos register is also available on the Intranet as a read only document. The Project Manager for each Campus also holds copies of the asbestos registers. 5.2 If the register confirms the presence of asbestos in the area, then the Contract Supervisor responsible for organising the work is to assess the risk and complete the UniSA Asbestos Work Permit, that details the requirements for the work to proceed. However, if it is suspected that the area not identified in the Asbestos Register contains asbestos, the Contract Supervisor is to be notified so that necessary arrangements can be made to clarify the situation. If the register does not list the material and the material is suspected of containing asbestos, then the Contract Supervisor responsible for organising the work will make the necessary arrangements for the material to be sampled and sent for analysis. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 38 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

127 5.3 If the sample analysis results confirm that the material contains asbestos, the Contract Supervisor will notify the Contracts Manager: Maintenance who will update the asbestos register accordingly. 5.4 If the presence of asbestos is confirmed follow the appropriate and applicable Standard Operating Procedure for the work situation or asbestos material. 5.5 If the person supervising the work is unsure of the level of risk, then arrangements should be made to consult with the Contracts Manager: Maintenance or a suitably qualified Asbestos Management Consultant. 6. Applicable Legislation South Australian OHS & Welfare Act Sections 19 & 21. South Australian OHS & Welfare Regulations 1995 Div 4.2. Approved Codes of Practice Safe Removal of Asbestos. Approved Codes of Practice Asbestos Work (excluding asbestos removal). T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 39 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

128 Section 4 Standard Forms Index of Standard Forms PRO-005 Asbestos Work Permit Form PRO-006 Environmental Air Monitoring Form PRO-007 Asbestos Works Awareness Form PRO-008 Personal Protective Equipment Inspection Log Form (not currently available) T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 40 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

129 PRO Asbestos Permit to Work Form This permit is valid :* from to This Asbestos Permit to Work is to be used for and is limited to construction, maintenance or repair work in areas or on items that contain asbestos. If the work requires the asbestos materials to be removed, then the appropriate Contract Supervisor in consultation with the Contracts Manager: Maintenance will make the appropriate arrangements to have the asbestos materials removed by a licensed asbestos removal contractor. Insert name of contractor Is/are authorised to undertake construction or maintenance work in areas contaminated by asbestos in accordance with the Occupation Health, Safety and Welfare (Asbestos) Regulations 1995 Nature of Work to be undertaken * The following Standard Operating Procedures have been provided to the contractor: SOP1 Personnel entering asbestos contaminated roof and ceiling spaces Procedure SOP2 Vinyl floor tiles (VFT s) Procedure SOP3 Asbestos backed vinyl flooring (ABVF) Procedure SOP4 Asbestos Fibre Cement Products (AFCP) Procedure Work is to be undertaken in Building (s) * Room (s) SOP5 Asbestos Containing Fire Doors (ACFD) Procedure SOP6 Asbestos Electrical Backing Boards Zelemite (AEBB) Procedure SOP7 Cleaning and Maintenance of Personal Protective Equipment (PPE) Procedure SOP8 Unexpected Occurrences of Suspected Asbestos Containing Materials Procedure Other (as attached) Authorising Officer For Asset Manager* Approved Contract Supervisor This permit is only valid for the tasks identified, under the conditions below and outlined in the Standard Operating Procedures provided. The work permit is valid only for the time period outlined above. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 41 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

130 PRO Environmental Air Monitoring Report Form For the purpose of determining the levels of airborne asbestos fibres during the works, it is a requirement of this Asbestos Work Permit and Standard Operating Procedures (SOP s) that the person responsible for organising the work is to make arrangements for environmental air monitoring to be carried out. The monitoring shall be carried out by an approved accredited organisation such as NATA or a company that has current DAIS Pre-Qualification for such works. Monitoring will be conducted when there is a possibility the work activity will result in the asbestos being disturbed and will be conducted during and after the work period. In accordance with the requirements of Section (5) (a) of the OHSW Regulations 1995, environmental air monitoring does not have to be carried out if the exposure to airborne asbestos fibres is no more than trivial, infrequent and of short duration. This permit is issued conditional upon all work being carried out in accordance with legislative and regulatory requirements including Standard Operating Procedures that accompany this permit. I acknowledge having read and signed the Asbestos Register and received a copy of this UniSA Asbestos Work Permit and accompanying Standard Operating Procedures. Print Name Signed T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 42 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

131 PRO Asbestos Works Awareness Form The UniSA Contract Supervisor(s) and designated Line Manager(s) must ensure that all efforts are made to inform staff/students of asbestos related construction and or maintenance works being undertaken in their areas of responsibility. Asbestos related works shall be clearly documented on the relevant UniSA Asbestos Work Permit and this form signed by affected staff/students. I acknowledge that I am aware that asbestos work is being undertaken as outlined in this asbestos work permit. Name Title Department Building Floor Date Signature Page 43 of 44

132 PRO Personal Protective Equipment Inspection Log Form (not currently available) Page 44 of 44

133 FORMS 7

134 Forms UniSA Document Form Document Title Approval Date Attached Number Yes/No OHSW&IM Forms 1 Hazard Register Yes No 2 Risk Assessment Worksheet Yes No 3 Action Plan example Yes No 4 Workplace Management Audit Checklist Yes No 5 OHSW&IM Management System Audit Yes No 6 Legislative Compliance Audit checklist Yes No 7 Action Plan Performance Report Yes No 8 Standard Operating Procedure Yes No 9 Incident Report Yes No 10 Hazardous Substances Register Yes No 11 Preliminary/Risk Assessment for Hazardous Substance Yes No 12 Hazardous Substance Risk Assessment Yes No 13 Training Needs Analysis Yes No 14 Training Plan Yes No 15 Training Register Yes No 16 Worksite Inspection General Environment Yes No 17 Worksite Inspection Laboratory Environment Yes No 18 Call for Nominations Health and Safety Representative Yes No 19 Health and Safety Representative Nomination Yes No 20 Ballot Paper Yes No 21 Notice of Election Result Yes No 22 Notification of Health and Safety Representative Yes No * WorkCover Corporation Health and Safety Representatives Notification of Election Yes No 23 Induction Checklist Yes No 24 Outstanding Actions Yes No 25 Electrical Equipment Register Yes No 26 Residual Current Devices Register Yes No 27 Contractor s Permit to Work Yes No 28 Contractor OHSW Induction Checklist Yes No 29 Working from Home - OHSW & Ergonomic Self-Assessment - (Currently Not Available) Yes No 30 Employee Licence and Certificate of Competency Register Yes No 31 DAIS Plant Registration Register Yes No Contractors Induction Kit Section 7 - November 2002

135 UniSA Document Form Document Title Approval Date Attached Number Yes/No 32 Licensed Dangerous Substance Storage Register Yes No 33 Premises Containing Unsealed Radioactive Sources Register Yes No 34 Sealed Radioactive Sources Register Yes No 35 Confined Space Risk Assessment Worksheet Yes No 36 Confined Space Entry Permit Low Risk Yes No 37 Confined Space Entry Permit High Risk Yes No 38 Hot Work Permit for Confined Spaces Yes No 39 Fieldwork activity acknowledgment Yes No 40 Plant Register Yes No 41 Plant Inspection Checklist Yes No 42 Authority to Exchange Information Yes No 43 Rehabilitation Return to Work Plan Yes No 44 Rehabilitation Program Yes No 45 Workstation Assessment Yes No 46 Manual Handling Risk Checklist Yes No 47 Not Available Yes No 48 Safety Sign Requirements Yes No 49 Injury Management Yes No 50 Confined Space Permit Register Yes No Contractors Induction Kit Section 7 - November 2002 Property Unit Forms PRO-005 Asbestos Work Permit Form Yes No PRO-006 Environmental Air Monitoring Form Yes No PRO-007 Asbestos Work Awareness Yes No PRO-008 Personal Protective Equipment Inspection Log Form Yes No

136 Workplace: UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE INCIDENT REPORT FORM Date: OHSW9 Page 1 NOTES: Complete all parts of this form - incomplete forms WILL be returned to the relevant person. If this is a lost time incident the Line Manager and the OHSW Services shall be advised within 24 hours of the incident occurring. All other incidents shall be advised within 72 hours of the incident EMPLOYEE DETAILS Family name: Other Name: Sex: M F Contact Phone No: (w) (h) Date of Birth Occupation: Payroll No: Current Classification: Employment Status: Full Time Part time Casual Student Contractor Usual Work Location: INCIDENT DETAILS Visitor Other (Please Describe)... Date: / / Time of Incident: am / pm Location where Incident occurred: What happened? (Describe what happened, and include the events that led to the occurrence of this incident) This incident resulted in: Injury No injury Property damage Hazard Near miss This incident was reported to (Supervisor) on / /. INJURY/DAMAGE DETAILS If injury was sustained, what part of the body was affected OR if damage occurred what was damaged? MEDICAL TREATMENT Was any medical treatment sought/provided? When / / at am / pm From whom? Has any time been lost from work? (More than 1 complete shift) Yes No If so, have you returned to work? Yes No Have/will medical expenses been incurred? Yes No Uncertain at this time # If MEDICAL EXPENSES are incurred a WorkCover "Worker Report Form" must be completed. Were there witnesses? If so, name of witness(s): Contact Phone: Employee signature Date:

137 UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE INCIDENT REPORT FORM Workplace: Date: OHSW9 Page 2 INVESTIGATION: Is the responsibility of the Supervisor/Line Manager, and is to be completed in consultation with the employee and the health and safety representative. Please describe the events and contributing factors that led to the incident occurring: Did any of the following factors contribute to the incident/accident? No written procedure Incorrect method used Outdated Method No training provided Inadequate training provided Needs on-going training Lack of equipment Equipment fault Lack of maintenance Equipment not available Inappropriate equipment used Inadequate ventilation / lighting Inadequate space Inadequate storage Poor access Unsuitable work area Possible lack of attention Excessive workload RISK CONTROL: Supervisor/Line Manager should complete in consultation with the H&S Rep and the Injured/ Reporting Employee Recommendation to prevent recurrence of this incident/accident Change in induction program Proposed Taken Change in on-going training Proposed Taken Equipment/machinery modifications Proposed Taken Change to work procedure Proposed Taken Change to work environment Proposed Taken Equipment/machinery maintenance Proposed Taken Other job redesign Proposed Taken Other preventative action Proposed Taken Post trauma counselling Proposed Taken Exacerbation of a previous injury No change proposed Rehabilitation required Yes No Rehabilitation Consultant advised Date: SUPERVISOR S ACTION - The Supervisor is responsible and accountable for ensuring that the appropriate action has been taken to minimise or eliminate the possible risk of injury or re-occurrence. I have taken the following action to reduce/ eliminate the risk of re-injury or re-occurrence: Referred to Line Manager Placed issue on Local Action Plan Consulted employees Advised Senior Manager Advised Senior Consultant, OHSW Advised Rehabilitation Consultant Estimated cost: $ Name: Signed: Date:

138 UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE CONTRACTOR S PERMIT TO WORK OHSW27 Page 1 of 2 TO BE COMPLETED BY THE CONTRACTOR Contractor Company Name: Contractor Name: Contract Supervisor Name: Campus/Worksite: Location of the Work: Date: Period of work Ph: Expiry Date SAFE WORK METHOD Work Description Please indicate with a tick ( ) WILL YOU BE: Working on the roof Spray painting Window cleaning Asbestos work Working in confined spaces Abrasive blasting Using power tools Welding or abrasive cutting Trenching Demolishing Erecting scaffolding Using chemicals Working at heights Explosives Confined Space Other specify Access to high voltage workstation Hot work Note: A work permit (which may be required by OHSW Legislation) and specific to the work activity that will be carried out is to be forwarded to the Contract Supervisor along with any other relevant work permits. Do you have a safe work method(s) to undertake the work indicated above? Please circle Have you been trained and are you competent in the safe work method(s)? Please circle yes / no yes / no Hazard Identification What are the hazards relating to this task, what could go wrong? If more than one provide separate list Risk Assessment How likely is this hazard? Very Likely Likely Unlikely What could be the outcome? Death Serious Injury First Aid Hazard Control How will you control this hazard? Detail your safe work method here (attach extra pages if needed).

139 UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE CONTRACTOR S PERMIT TO WORK OHSW27 Page 2 of 2 I. of Contractor Name please print Company Name declare that I/We a) understand the obligations under the Occupational Health Safety & Welfare Act, 1986, Regulations, approved Codes of Practice and Australian Standards that are applicable to the work being undertaken and to the circumstances in which the contract will be effected b) Have received a copy of and understand the requirements of the UniSA Contractors Induction kit and will abide by the universities safety rules as stated in the UniSA OHSW Procedure Contractor Management. c) have certification and qualifications that are required by legislation d) will cease working, make safe the workplace and contact the Contract Supervisor if I become aware of danger to myself or others during the period of the contract e) have a current Workers Compensation and Rehabilitation Insurance Policy in place f) agree to the Contractor OHSW Requirements in the University OHSW Procedure Contractor Management. Signed: Contractor Date / / TO BE COMPLETED BY THE CONTRACT SUPERVISOR The contractor has been admitted to the University site to provide the services as detailed in the contract. An additional Hazardous Work Permit has / has not been issued. Contractor OHSW Site Induction has been arranged before work will commence on the site Signed: Contract Supervisor Date / /

140 UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE CONTRACTOR OHSW INDUCTION CHECKLIST Workplace: Location: Date: Name of Contractor s representative: Contract Work: Commencement Date Contract Supervisor OHSW28 Work area Orientation Emergency Procedure Emergency exits Fire extinguisher location Parking requirements Occupational Health & Safety Licenses/certification requirements Smoke Free Work Environment Resolution of Issues Incident Reporting Procedures Hazards present in work area Type of hazard Safe practices to be followed Work practices for particular work Asbestos Emergency Procedures Fire Bomb threat Building evacuation Fire warden(s) Clean up FOLLOW-UP AFTER ONE WEEK Review work practices & procedures with contractor or contractor s representative Answer contractor s questions Contract Supervisor signature: Date: Speed limits Washing and toilet facilities Drinking water facilities Restricted areas Standard Operating Procedures Material Safety Data Sheets (MSDS) Location of MSDS Training in MSDS (if necessary) Confined spaces Hot work Danger & Out of Service Tags/Locks Roof Access First Aid First Aid Officer First Aid kit location Record Provide a copy of this completed checklist to the Contractor and retain this original with Your OHSW records Contractor s Representative signature: Date:

141 Workplace: UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE OHSW36 CONFINED SPACE ENTRY PERMIT LOW RISK Page 1 of 2 Location: This permit must be signed by the Authorised Competent Person before the work proceeds. Only the work listed may be done. Name of Person(s) Entering Non-University employer s Name and Address Description of Work (if Hot Work, also complete OHSW38 Hot Work Permit for Confined Spaces) Hot Work permit required: Yes No Safety Personnel Notified: Security (Name) Other (Name) Radio Communication Check (Working) Yes No Purging or Ventilation: Automatic Portable N/A Personal Protective Equipment: Safety Glasses Hearing Protection Safety Helmets Breathing Apparatus Type Safety Footwear Protective Clothing Other As per risk assessment and hazard identification Atmospheric testing (as required) Type: Continuous Periodic N/A Type of instrument used Name of Competent Person Conducting Test (please print) Test Results: Methane 10% LEL Hydrogen Sulfide 10 PPM Oxygen Levels % Carbon Dioxide 30 PPM Other AUTHORISATION FOR ENTRY The confined space described above, is in my opinion, safe for the work detailed in the Description of Work above to be carried out, provided that the precautions listed are adhered to. Signature: Authorised Competent Person Date: / / Time: am/pm PERMIT VALID from am/pm to am/pm Date / /

142 OHSW38 2 TASK COMPLETED: All persons, equipment, plant & materials have been withdrawn. Work has been completed Access to the confined space has been secured Signature: Date: / / Time: am/pm Authorised Competent Person Return the completed form to the relevant Line Manager

143 UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE OHSW37 CONFINED SPACE ENTRY PERMIT HIGH RISK Page 1 of 4 Workplace: Location: Date: This permit must be signed by the Authorised Competent Person before the work proceeds. Only the work listed may be done. Employee Name (please print): Non-University employer s Name and Address Emergency contact; Name phone Number of Employees (named below) Name of Competent Person (please print): Description of Confined Space: DESCRIPTION OF WORK (if Hot work, also complete OHSW38 Hot Work Permit for Confined Spaces) Hot Work permit required: Yes No Requested By: Position: 1. ISOLATION OF THE CONFINED SPACE (as per AS Sections ) The items ticked below have been isolated or made safe [1] Pipelines (water, steam, gas, etc.) [2] Mechanical or Electrical Drives [3] Sludges, Deposits, Waste [4] Harmful Materials [5] Electrical Services [6] Warning Notices, Portable Signs, Locks or Tags (danger) installed to the means of isolation [7] Radiation Services

144 OHSW ATMOSPHERIC TEST REQUIREMENTS (Fill in details of test) If the confined space must be cleared of contaminants then use a suitable purging agent and if this is a gas mixture it shall have less than 21% by volume of oxygen, otherwise respiratory equipment shall be provided. Has the gas detector been calibrated in the last 6 months? Due date for next calibration: / / Yes/No Test Results: Methane 10% LEL Hydrogen Sulphide 10 PPM Oxygen Levels % Carbon Dioxide 30 PPM Other The concentration of any flammable contaminant in the atmosphere of the confined space is: below 5% of its LEL between 5 and 10% of its level enter confined space only with continuous monitoring and the use of suitably calibrated flammable gas detector CONDITIONS SAFE TO ENTER? with supplied air respiratory device (no combustible gas) with an air purifying (non air supplied) respiratory protection device without supplied air respiratory device 3. PERSONAL PROTECTIVE EQUIPMENT The following personal protective equipment (ticked) shall be worn as required (a) Supplied air respirators (cylinders filled) reference to safe work procedures (b) Air purifying respiratory protection devices (c) Safety harness and/or safety line or lifeline/rescue (d) Eye protection eg. safety glasses (e) Hand protection eg. gloves (f) Foot protection eg. safety shoes or boots (g) Protective clothing eg. overalls (h) Hearing protection (i) Safety helmets

145 OHSW STAND-BY & RESCUE PERSONNEL (a) Stand-by personnel are: and (b) Rescue & emergency procedures have been issued and understood? Yes / No (c) Openings for entry and exit to permit rescue of any person who may enter the confined space, or provision of suitable alternative means of rescue (d) Procedures to prevent obstruction of the openings by fittings or equipment which could impede rescue 5. HAZARDS IDENTIFIED WITH THIS CONFINED SPACE ARE: 6. PRECAUTIONS: The following precautions have been identified: a) Appropriate warning signs and barriers have been placed correctly. b) Smoking has been banned from the confined space site. c) Ignition sources have been removed from within 6 metres of the entry/exit point. d) Equipment for fire protection e) First aid equipment f) No chemical agents other than those listed below shall be permitted in the confined space e) Any special precautions required 7. ENTRY PERSONNEL I/We understand the safety procedures required for entry and exit for working in a confined space and the safety protective equipment to be used and have a working knowledge of the equipment to be used. EMPLOYEES NAME Please Print EMPLOYEES SIGNATURE TRAINED IN LAST 12 MONTHS Yes / No DATE OF ENTRY IN (TIME) OUT (TIME) Yes / No Yes / No Yes / No

146 OHSW AUTHORISATION FOR ENTRY The confined space described above, is in my opinion, safe for the work detailed in the Description of Work above to be carried out, provided that the precautions listed are adhered to. NOTE: No work shall be carried out within a confined space, or on the outside surface of a confined space, if the work or any plant is likely to cause or create a risk: to the health and safety of a person in the confined space, or of fire or explosion. Signature: Authorised Competent Person Date: / / Time: am/pm PERMIT VALID from am/pm to am/pm Date / / TASK COMPLETED: All persons, equipment, plant & materials have been withdrawn. Work has been completed Access to the confined space has been secured Signature: Date: / / Time: am/pm Authorised Competent Person Return the completed form to the Property Unit

147 UNIVERSITY OF SOUTH AUSTRALIA OHSW PROCEDURE OHSW38 HOT WORK PERMIT FOR CONFINED SPACE Page 1 of 3 Workplace: Location: Date: The precautions ticked below must be fully observed. (1) The area is clean and free of all readily combustible materials within 15 metres. (2) All drains within 15 metres are covered with a wet fireproof blanket. (3) Appropriate fire extinguishers are on site and near the source of ignition. (4) A water hose is run to the job site, tested/left running. (5) All sparks from work conducted more than 2 metres above ground, must be contained completely by the use of a suitable enclosure that shall be inspected before commencing work. (6) Welding machine/gas cylinders are located (they must not be within 8 metres of any drain). (7) Welding machine must be earthed directly to the equipment that is being welded as close to the welding point as practical. (8) Power leads are not draped across pipelines or access ways. (9) Electrical traces on pipes are isolated. Any special conditions? I have read and fully understand the precautions listed on the attachment to this permit Signature: Competent Person(s) entering Date: / / Time: am/pm AUTHORISATION The hot work in or on the occupied confined space described above and on the associated Confined Space Entry Permit, is in my opinion, safe for the work to be carried out, provided that the precautions listed are adhered to. Signature: Authorised Competent Person Date: / / Time: am/pm PERMIT VALID from am/pm to am/pm Date / / TASK COMPLETED: This sign-off must be completed with the associated Confined Space Entry Permit Signature: Date: / / Time: am/pm Authorised Competent Person Return the completed form to the Property Unit Attachment to Hot Work Permit for Confined Space

148 OHSW38 2 GENERAL PRECAUTIONS & RECOMMENDATIONS FOR HOT WORK IN CONFINED SPACES Special care is necessary when Hot Work is undertaken in or on a confined space. Hot work is defined in Australian Standard 2865 as welding, thermal or oxygen cutting, heating and other fire-producing or spark-producing operations. Attention is drawn to the requirements of Regulatory Authorities??? governing particular operations/use of equipment, which may exceed these guidelines and to the relevant provisions of Australian Standard AS Safety in welding and allied processes - Fire precautions and of AWRA-AWI Technical Note 7..??? PERMITS Hot work in or on the exterior surfaces of an occupied confined space shall not be commenced until a hot work permit has been issued. The hot work permit shall certify that appropriate precautions have been carried out and shall list any tests necessary to ensure that safe conditions are maintained. Aspects to be taken into account when considering the issue of a permit include the following: 1. When a confined space or a space adjacent thereto has contained a flammable or combustible substance, the permit shall be issued only after inspection and testing have ensured that the following requirements have been achieved. a) The concentration of flammable vapours or gases in the atmosphere is below 5% of the LEL b) The liquid and solid residues have been removed as necessary to prevent the release of flammable vapours or gases that will raise the concentration above 5% of the LEL c) All piping within the confined space has been found by testing, not to contain concentrations of flammable vapour or gas above 5% of the LEL 2. In a confined space having last contained dry material that creates a explosive atmosphere when dispersed in air, the permit shall be issued only after inspection has ensured that loose dust has been removed from the confined space and all appropriate surfaces have been cleaned.3. Where fixed fire extinguishing equipment, having either manual or automatic activation controls, protects the confined space such equipment shall be positively isolated when the confined space is occupied. In such cases alternative fire protection shall provided in the confined space by adequate numbers of the appropriate size and type of portable fire extinguishers. FIRE PREVENTION The following fire preventative measures shall be taken: 1. All combustibles, including any dry residues, in the vicinity of the hot work shall be removed to a safe place. If they cannot be moved, such items shall be covered by a non-combustible blanket, flameresistant tarpaulin, or other means to prevent ignition from heat, sparks and slag. 2. When hot work is involved, consideration shall be given to the assignment of a fire watch while the hot work is being performed and for a period of a least 30 minutes after completion of such hot work. 3. When welding or cutting will be performed on a tank shell or a conductive boundary of a confined space, the same precautions shall be exercised inside and outside the space where the hot work is being performed. NOTE: Sparks from direct penetration or heat transfer may also create an explosion or fire hazard in the adjacent spaces outside the confined space. 4. Before hot work is started on a surface covered with a preservative or other protective coating, the flammability and thermal decomposition products of the coating shall be considered. Where such a coating is flammable, it shall be stripped from the area of hot work to prevent ignition. A pressurised fire hose and a suitable nozzle or other extinguishing equipment, or both, shall be available.

149 OHSW When arc welding is suspended for a substantial period of time, such as during lunch periods or overnight, the power source to the equipment shall be de-energised, all electrodes removed from holders, and the holders placed so that accidental contact or arcing cannot occur. 6. When gas welding or cutting is suspended for a substantial period of time, such as during lunch periods or overnight, the torch and cylinder valves shall be closed. Where practicable, the torch and hose shall be removed from the area and depressurised outside the confined space. 7. Where practicable, no compressed gas cylinders or associated manifold, other than those used for self-contained breathing apparatus, shall be located inside the confined space. CONTROL OF FUMES Fumes shall be controlled as follows: 1. Before hot work is started on a metal surface which is coated, the atmosphere in the confined space shall be tested to ensure that flammable vapours or gas from coatings with flashpoints below the ambient temperature do not exceed 5% of the LEL 2. During such hot work, periodic tests shall be conducted to ensure that these limits are not exceeded. In a confined space, all surfaces covered with coatings that would decompose or volatilise under hot work into toxic, corrosive or irritant components, shall be stripped from the area of heat application. Coatings shall also be removed for a sufficient distance from the area to be heated in order to minimise the temperature increase of the unstripped metal. Additionally, artificial cooling of the metal surrounding the hot-work area may be necessary to limit the size of the area required to be cleaned. Where such stripping is not practicable, all persons in the confined space shall wear suitable respiratory protective devices and other personal protective equipment, as appropriate. Means shall be provided to exhaust contaminated air from the confined space. Such exhaust shall be directed to a location where it presents no hazard to any persons or equipment and will not accidentally be recirculated into the confined space.

150 81,9(56,7<2)6287+$8675$/,$ 2+6:352&('85( 2+6: &21),1('63$&(3(50,75(*,67(5 3DJHRI :RUNSODFH /RFDWLRQ 'DWH 3(50,712 '$7( 3(5621(17(5,1*7+(&21),1('63$&( +,*+25 /2:5,6. 3(50,7 (175<7,0( (;,77,0(

151 PRO Asbestos Permit to Work Form This permit is valid :* from to This Asbestos Permit to Work is to be used for and is limited to construction, maintenance or repair work in areas or on items that contain asbestos. If the work requires the asbestos materials to be removed, then the appropriate Contract Supervisor in consultation with the Contracts Manager: Maintenance will make the appropriate arrangements to have the asbestos materials removed by a licensed asbestos removal contractor. Insert name of contractor Is/are authorised to undertake construction or maintenance work in areas contaminated by asbestos in accordance with the Occupation Health, Safety and Welfare (Asbestos) Regulations 1995 Nature of Work to be undertaken * The following Standard Operating Procedures have been provided to the contractor: SOP1 Personnel entering asbestos contaminated roof and ceiling spaces Procedure SOP2 Vinyl floor tiles (VFT s) Procedure SOP3 Asbestos backed vinyl flooring (ABVF) Procedure SOP4 Asbestos Fibre Cement Products (AFCP) Procedure Work is to be undertaken in Building (s) * Room (s) SOP5 Asbestos Containing Fire Doors (ACFD) Procedure SOP6 Asbestos Electrical Backing Boards Zelemite (AEBB) Procedure SOP7 Cleaning and Maintenance of Personal Protective Equipment (PPE) Procedure SOP8 Unexpected Occurrences of Suspected Asbestos Containing Materials Procedure Other (as attached) Authorising Officer For Asset Manager* Approved Contract Supervisor This permit is only valid for the tasks identified, under the conditions below and outlined in the Standard Operating Procedures provided. The work permit is valid only for the time period outlined above. T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 41 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

152 PRO Environmental Air Monitoring Report Form For the purpose of determining the levels of airborne asbestos fibres during the works, it is a requirement of this Asbestos Work Permit and Standard Operating Procedures (SOP s) that the person responsible for organising the work is to make arrangements for environmental air monitoring to be carried out. The monitoring shall be carried out by an approved accredited organisation such as NATA or a company that has current DAIS Pre-Qualification for such works. Monitoring will be conducted when there is a possibility the work activity will result in the asbestos being disturbed and will be conducted during and after the work period. In accordance with the requirements of Section (5) (a) of the OHSW Regulations 1995, environmental air monitoring does not have to be carried out if the exposure to airborne asbestos fibres is no more than trivial, infrequent and of short duration. This permit is issued conditional upon all work being carried out in accordance with legislative and regulatory requirements including Standard Operating Procedures that accompany this permit. I acknowledge having read and signed the Asbestos Register and received a copy of this UniSA Asbestos Work Permit and accompanying Standard Operating Procedures. Print Name Signed T:\Ian\Web site files\policies and Procedures\Asbestos Management Policy.doc Page 42 of 44 University of South Australia Asbestos Code of Practice June 2002 (Revision 1)

153 PRO Asbestos Works Awareness Form The UniSA Contract Supervisor(s) and designated Line Manager(s) must ensure that all efforts are made to inform staff/students of asbestos related construction and or maintenance works being undertaken in their areas of responsibility. Asbestos related works shall be clearly documented on the relevant UniSA Asbestos Work Permit and this form signed by affected staff/students. I acknowledge that I am aware that asbestos work is being undertaken as outlined in this asbestos work permit. Name Title Department Building Floor Date Signature Page 43 of 44

154 PRO Personal Protective Equipment Inspection Log Form (not currently available) Page 44 of 44

155 5(9,6,21180%(5,668('$7(129(0%(5