Supporting Online Material
|
|
- Jeffery Cain
- 5 years ago
- Views:
Transcription
1 Supporting Online Material 1. Materials and Methods 2. Supporting online figures 3. Supporting online references 1. Material and Methods Plasmid constructs All AvrPphB and protease inactive AvrPphB() constructs were generated by PCR amplification of the 28 kda form of AvrPphB, which lacks the amino-terminal 62 amino acids, using previously described plasmid clones as templates (S1, S2). The PBS1 gene was amplified from a cdna construct (S3) for transient expression assays, and from genomic DNA for complementation assays. For mammalian expression, AvrPphB was inserted into a derivative of the pcdna3 vector (Invitrogen) containing a C-terminal FLAG epitope, and PBS1 was inserted into a pcdna3 derivative containing an HA epitope. An AU1 tag was inserted into the pcdna3-pbs1-ha construct between amino acid residues 19 and 20 of PBS1, which is after the PBS1 myristoylation site. Bacterial expression constructs of AvrPphB-His6 were generated by cloning wild-type and mutant AvrPphB into pet21a (Novagen). The bacterial expression construct pgex-kg-pbs1-his6 was constructed by inserting PBS1 into the pgex- KG vector (Pharmacia). Arabidopsis kinases At3g17410 and At5g02800 were amplified from an Arabidopsis cdna library and cloned into the pcdna3-ha vector. RPS5 coding sequence was amplified from a genomic RPS5 clone in the pgem-t vector (Promega) and cloned into the pef4-myc vector (Invitrogen). For dexamethasone-inducible expression in planta, wild-type and
2 mutant forms of AvrPphB and PBS1-HA were cloned into the vector pta7002 (S4). For complementation assays, a genomic fragment spanning from 875 bp 5' of the PBS1 start codon to 229 bp 3' of the stop codon was amplified by PCR and cloned into the pgreen0229 vector (S5). All point mutations as well as the AU1 tag insertion constructs were generated using a QuikChange Site-Directed Mutagenesis Kit (Stratagene). Plant material Nicotiana tabacum cultivar xanthi, Nicotiana benthamiana, Arabidopsis thaliana accessions Columbia (Col-0) and Landsberg-erecta (Ler), and the Col-0 mutant lines rps5-2, pbs1-1 and rar1-20 were grown under a 9-hour photoperiod at 24ûC. Agrobacterium transient expression in planta Agrobacterium tumefaciens GV3101 strains carrying the various dexamethasone-inducible constructs were grown and prepared for transient expression as described in (S6). Agrobacterium cultures was resuspended in infiltration medium at OD 600 = 0.4. For experiments requiring coexpression of AvrPphB and PBS1, suspensions were mixed in a 1:1 ratio, maintaining an OD 600 = 0.4. Bacterial suspensions were infiltrated into expanding leaves of 4-week old tobacco and N. benthamiana or 5-week old Arabidopsis plants. Plants were sprayed with 50 µm dexamethasone 40 hours after injection to induce expression. Samples were collected for protein extractions 4 hours after dexamethasone application for tobacco and N. benthamiana and 24 hours after application for Arabidopsis. Samples were flash-frozen in liquid nitrogen and ground in an extraction buffer (10 mm Tris-HCl, ph 7, 0.33 M sucrose, 1mM EDTA, plant Protease Inhibitor Cocktail (Sigma)). Extracts were centrifuged briefly to clear debris, and protein in the
3 supernatant quantified. Approximately 50 µg of proteins per sample were separated on a 10% SDS-PAGE and transferred to a nitrocellulose membrane. The resulting blots were probed with Anti-HA-Peroxidase High Affinity monoclonal antibody (Roche) or polyclonal anti-avrpphb antibody. Immunoprecipitation Following transient expression in N. benthamiana, 8 leaf-discs were collected and ground in lysis buffer (50 mm Tris, ph 7.5, 150 mm NaCl, 0.1% NP-40 and Plant Proteinase Inhibitor Cocktail (Sigma)). Protein concentrations were determined and normalized to 2 mg/ml. 100 µl of rat monoclonal Anti-HA matrix slurry (50 µl resin) (Roche) were added to 2 mg of protein in a 1.5 ml tube and mixed gently. The mixtures were incubated at 4ûC overnight with rotation endover-end. The resins were centrifuged at 16,000 g for 10 seconds and the pellets washed three times with 1 ml of lysis buffer. The immunocomplexes were resuspended in 50 µl of 1x SDS loading buffer, boiled for 5 minutes and 15 µl separated in a 10% SDS-PAGE gel. Proteins were transferred to a nitrocellulose membrane and probed with anti-ha-peroxidase high affinity monoclonal antibody (Roche). The blot was stripped and re-probed with anti-avrpphb polyclonal antibody. Protein expression and purification Recombinant AvrPphB-His6 and GST-PBS1-His6 mutants were expressed in E. coli BL21(DE3). E. coli clones were grown in LB medium containing 100 µg/ml ampicillin to a density of OD 600 =0.6. Protein expression was induced overnight at room temperature with 0.4 mm isopropyl b-d-thiogalactopyranoside (IPTG). Cells were lysed in the buffer containing 20
4 mm Tris (ph 8.0), 200 mm NaCl, 20 mm imidazole, and 5% glycerol supplemented with 1 mm phenylmethylsulfonylfluoride (PMSF) and 10 mm ß-mercaptoethanol. Both AvrPphB-His6 and GST-PBS1-His6 proteins were purified by Ni + -agarose affinity chromatography and eluted with 250 mm imidazole in the same buffer. Protein concentrations were estimated by Coomassie blue staining of SDS-PAGE gels using BSA standards. PBS1 and RPS5 cleavage assays in mammalian cells and in vitro For cleavage assay in mammalian cells, 3 µg of pcdna3-pbs1-ha plasmids were cotransfected with 2 µg of pcdna3-avrpphb-flag (wild type or ) constructs into 6 x 10 6 HEK293T cells. The cells were lysed in 200 µl of SDS sample buffer, 15 µl of which were loaded onto a SDS-PAGE gel followed by anti-ha, or anti-au1, or anti-flag immuno-blot. For RPS5 cleavage experiments, 1 x 10 7 HEK293T cells were co-transfected with 6 µg of pef4- RPS5-myc constructs and 4 µg of pcdna3-avrpphb-flag (wild type or ) constructs. The cells were lysed in 1 ml of the buffer containing 10 mm HEPES (ph 7.5), 50 mm NaCl, 1% Triton, 2 mm EDTA and a protease inhibitor mixture. The cell lysates were then subjected to anti-myc immunoprecipitation followed by anti-myc Western blot analysis. For in vitro cleavage assays, the mammalian expression constructs for PBS1, At3g17410, At5g02800 and RPS5 described above were in vitro transcribed and translated in the presence of 35 S-methionine using the TnT wheat germ extract system (Promega) following the manufactures' protocol. 5 µl of the transcription/translation reactions were added as substrates into a 40 µl cleavage reaction containing 50 mm Tris-HCl, 50 mm NaCl, 4 mm dithiotreitol, and 2 µg of purified recombinant AvrPphB-His6 protein (wild type or ). The reaction was carried out
5 by incubation at 30ûC for 1 hour and stopped by the addition of SDS sample buffer. One fifth of the reaction mixture was analyzed by SDS-PAGE, followed by autoradiography. Cleavage assays on purified recombinant PBS1 proteins were performed under the same condition as that used for the TnT cleavage assay except that purified GST-PBS1(G252R)-His6 proteins were used as the substrates. Cleavage products were visualized on SDS PAGE gels by Coomassie Blue staining, as well as analyzed by anti-gst and anti-his immunoblotting. Edman sequencing of PBS1 cleavage product Protein samples were separated on an SDS-PAGE gel and transferred to a PVDF membrane (Bio Rad ) in CAPS buffer. Following Coomassie staining and extensive destaining in 50% methanol of the membrane, protein bands to be sequenced were excised and subjected to Edman sequencing performed by the Macromolecular Structure Core Facility in the Biochemistry Department at Michigan State University. Kinase assays The kinase activity of PBS1 variants was measured using an in vitro autophosphorylation assay. HEK 293T cells were transfected with equal amounts of various pcdna3-pbs1-ha constructs. Cells were lysed in a buffer containing 50 mm Tris (ph 8.0), 150 mm NaCl, 1% NP-40, and a protease inhibitor mixture 24 hours after transfection. The cell lysates were then subjected to anti-ha immunoprecipitation. To measure the kinase activity, the immunoprecipitated PBS1 proteins on the protein A agarose were incubated in an in vitro kinase assay buffer containing 50 mm Tris, ph 7.2, 10 mm MnCl 2, 1 mm dithiothreitol (DTT), 20 µm ATP, 1 mg/ml BSA and 5 µci (g- 32 P)-ATP (New England Nuclear). The reaction was incubated at room tempreture for 30
6 min and quenched with SDS loading buffer. One-third of the kinase reaction was electrophoresed on a 12% SDS/PAGE gel. Radioactivity was analyzed by autoradiography and the level of PBS1 protein was measured by anti-ha Western blot. We also performed kinase assays on recombinant PBS1 protein purified from E. coli as previously described (S3). Complementation assays The function of various pbs1 mutant alleles was assayed by stable transformation of pbs1-1 mutant plants. Genomic clones (described above) were transformed into Arabidopsis using the floral dip method (S7). Transformed plants were selected by spraying soil grown seedlings with the herbicide Finale (glufosinate-ammonium; Aventis). Selected plants (T1 generation) were grown under 9 hour days for four weeks and then assayed for resistance to Pseudomonas syringae strain DC3000(avrPphB) using a hypersensitive resistance (HR) assay. Briefly, bacteria were grown overnight on King's medium B agar plates, resuspended in 10 mm MgCl 2 at on OD 600 of 0.075, and injected into the underside of leaves using a needleless syringe. Injections were performed in the late afternoon and HR-associated collapse of leaves scored hours later. For the PBS1-GDK clone, eleven T1 plants were scored by injecting 3 to 6 leaves per plant (38 leaves total); none displayed an HR. For the wild-type PBS1 clone, four T1 plants were scored and all injected leaves displayed an HR (26 leaves total). For the PBS1(K115N) allele, 5 T1 plants were scored and none of the injected leaves displayed an HR (26 leaves total). Leaves were removed from plants for photography at 20 hours after inoculation.
7 2. Supporting Online Figures Figure S1. Autophosphorylation activity of recombinant PBS1, PBS1-GDK, and PBS1(K115N). Figure S2. AvrPphB induces cleavage of PBS1 in mammalian cells. Figure S3. Recombinant AvrPphB cleaves PBS1 produced in wheat germ extract. Figure S4. Identification of residues in PBS1 required for cleavage by AvrPphB. Figure S5. Model depicting possible mechanism by which AvrPphB triggers the resistance response in Arabidopsis.
8 Figure S1 PBS1 GDK K115N Fig. S1. Autophosphorylation activity of recombinant PBS1, PBS1-GDK, and PBS1(K115N). Approximately 250 ng of purified recombinant protein was incubated in a kinase reaction buffer with γ- 32 P-ATP, then separated on an SDS-PAGE gel and viewed by autoradiography.
9 Figure S2 (AU1)-PBS1-HA G/R G/R G/R AvrPphB ( AU1)-PBS1-HA 28 kda α-ha (AU1)-PBS1-HA 32 kda α-au1 α-gapdh Fig. S2. AvrPphB induces cleavage of PBS1 in mammalian cells. Plasmids encoding (AU1)-PBS1-HA (wild type or G252R mutant) were co-transfected with AvrPphB-Flag constructs (wild type or ) into HEK 293T cells. Total cell lysates were analyzed by anti-ha (upper panel) and anti-au1 (lower panel) immunoblot. Total protein loading was controlled by analysis of the same gel using anti-gapdh antibody.
10 Figure S3 PBS1 G252R AvrPphB Input Input PBS1 Nonspecific 32 kda 28 kda Fig. S3. Recombinant AvrPphB cleaves PBS1 produced in wheat germ extract. PBS1 (wild type or the pbs1-2 allele G252R) was in vitro transcribed/translated in a wheat germ extract system containing 35 S-methionine. The labeled proteins were then incubated with purified recombinant AvrPphB proteins, and samples analyzed by autoradiography of SDS-PAGE gels.
11 Figure S4 PBS1 I219A L221A G241A D242A K243A AvrPphB Fig. S4. Identification of residues in PBS1 required for cleavage by AvrPphB. The indicated PBS1 variants were in vitro transcribed/translated in a wheat germ extract containing 35 S-methionine, and the labeled proteins used as substrates for cleavage by recombinant AvrPphB. Arrows indicate the cleavage products. Mutants I219A and L221A blocked cleavage and eliminated kinase activity (not shown), possibly indicating gross structural changes. All other mutants retained kinase activity.
12 Figure S5 Fig. S5. Model depicting possible mechanism by which AvrPphB triggers the resistance response in Arabidopsis. The AvrPphB protease cleaves the auto-phosphorylated PBS1 protein, and a PBS1 cleavage product binds to and activates the RPS5 protein. All three proteins are shown as being associated with a membrane because all contain putative myristoylation motifs and pellet with the membrane fraction during high-speed centrifugation (data not shown).
13 3. Supporting Online References S1. F. Shao, P. M. Merritt, Z. Bao, R. W. Innes, J. E. Dixon, Cell 109, 575 (2002). S2. M. T. Simonich, R. W. Innes, Mol Plant Microbe Interact 8, 637 (1995). S3. M. R. Swiderski, R. W. Innes, Plant J 26, 101 (2001). S4. T. Aoyama, N.-H. Chua, Plant J. 11, 605 (1997). S5. R. P. Hellens, E. A. Edwards, N. R. Leyland, S. Bean, P. M. Mullineaux, Plant Mol Biol 42, 819 (2000). S6. Z. Nimchuk et al., Cell 101, 353 (2000). S7. S. J. Clough, A. F. Bent, Plant J 16, 735 (1998).
Analysing protein protein interactions using a GST-fusion protein to pull down the interacting target from the cell lysate Hong Wang and Xin Zeng
Analysing protein protein interactions using a GST-fusion protein to pull down the interacting target from the cell lysate Hong Wang and Xin Zeng Department of Molecular Genetics, Biochemistry and Microbiology,
More informationSupplementary Information: Materials and Methods. Immunoblot and immunoprecipitation. Cells were washed in phosphate buffered
Supplementary Information: Materials and Methods Immunoblot and immunoprecipitation. Cells were washed in phosphate buffered saline (PBS) and lysed in TNN lysis buffer (50mM Tris at ph 8.0, 120mM NaCl
More informationSupplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53
Supplementary data Supplemental Figure 1 A sienigma #2 sienigma sicontrol a-enigma - + ++ - - - - - - + ++ - - - - - - ++ B sienigma F-Enigma F-EnigmaSM a-flag HLK3 cells - - - + ++ + ++ - + - + + - -
More informationCdc42 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Cdc42 Activation Assay Kit Catalog Number: 80701 20 assays 1 Table of Content Product Description 3 Assay
More information1. Cross-linking and cell harvesting
ChIP is a powerful tool that allows the specific matching of proteins or histone modifications to regions of the genome. Chromatin is isolated and antibodies to the antigen of interest are used to determine
More informationRheB Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based RheB Activation Assay Kit Catalog Number: 81201 20 assays NewEast Biosciences 1 FAX: 610-945-2008 Table
More informationArf6 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Arf6 Activation Assay Kit Catalog Number: 82401 20 assays NewEast Biosciences 1 Table of Content Product
More informationFor Research Use Only. Not for use in diagnostic procedures.
Printed December 13, 2011 Version 1.0 For Research Use Only. Not for use in diagnostic procedures. DDDDK-tagged Protein PURIFICATION GEL with Elution Peptide (MoAb. clone FLA-1) CODE No. 3326 / 3327 PURIFICATION
More informationRab5 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Rab5 Activation Assay Kit Catalog Number: 83701 20 assays 24 Whitewoods Lane 1 Table of Content Product
More informationGα i Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Gα i Activation Assay Kit Catalog Number 80301 20 assays NewEast Biosciences, Inc 1 Table of Content Product
More informationBACTERIAL PRODUCTION EXPRESSION METHOD OVERVIEW: PEF # GENE NAME EXPRESSION VECTOR MOLECULAR WEIGHT kda (full-length) 34.
BACTERIAL PRODUCTION PEF # GENE NAME EXPRESSION VECTOR MOLECULAR WEIGHT 2015-XXXX XXXX pet-32a 50.9 kda (full-length) 34.0 kda (cleaved) EXPRESSION METHOD OVERVIEW: Plasmid DNA was transformed into BL21
More informationSupplementary Figure S1. Growth patterns of WT and siz1-2 plants and the effect of different nitrogen sources on their growth. After germination on
Supplementary Figure S1. Growth patterns of WT and siz1-2 plants and the effect of different nitrogen sources on their growth. After germination on MS media, seedlings were transferred to soil and treated
More informationProtocol for in vitro transcription
Protocol for in vitro transcription Assemble the reaction at room temperature in the following order: Component 10xTranscription Buffer rntp T7 RNA Polymerase Mix grna PCR DEPC H 2 O volume 2μl 2μl 2μl
More informationGST Fusion Protein Purification Kit
Glutathione Resin GST Fusion Protein Purification Kit Cat. No. L00206 Cat. No. L00207 Technical Manual No. TM0185 Version 01042012 Index 1. Product Description 2. Related Products 3. Purification Procedure
More informationSuperexpression of tuberculosis antigens in plant leaves
Superexpression of tuberculosis antigens in plant leaves Tuberculosis Volume 87, Issue 3, May 2007, Pages 218-224 Yuri L. Dorokhov, a,, Anna A. Shevelevaa, Olga Y. Frolovaa, Tatjana V. Komarovaa, Anna
More informationSupporting Information
Supporting Information Su et al. 10.1073/pnas.1211604110 SI Materials and Methods Cell Culture and Plasmids. Tera-1 and Tera-2 cells (ATCC: HTB- 105/106) were maintained in McCoy s 5A medium with 15% FBS
More informationpt7ht vector and over-expressed in E. coli as inclusion bodies. Cells were lysed in 6 M
Supplementary Methods MIG6 production, purification, inhibition, and kinase assays MIG6 segment 1 (30mer, residues 334 364) peptide was synthesized using standard solid-phase peptide synthesis as described
More informationHOOK 6X His Protein Purification (Yeast)
G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name HOOK 6X His Protein Purification (Yeast) For The Purification of His Tagged Proteins from
More informationGlutathione Resin. (Cat. # , , , ) think proteins! think G-Biosciences
191PR 05 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Glutathione Resin (Cat. # 786 280, 786 310, 786 311, 786 312) think proteins! think
More informationIgG TrueBlot Protocol for Mouse, Rabbit or Goatderived Antibodies - For Research Use Only
IgG TrueBlot Protocol for Mouse, Rabbit or Goatderived Antibodies - For Research Use Only Introduction The IgG TrueBlot for mouse, rabbit, or goat-derived antibodies represents unique series of respective
More informationSUPPLEMENTARY INFORMATION
The Supplementary Information (SI) Methods Cell culture and transfections H1299, U2OS, 293, HeLa cells were maintained in DMEM medium supplemented with 10% fetal bovine serum. H1299 and 293 cells were
More informationHOOK 6X His Protein Purification (Bacteria)
182PR-02 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name HOOK 6X His Protein Purification (Bacteria) For The Purification Of His-Tagged Proteins
More information5.2 Protein purification
Purification of a His 6 -tagged Green Fluorescent Protein (GFP). Protein purification.. Purification of a His 6 -tagged Green Fluorescent Protein (GFP) Principle You can add either a N- or C-terminal His
More informationSupplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons
Neuron, Volume 61 Supplemental Data LMO4 Controls the Balance between Excitatory and Inhibitory Spinal V2 Interneurons Kaumudi Joshi, Seunghee Lee, Bora Lee, Jae W. Lee, and Soo-Kyung Lee Supplemental
More informationSupplementary information
Supplementary information The E3 ligase RNF8 regulates KU80 removal and NHEJ repair Lin Feng 1, Junjie Chen 1 1 Department of Experimental Radiation Oncology, The University of Texas M. D. Anderson Cancer
More informationab Ran Activation Assay Kit
ab173247 Ran Activation Assay Kit Instructions for Use For the simple and fast measurement of Ran activation. This product is for research use only and is not intended for diagnostic use. Version 1 Last
More informationGα 13 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Gα 13 Activation Assay Kit Catalog Number: 80401 20 assays NewEast Biosciences 1 Table of Content Product
More informationSupplemental Experimental Procedures
Supplemental Experimental Procedures Generation of BLM protein segments and mutants. For immunoprecipitation experiments with topoisomerase IIα, BLM N-terminal segments were generated by PCR amplification
More informationdriven by unfolded protein response elements-upre s). E. coli BL21(DE3) lysogens
Supporting Online Material Materials and Methods Strains and Plasmids: The ire1 yeast strain PWY260 ( ire1::trp1; his3-11,-15::his + UPRE-lacZ; leu2-3,- 112::LEU2 + UPRE-lacZ; ura3-1) used in this study
More informationAt E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in
Supplementary Materials and Methods Barrier function assays At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in acidic X-gal mix (100 mm phosphate buffer at ph4.3, 3 mm
More informationAttenuation of synaptic toxicity and MARK4/PAR1-mediated Tau phosphorylation by
Supplementary Methods and Figures Attenuation of synaptic toxicity and MARK4/PAR1-mediated Tau phosphorylation by methylene blue for Alzheimer s disease treatment Wenchao Sun 1, Seongsoo Lee 1,2, Xiaoran
More informationHOOK 6X His Protein Spin Purification (Bacteria)
222PR 03 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name HOOK 6X His Protein Spin Purification (Bacteria) For the Purification of His Tagged
More informationAntibodies against PCNA were previously described [1]. To deplete PCNA from Xenopus egg
Supplementary information Supplementary methods PCNA antibody and immunodepletion Antibodies against PCNA were previously described [1]. To deplete PCNA from Xenopus egg extracts, one volume of protein
More informationRhoC Activation Assay Kit
Product Manual RhoC Activation Assay Kit Catalog Number STA-403-C 20 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Small GTP-binding proteins (or GTPases) are a family
More informationProtein A Agarose Immunoprecipitation Kit
Protein A Agarose Immunoprecipitation Kit Catalog Number KA0568 20 Reactions Version: 01 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information...
More informationGST Elution Buffer. (Cat. # ) think proteins! think G-Biosciences
191PR-05 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name GST Elution Buffer (Cat. #786-541) think proteins! think G-Biosciences www.gbiosciences.com
More informationSUPPLEMENTARY INFORMATION
R2A MASNSEKNPLL-SDEKPKSTEENKSS-KPESASGSSTSSAMP---GLNFNAFDFSNMASIL 56 R2B MASSSEKTPLIPSDEKNDTKEESKSTTKPESGSGAPPSPS-PTDPGLDFNAFDFSGMAGIL 60 R2A NDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVNTMQQVMHNPEFK
More informationab G alpha i Activation Assay Kit
ab173234 G alpha i Activation Assay Kit Instructions for Use For the simple and fast measurement of G alpha i activation. This product is for research use only and is not intended for diagnostic use. Version
More informationGlutathione Resin. (Cat. # , , , ) think proteins! think G-Biosciences
191PR-05 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Glutathione Resin (Cat. # 786-280, 786-310, 786-311, 786-312) think proteins! think
More informationQuantitative and non-quantitative RT-PCR. cdna was generated from 500ng RNA (iscript;
Supplemental Methods Quantitative and non-quantitative RT-PCR. cdna was generated from 500ng RNA (iscript; Bio-Rad, Hercules, CA, USA) and standard RT-PCR experiments were carried out using the 2X GoTaq
More informationA General Protocol for GST Pull-down Lili Jing *
A General Protocol for GST Pull-down Lili Jing * Department of Cell and Molecular Biology, University of Pennsylvania, Philadelphia, USA *For correspondence: lilijingcn@gmail.com [Abstract] GST pull-down
More informationSupplemental Information
FOOT-AND-MOUTH DISEASE VIRUS PROTEIN 2C IS A HEXAMERIC AAA+ PROTEIN WITH A COORDINATED ATP HYDROLYSIS MECHANISM. Trevor R. Sweeney 1, Valentina Cisnetto 1, Daniel Bose 2, Matthew Bailey 3, Jon R. Wilson
More informationStabilization of a virus-like particle and its application as a nanoreactor at physiological conditions
Supporting Information Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Lise Schoonen, b Sjors Maassen, b Roeland J. M. Nolte b and Jan C. M. van
More informationOPPF-UK Standard Protocols: Mammalian Expression
OPPF-UK Standard Protocols: Mammalian Expression Joanne Nettleship joanne@strubi.ox.ac.uk Table of Contents 1. Materials... 3 2. Cell Maintenance... 4 3. 24-Well Transient Expression Screen... 5 4. DNA
More informationSupplemental Information. OprG Harnesses the Dynamics of its Extracellular. Loops to Transport Small Amino Acids across
Structure, Volume 23 Supplemental Information OprG Harnesses the Dynamics of its Extracellular Loops to Transport Small Amino Acids across the Outer Membrane of Pseudomonas aeruginosa Iga Kucharska, Patrick
More informationHuman Viperin Causes Radical SAM Dependent Elongation of E. coli Hinting at its Physiological Role
Supporting Information Human Viperin Causes Radical SAM Dependent Elongation of E. coli Hinting at its Physiological Role Micah T. Nelp, Anthony P. Young, Branden M. Stepanski, Vahe Bandarian* Department
More informationAnti-CLOCK (Mouse) mab
Page 1 For Research Use Only. Not for use in diagnostic procedures. Anti-CLOCK (Mouse) mab CODE No. D349-3 CLONALITY CLONE ISOTYPE QUANTITY SOURCE IMMUNOGEN FORMURATION STORAGE Monoclonal CLSP4 Mouse IgG1
More informationSUPPLEMENTARY INFORMATION
Supplementary Methods Protein expression and in vitro binding studies. Recombinant baculovirus carrying GST, GST-mCC, GST-mSec, GST-mSecA and GST-mSecD were generated according to the manufacturer s instructions
More informationSupplemental Data. Noncoding Transcription by RNA Polymerase Pol IVb/Pol V Mediates Transcriptional Silencing of Overlapping and Adjacent Genes
Cell, Volume 135 Supplemental Data Noncoding Transcription by RNA Polymerase Pol IVb/Pol V Mediates Transcriptional Silencing of Overlapping and Adjacent Genes Andrzej T. Wierzbicki, Jeremy R. Haag, and
More informationPurification of GST-tagged proteins using PureCube Glutathione Agarose
Purification GST-tagged proteins using PureCube Glutathione Agarose Overview This protocol describes the generation a cleared lysate from 200 ml E. coli cell culture, and the purification GST-tagged proteins
More informationSupplementary Information: Materials and Methods. GST and GST-p53 were purified according to standard protocol after
Supplementary Information: Materials and Methods Recombinant protein expression and in vitro kinase assay. GST and GST-p53 were purified according to standard protocol after induction with.5mm IPTG for
More informationCHAPTER 4 Cloning, expression, purification and preparation of site-directed mutants of NDUFS3 and NDUFS7
CHAPTER 4 Cloning, expression, purification and preparation of site-directed mutants of NDUFS3 and NDUFS7 subunits of human mitochondrial Complex-I Q module N DUFS2, 3, 7 and 8 form the core subunits of
More informationGeNei TM Transformation Teaching Kit Manual
Teaching Kit Manual Cat No. New Cat No. KT07 107385 KT07A 106220 Revision No.: 00060505 CONTENTS Page No. Objective 3 Principle 3 Kit Description 6 Materials Provided 7 Procedure 9 Observation & Interpretation
More informationKinase Reaction and Alkylation Protocol
Kinase Reaction and Alkylation Protocol Protocol for the treatment of substrates prior to detection by Thiophosphate Ester antibodies This product is for research use only and is not intended for diagnostic
More informationFisher (Fairlawn, NJ) and Sigma-Aldrich (St. Louis, MO) and were used without further. (Promega) and DpnI (New England Biolabs, Beverly, MA).
175 Appendix III Chapter 4 Methods General. Unless otherwise noted, reagents were purchased from the commercial suppliers Fisher (Fairlawn, NJ) and Sigma-Aldrich (St. Louis, MO) and were used without further
More informationsupplementary information
DOI: 1.138/ncb1839 a b Control 1 2 3 Control 1 2 3 Fbw7 Smad3 1 2 3 4 1 2 3 4 c d IGF-1 IGF-1Rβ IGF-1Rβ-P Control / 1 2 3 4 Real-time RT-PCR Relative quantity (IGF-1/ mrna) 2 1 IGF-1 1 2 3 4 Control /
More informationSupplemental Data. Lee et al. Plant Cell. (2010) /tpc Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2.
Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2. (A) Protein structures of DWA1 and DWA2. WD40 region was determined based on the NCBI conserved domain databases (B, C) Schematic representation
More informationTable S1 Yeast strains used in this study Strain Genotype JSY7452* MAT ade2-1 leu2-3 his3-11,15 trp1-1 ura3-1 can1-100 JSY7453* MAT ade2-1 leu2-3
Table S1 Yeast strains used in this study Strain Genotype JSY7452* MAT ade2-1 leu2-3 his3-11,15 trp1-1 ura3-1 can1-100 JSY7453* MAT ade2-1 leu2-3 his3-11,15 trp1-1 ura3-1 can1-100 mfb1::his3 JSY8272 MAT
More informationImmunoprecipitation (IP)
BlueGene Biotech Co.,Ltd. Tel: 0086-21-61471242 Fax: 0086-21-61471242 ext 806 E-mail: sales@bluegene.cc tech@bluegene.cc www.elisakit.cc www.bluegene.cc Immunoprecipitation (IP) Immunoprecipitation is
More informationImmunoprecipitation Protocol
Immunoprecipitation Protocol Immunoprecipitation is a general method to obtain the enrichment of a specific protein from tissue lysate and cell lysate. It can be used to purify a specific protein, to identify
More informationIndex 1. Product Description 2. Purification Procedure 3. Troubleshooting 4. Ordering Information
High Affinity Ni-Charged Resin Cat. No. L00223 Technical Manual No. TM0217 Version 07132010 Index 1. Product Description 2. Purification Procedure 3. Troubleshooting 4. Ordering Information 1. Product
More informationYeast Nuclei Isolation Kit
Yeast Nuclei Isolation Kit Catalog Number KA3951 50 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 General Information...
More informationSupplemental Materials and Methods:
Supplemental Materials and Methods: Cloning: Oligonucleotides used in the subcloning steps are listed in Supplemental Table 1. Human FANCI (isoform 1, KIAA1794) was subcloned from pcmv6-xl4 [FANCI] in
More informationCheckpoint Kinase Activity Immunoblot Kit
Product Manual Checkpoint Kinase Activity Immunoblot Kit Catalog Number STA- 413 20 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Cdc25C is a protein phosphatase responsible
More informationSupplemental Information
Supplemental Information ATP-dependent unwinding of U4/U6 snrnas by the Brr2 helicase requires the C-terminus of Prp8 Corina Maeder 1,3, Alan K. Kutach 1,2,3, and Christine Guthrie 1 1 Department of Biochemistry
More informationStrep-Spin Protein Miniprep Kit Catalog No. P2004, P2005
INSTRUCTION MANUAL Strep-Spin Protein Miniprep Kit Catalog No. P2004, P2005 Highlights Fast protocol to purify Strep-tagged proteins from cell-free extracts Screen your recombinant colonies directly for
More informationSupporting Information
Supporting Information Krieg et al. 10.1073/pnas.0907131106 SI Text Reagents. Recombinant human TNF- was from Peprotech. Monoclonal rat anti-rip2 was purchased from Alexis, whereas monoclonal mouse anti-xiap
More informationNOTE ACRYLAMIDE IS NEUROTOXIN YOU MUST WEAR GLOVES.
GST Purfication and Pulldown Part I Instructor: David Deitcher TA: Kristy Lawton In order to study the function of a protein it is often useful to have that protein purified away from others in the cell.
More informationPROCEDURE FOR USE NICKEL NTA Magnetic Agarose Beads (5%)
1 AFFINITY HIS-TAG PURIFICATION PROCEDURE FOR USE NICKEL NTA Magnetic Agarose Beads (5%) DESCRIPTION Nickel NTA Magnetic Agarose Beads are products that allow rapid and easy small-scale purification of
More informationSupplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/-
#1074683s 1 Supplemental Online Material Materials and Methods Cell lines and tissue culture The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- knock-out animals
More informationFig. S1. CrgA intracellular levels in M. tuberculosis. Ten and twenty micrograms of
Supplementary data Fig. S1. CrgA intracellular levels in M. tuberculosis. Ten and twenty micrograms of cell free protein lysates from WT M. tuberculosis (Rv) together with various known concentrations
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION SUPPLEMENTARY MATERIALS AND METHODS Antibodies and sirna The antibodies against BAF170, BAF155, BAF60a, BAF57 and BAF53 were purchased from Santa Cruz (TX), and the antibodies
More informationChromatin Immunoprecipitation (ChIP)
de Lange Lab Chromatin Immunoprecipitation (ChIP) Required Solutions IP Wash A 0.1% SDS 1% Triton X-100 2 mm EDTA ph 8.0 20 mm Tris-HCl ph 8.0 150 mm NaCl 1 mm PMSF 1 µg/ml Leupeptin 1 µg/ml Aprotinin
More information5.36 Biochemistry Laboratory Spring 2009
MIT OpenCourseWare http://ocw.mit.edu 5.36 Biochemistry Laboratory Spring 2009 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms. Laboratory Manual for URIECA
More informationProtein Translation Study Label Protein with S35 Methionine in Cells Salma Hasan and Isabelle Plo *
Protein Translation Study Label Protein with S35 Methionine in Cells Salma Hasan and Isabelle Plo * INSERM U1009, Gustave Roussy, Villejuif, France *For correspondence: isabelle.plo@gustaveroussy.fr [Abstract]
More informationJan 25, 05 His Bind Kit (Novagen)
Jan 25, 05 His Bind Kit (Novagen) (1) Prepare 5ml of 1X Charge buffer (stock is 8X= 400mM NiSO4): 0.625ml of the stock + 4.375ml DH2O. (2) Prepare 13ml of 1X Binding buffer (stock is 8X = 40mM imidazole,
More informationSupplementary Figure 1 - Characterization of rbag3 binding on macrophages cell surface.
Supplementary Figure 1 - Characterization of rbag3 binding on macrophages cell surface. (a) Human PDAC cell lines were treated as indicated in Figure 1 panel F. Cells were analyzed for FITC-rBAG3 binding
More informationSupplemental Information. PARP1 Represses PAP and Inhibits Polyadenylation during Heat Shock
Molecular Cell, Volume 49 Supplemental Information PARP1 Represses PAP and Inhibits Polyadenylation during Heat Shock Dafne Campigli Di Giammartino, Yongsheng Shi, and James L. Manley Supplemental Information
More informationSupporting Information
Supporting Information Development of a 2,4-Dinitrotoluene-Responsive Synthetic Riboswitch in E. coli cells Molly E. Davidson, Svetlana V. Harbaugh, Yaroslav G. Chushak, Morley O. Stone, Nancy Kelley-
More informationAminTRAP HIS Prepacked Column
INDEX Ordering Information... 3 Intended Use... 3 Product Description... 3 Purification Procedure... 4 Sample Preparation... 5 Sample Purification... 6 Analysis... 6 Regeneration Procedure... 6 Use and
More informationCHAPTER 5 PTP-1B CLONING AND RECOMBINANT PROTEIN EXPRESSION. Recombinant DNA technology has revolutionized molecular biology and
204 CHAPTER 5 PTP-1B CLONING AND RECOMBINANT PROTEIN EXPRESSION SUMMARY Recombinant DNA technology has revolutionized molecular biology and genetics. Today, virtually any segment of DNA, the genetic material
More informationChIP protocol Chromatin fragmentation using the Covaris S2 sonicator by Ethan Ford (version 12/1/11) X- link Cells
ChIP protocol Chromatin fragmentation using the Covaris S2 sonicator by Ethan Ford (version 12/1/11) X- link Cells 1. Grow six 15 cm plates of HeLa cells to 90% confluency. 2. Remove media and add wash
More informationSUPPLEMENTAL INFORMATION
SUPPLEMENTAL INFORMATION SUPPLEMENTAL DATA Table S1: Related to Figure 4. DnaA screen for divalent cations and nucleotides. Concentration of reagents, T m and F fold30 75. Reagent Conc T m (±SEM) mm C
More informationHiChIP Protocol Mumbach et al. (CHANG), p. 1 Chang Lab, Stanford University. HiChIP Protocol
HiChIP Protocol Mumbach et al. (CHANG), p. 1 HiChIP Protocol Citation: Mumbach et. al., HiChIP: Efficient and sensitive analysis of protein-directed genome architecture. Nature Methods (2016). Cell Crosslinking
More informationExpression and Purification of the Thermus thermophilus Argonaute Protein Daan C. Swarts *, Matthijs M. Jore and John van der Oost
Expression and Purification of the Thermus thermophilus Argonaute Protein Daan C. Swarts *, Matthijs M. Jore and John van der Oost Department of Agrotechnology and Food Sciences, Wageningen University,
More informationRNP-IP (Modified Method)-Getting Majority RNA from RNA Binding Protein in the Cytoplasm Fengzhi Liu *
RNP-IP (Modified Method)-Getting Majority RNA from RNA Binding Protein in the Cytoplasm Fengzhi Liu * School of Biomedical Sciences, Thomas Jefferson University, Philadelphia, USA *For correspondence:
More informationLINGO-1, A TRANSMEMBRANE SIGNALING PROTEIN, INHIBITS OLIGODENDROCYTE DIFFERENTIATION AND MYELINATION THROUGH INTERCELLULAR SELF- INTERACTIONS.
Supplemental Data: LINGO-1, A TRANSMEMBRANE SIGNALING PROTEIN, INHIBITS OLIGODENDROCYTE DIFFERENTIATION AND MYELINATION THROUGH INTERCELLULAR SELF- INTERACTIONS. Scott Jepson, Bryan Vought, Christian H.
More informationSupplementary Materials and Methods
Supplementary Materials and Methods sirna sequences used in this study The sequences of Stealth Select RNAi for ALK and FLOT-1 were as follows: ALK sense no.1 (ALK): 5 -AAUACUGACAGCCACAGGCAAUGUC-3 ; ALK
More informationTECHNICAL BULLETIN. EZview Red ANTI-FLAG M2 Affinity Gel. Catalog Number F2426 Storage Temperature 20 C
EZview Red ANTI-FLAG M2 Affinity Gel Catalog Number F2426 Storage Temperature 20 C TECHNICAL BULLETIN Product Description EZview Red ANTI-FLAG M2 Affinity Gel is a highly visible, red colored ANTI-FLAG
More informationElectronic Supplementary Information. and purified according to previously published procedures(1). GlcNAc and Phos-FLAG were
Electronic Supplementary Information Experimental details: Synthesis and purification of sugars. GlcN, 4 GlcN, and 4 GlcN were synthesized and purified according to previously published procedures(1).
More informationSupplementary Material
Supplementary Material Supplementary Methods Cell synchronization. For synchronized cell growth, thymidine was added to 30% confluent U2OS cells to a final concentration of 2.5mM. Cells were incubated
More informationTransfection of CRISPR/Cas9 Nuclease NLS ribonucleoprotein (RNP) into adherent mammalian cells using Lipofectamine RNAiMAX
Transfection of CRISPR/Cas9 Nuclease NLS ribonucleoprotein (RNP) into adherent mammalian cells using Lipofectamine RNAiMAX INTRODUCTION The CRISPR/Cas genome editing system consists of a single guide RNA
More informationOPPF-UK Standard Protocols: Insect Cell Purification
OPPF-UK Standard Protocols: Insect Cell Purification Last Updated 6 th October 2016 Joanne Nettleship joanne@strubi.ox.ac.uk OPPF-UK SOP: Insect Cell Purification Table of Contents Suggested Schedule...
More informationStrep-Spin Protein Miniprep Kit Catalog No. P2004 & P2005
INSTRUCTION MANUAL Strep-Spin Protein Miniprep Kit Catalog No. P2004 & P2005 Highlights Fast & Simple: Purify Strep-tagged proteins from cell-free extracts using a spin-column in 7 minutes High-Quality:
More informationComparison of different methods for purification analysis of a green fluorescent Strep-tag fusion protein. Application
Comparison of different methods for purification analysis of a green fluorescent Strep-tag fusion protein Application Petra Sebastian Meike Kuschel Stefan Schmidt Abstract This Application Note describes
More informationSupplemental Information
Supplemental Information Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome * Qihong Zhang 1#, Dahai
More informationEPIGENTEK. EpiQuik Tissue Chromatin Immunoprecipitation Kit. Base Catalog # P-2003 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE
EpiQuik Tissue Chromatin Immunoprecipitation Kit Base Catalog # P-2003 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik Tissue Chromatin Immunoprecipitation Kit is suitable for combining the specificity
More informationRal Activation Assay Kit
Product Manual Ral Activation Assay Kit Catalog Number STA-408 20 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Small GTP-binding proteins (or GTPases) are a family of
More informationFig. S1 TGF RI inhibitor SB effectively blocks phosphorylation of Smad2 induced by TGF. FET cells were treated with TGF in the presence of
Fig. S1 TGF RI inhibitor SB525334 effectively blocks phosphorylation of Smad2 induced by TGF. FET cells were treated with TGF in the presence of different concentrations of SB525334. Cells were lysed and
More informationFor Research Use Only. Not for use in diagnostic procedures. Anti-NRF2 mab
Page 1 For Research Use Only. Not for use in diagnostic procedures. Anti-NRF2 mab CODE No. M200-3 CLONALITY CLONE ISOTYPE QUANTITY SOURCE IMMUNOGEN FORMURATION STORAGE Monoclonal 1F2 Mouse IgG1 100 L,
More information