Supporting Online Material

Size: px
Start display at page:

Download "Supporting Online Material"

Transcription

1 Supporting Online Material 1. Materials and Methods 2. Supporting online figures 3. Supporting online references 1. Material and Methods Plasmid constructs All AvrPphB and protease inactive AvrPphB() constructs were generated by PCR amplification of the 28 kda form of AvrPphB, which lacks the amino-terminal 62 amino acids, using previously described plasmid clones as templates (S1, S2). The PBS1 gene was amplified from a cdna construct (S3) for transient expression assays, and from genomic DNA for complementation assays. For mammalian expression, AvrPphB was inserted into a derivative of the pcdna3 vector (Invitrogen) containing a C-terminal FLAG epitope, and PBS1 was inserted into a pcdna3 derivative containing an HA epitope. An AU1 tag was inserted into the pcdna3-pbs1-ha construct between amino acid residues 19 and 20 of PBS1, which is after the PBS1 myristoylation site. Bacterial expression constructs of AvrPphB-His6 were generated by cloning wild-type and mutant AvrPphB into pet21a (Novagen). The bacterial expression construct pgex-kg-pbs1-his6 was constructed by inserting PBS1 into the pgex- KG vector (Pharmacia). Arabidopsis kinases At3g17410 and At5g02800 were amplified from an Arabidopsis cdna library and cloned into the pcdna3-ha vector. RPS5 coding sequence was amplified from a genomic RPS5 clone in the pgem-t vector (Promega) and cloned into the pef4-myc vector (Invitrogen). For dexamethasone-inducible expression in planta, wild-type and

2 mutant forms of AvrPphB and PBS1-HA were cloned into the vector pta7002 (S4). For complementation assays, a genomic fragment spanning from 875 bp 5' of the PBS1 start codon to 229 bp 3' of the stop codon was amplified by PCR and cloned into the pgreen0229 vector (S5). All point mutations as well as the AU1 tag insertion constructs were generated using a QuikChange Site-Directed Mutagenesis Kit (Stratagene). Plant material Nicotiana tabacum cultivar xanthi, Nicotiana benthamiana, Arabidopsis thaliana accessions Columbia (Col-0) and Landsberg-erecta (Ler), and the Col-0 mutant lines rps5-2, pbs1-1 and rar1-20 were grown under a 9-hour photoperiod at 24ûC. Agrobacterium transient expression in planta Agrobacterium tumefaciens GV3101 strains carrying the various dexamethasone-inducible constructs were grown and prepared for transient expression as described in (S6). Agrobacterium cultures was resuspended in infiltration medium at OD 600 = 0.4. For experiments requiring coexpression of AvrPphB and PBS1, suspensions were mixed in a 1:1 ratio, maintaining an OD 600 = 0.4. Bacterial suspensions were infiltrated into expanding leaves of 4-week old tobacco and N. benthamiana or 5-week old Arabidopsis plants. Plants were sprayed with 50 µm dexamethasone 40 hours after injection to induce expression. Samples were collected for protein extractions 4 hours after dexamethasone application for tobacco and N. benthamiana and 24 hours after application for Arabidopsis. Samples were flash-frozen in liquid nitrogen and ground in an extraction buffer (10 mm Tris-HCl, ph 7, 0.33 M sucrose, 1mM EDTA, plant Protease Inhibitor Cocktail (Sigma)). Extracts were centrifuged briefly to clear debris, and protein in the

3 supernatant quantified. Approximately 50 µg of proteins per sample were separated on a 10% SDS-PAGE and transferred to a nitrocellulose membrane. The resulting blots were probed with Anti-HA-Peroxidase High Affinity monoclonal antibody (Roche) or polyclonal anti-avrpphb antibody. Immunoprecipitation Following transient expression in N. benthamiana, 8 leaf-discs were collected and ground in lysis buffer (50 mm Tris, ph 7.5, 150 mm NaCl, 0.1% NP-40 and Plant Proteinase Inhibitor Cocktail (Sigma)). Protein concentrations were determined and normalized to 2 mg/ml. 100 µl of rat monoclonal Anti-HA matrix slurry (50 µl resin) (Roche) were added to 2 mg of protein in a 1.5 ml tube and mixed gently. The mixtures were incubated at 4ûC overnight with rotation endover-end. The resins were centrifuged at 16,000 g for 10 seconds and the pellets washed three times with 1 ml of lysis buffer. The immunocomplexes were resuspended in 50 µl of 1x SDS loading buffer, boiled for 5 minutes and 15 µl separated in a 10% SDS-PAGE gel. Proteins were transferred to a nitrocellulose membrane and probed with anti-ha-peroxidase high affinity monoclonal antibody (Roche). The blot was stripped and re-probed with anti-avrpphb polyclonal antibody. Protein expression and purification Recombinant AvrPphB-His6 and GST-PBS1-His6 mutants were expressed in E. coli BL21(DE3). E. coli clones were grown in LB medium containing 100 µg/ml ampicillin to a density of OD 600 =0.6. Protein expression was induced overnight at room temperature with 0.4 mm isopropyl b-d-thiogalactopyranoside (IPTG). Cells were lysed in the buffer containing 20

4 mm Tris (ph 8.0), 200 mm NaCl, 20 mm imidazole, and 5% glycerol supplemented with 1 mm phenylmethylsulfonylfluoride (PMSF) and 10 mm ß-mercaptoethanol. Both AvrPphB-His6 and GST-PBS1-His6 proteins were purified by Ni + -agarose affinity chromatography and eluted with 250 mm imidazole in the same buffer. Protein concentrations were estimated by Coomassie blue staining of SDS-PAGE gels using BSA standards. PBS1 and RPS5 cleavage assays in mammalian cells and in vitro For cleavage assay in mammalian cells, 3 µg of pcdna3-pbs1-ha plasmids were cotransfected with 2 µg of pcdna3-avrpphb-flag (wild type or ) constructs into 6 x 10 6 HEK293T cells. The cells were lysed in 200 µl of SDS sample buffer, 15 µl of which were loaded onto a SDS-PAGE gel followed by anti-ha, or anti-au1, or anti-flag immuno-blot. For RPS5 cleavage experiments, 1 x 10 7 HEK293T cells were co-transfected with 6 µg of pef4- RPS5-myc constructs and 4 µg of pcdna3-avrpphb-flag (wild type or ) constructs. The cells were lysed in 1 ml of the buffer containing 10 mm HEPES (ph 7.5), 50 mm NaCl, 1% Triton, 2 mm EDTA and a protease inhibitor mixture. The cell lysates were then subjected to anti-myc immunoprecipitation followed by anti-myc Western blot analysis. For in vitro cleavage assays, the mammalian expression constructs for PBS1, At3g17410, At5g02800 and RPS5 described above were in vitro transcribed and translated in the presence of 35 S-methionine using the TnT wheat germ extract system (Promega) following the manufactures' protocol. 5 µl of the transcription/translation reactions were added as substrates into a 40 µl cleavage reaction containing 50 mm Tris-HCl, 50 mm NaCl, 4 mm dithiotreitol, and 2 µg of purified recombinant AvrPphB-His6 protein (wild type or ). The reaction was carried out

5 by incubation at 30ûC for 1 hour and stopped by the addition of SDS sample buffer. One fifth of the reaction mixture was analyzed by SDS-PAGE, followed by autoradiography. Cleavage assays on purified recombinant PBS1 proteins were performed under the same condition as that used for the TnT cleavage assay except that purified GST-PBS1(G252R)-His6 proteins were used as the substrates. Cleavage products were visualized on SDS PAGE gels by Coomassie Blue staining, as well as analyzed by anti-gst and anti-his immunoblotting. Edman sequencing of PBS1 cleavage product Protein samples were separated on an SDS-PAGE gel and transferred to a PVDF membrane (Bio Rad ) in CAPS buffer. Following Coomassie staining and extensive destaining in 50% methanol of the membrane, protein bands to be sequenced were excised and subjected to Edman sequencing performed by the Macromolecular Structure Core Facility in the Biochemistry Department at Michigan State University. Kinase assays The kinase activity of PBS1 variants was measured using an in vitro autophosphorylation assay. HEK 293T cells were transfected with equal amounts of various pcdna3-pbs1-ha constructs. Cells were lysed in a buffer containing 50 mm Tris (ph 8.0), 150 mm NaCl, 1% NP-40, and a protease inhibitor mixture 24 hours after transfection. The cell lysates were then subjected to anti-ha immunoprecipitation. To measure the kinase activity, the immunoprecipitated PBS1 proteins on the protein A agarose were incubated in an in vitro kinase assay buffer containing 50 mm Tris, ph 7.2, 10 mm MnCl 2, 1 mm dithiothreitol (DTT), 20 µm ATP, 1 mg/ml BSA and 5 µci (g- 32 P)-ATP (New England Nuclear). The reaction was incubated at room tempreture for 30

6 min and quenched with SDS loading buffer. One-third of the kinase reaction was electrophoresed on a 12% SDS/PAGE gel. Radioactivity was analyzed by autoradiography and the level of PBS1 protein was measured by anti-ha Western blot. We also performed kinase assays on recombinant PBS1 protein purified from E. coli as previously described (S3). Complementation assays The function of various pbs1 mutant alleles was assayed by stable transformation of pbs1-1 mutant plants. Genomic clones (described above) were transformed into Arabidopsis using the floral dip method (S7). Transformed plants were selected by spraying soil grown seedlings with the herbicide Finale (glufosinate-ammonium; Aventis). Selected plants (T1 generation) were grown under 9 hour days for four weeks and then assayed for resistance to Pseudomonas syringae strain DC3000(avrPphB) using a hypersensitive resistance (HR) assay. Briefly, bacteria were grown overnight on King's medium B agar plates, resuspended in 10 mm MgCl 2 at on OD 600 of 0.075, and injected into the underside of leaves using a needleless syringe. Injections were performed in the late afternoon and HR-associated collapse of leaves scored hours later. For the PBS1-GDK clone, eleven T1 plants were scored by injecting 3 to 6 leaves per plant (38 leaves total); none displayed an HR. For the wild-type PBS1 clone, four T1 plants were scored and all injected leaves displayed an HR (26 leaves total). For the PBS1(K115N) allele, 5 T1 plants were scored and none of the injected leaves displayed an HR (26 leaves total). Leaves were removed from plants for photography at 20 hours after inoculation.

7 2. Supporting Online Figures Figure S1. Autophosphorylation activity of recombinant PBS1, PBS1-GDK, and PBS1(K115N). Figure S2. AvrPphB induces cleavage of PBS1 in mammalian cells. Figure S3. Recombinant AvrPphB cleaves PBS1 produced in wheat germ extract. Figure S4. Identification of residues in PBS1 required for cleavage by AvrPphB. Figure S5. Model depicting possible mechanism by which AvrPphB triggers the resistance response in Arabidopsis.

8 Figure S1 PBS1 GDK K115N Fig. S1. Autophosphorylation activity of recombinant PBS1, PBS1-GDK, and PBS1(K115N). Approximately 250 ng of purified recombinant protein was incubated in a kinase reaction buffer with γ- 32 P-ATP, then separated on an SDS-PAGE gel and viewed by autoradiography.

9 Figure S2 (AU1)-PBS1-HA G/R G/R G/R AvrPphB ( AU1)-PBS1-HA 28 kda α-ha (AU1)-PBS1-HA 32 kda α-au1 α-gapdh Fig. S2. AvrPphB induces cleavage of PBS1 in mammalian cells. Plasmids encoding (AU1)-PBS1-HA (wild type or G252R mutant) were co-transfected with AvrPphB-Flag constructs (wild type or ) into HEK 293T cells. Total cell lysates were analyzed by anti-ha (upper panel) and anti-au1 (lower panel) immunoblot. Total protein loading was controlled by analysis of the same gel using anti-gapdh antibody.

10 Figure S3 PBS1 G252R AvrPphB Input Input PBS1 Nonspecific 32 kda 28 kda Fig. S3. Recombinant AvrPphB cleaves PBS1 produced in wheat germ extract. PBS1 (wild type or the pbs1-2 allele G252R) was in vitro transcribed/translated in a wheat germ extract system containing 35 S-methionine. The labeled proteins were then incubated with purified recombinant AvrPphB proteins, and samples analyzed by autoradiography of SDS-PAGE gels.

11 Figure S4 PBS1 I219A L221A G241A D242A K243A AvrPphB Fig. S4. Identification of residues in PBS1 required for cleavage by AvrPphB. The indicated PBS1 variants were in vitro transcribed/translated in a wheat germ extract containing 35 S-methionine, and the labeled proteins used as substrates for cleavage by recombinant AvrPphB. Arrows indicate the cleavage products. Mutants I219A and L221A blocked cleavage and eliminated kinase activity (not shown), possibly indicating gross structural changes. All other mutants retained kinase activity.

12 Figure S5 Fig. S5. Model depicting possible mechanism by which AvrPphB triggers the resistance response in Arabidopsis. The AvrPphB protease cleaves the auto-phosphorylated PBS1 protein, and a PBS1 cleavage product binds to and activates the RPS5 protein. All three proteins are shown as being associated with a membrane because all contain putative myristoylation motifs and pellet with the membrane fraction during high-speed centrifugation (data not shown).

13 3. Supporting Online References S1. F. Shao, P. M. Merritt, Z. Bao, R. W. Innes, J. E. Dixon, Cell 109, 575 (2002). S2. M. T. Simonich, R. W. Innes, Mol Plant Microbe Interact 8, 637 (1995). S3. M. R. Swiderski, R. W. Innes, Plant J 26, 101 (2001). S4. T. Aoyama, N.-H. Chua, Plant J. 11, 605 (1997). S5. R. P. Hellens, E. A. Edwards, N. R. Leyland, S. Bean, P. M. Mullineaux, Plant Mol Biol 42, 819 (2000). S6. Z. Nimchuk et al., Cell 101, 353 (2000). S7. S. J. Clough, A. F. Bent, Plant J 16, 735 (1998).

Analysing protein protein interactions using a GST-fusion protein to pull down the interacting target from the cell lysate Hong Wang and Xin Zeng

Analysing protein protein interactions using a GST-fusion protein to pull down the interacting target from the cell lysate Hong Wang and Xin Zeng Analysing protein protein interactions using a GST-fusion protein to pull down the interacting target from the cell lysate Hong Wang and Xin Zeng Department of Molecular Genetics, Biochemistry and Microbiology,

More information

Supplementary Information: Materials and Methods. Immunoblot and immunoprecipitation. Cells were washed in phosphate buffered

Supplementary Information: Materials and Methods. Immunoblot and immunoprecipitation. Cells were washed in phosphate buffered Supplementary Information: Materials and Methods Immunoblot and immunoprecipitation. Cells were washed in phosphate buffered saline (PBS) and lysed in TNN lysis buffer (50mM Tris at ph 8.0, 120mM NaCl

More information

Supplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53

Supplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53 Supplementary data Supplemental Figure 1 A sienigma #2 sienigma sicontrol a-enigma - + ++ - - - - - - + ++ - - - - - - ++ B sienigma F-Enigma F-EnigmaSM a-flag HLK3 cells - - - + ++ + ++ - + - + + - -

More information

Cdc42 Activation Assay Kit

Cdc42 Activation Assay Kit A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Cdc42 Activation Assay Kit Catalog Number: 80701 20 assays 1 Table of Content Product Description 3 Assay

More information

1. Cross-linking and cell harvesting

1. Cross-linking and cell harvesting ChIP is a powerful tool that allows the specific matching of proteins or histone modifications to regions of the genome. Chromatin is isolated and antibodies to the antigen of interest are used to determine

More information

RheB Activation Assay Kit

RheB Activation Assay Kit A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based RheB Activation Assay Kit Catalog Number: 81201 20 assays NewEast Biosciences 1 FAX: 610-945-2008 Table

More information

Arf6 Activation Assay Kit

Arf6 Activation Assay Kit A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Arf6 Activation Assay Kit Catalog Number: 82401 20 assays NewEast Biosciences 1 Table of Content Product

More information

For Research Use Only. Not for use in diagnostic procedures.

For Research Use Only. Not for use in diagnostic procedures. Printed December 13, 2011 Version 1.0 For Research Use Only. Not for use in diagnostic procedures. DDDDK-tagged Protein PURIFICATION GEL with Elution Peptide (MoAb. clone FLA-1) CODE No. 3326 / 3327 PURIFICATION

More information

Rab5 Activation Assay Kit

Rab5 Activation Assay Kit A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Rab5 Activation Assay Kit Catalog Number: 83701 20 assays 24 Whitewoods Lane 1 Table of Content Product

More information

Gα i Activation Assay Kit

Gα i Activation Assay Kit A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Gα i Activation Assay Kit Catalog Number 80301 20 assays NewEast Biosciences, Inc 1 Table of Content Product

More information

BACTERIAL PRODUCTION EXPRESSION METHOD OVERVIEW: PEF # GENE NAME EXPRESSION VECTOR MOLECULAR WEIGHT kda (full-length) 34.

BACTERIAL PRODUCTION EXPRESSION METHOD OVERVIEW: PEF # GENE NAME EXPRESSION VECTOR MOLECULAR WEIGHT kda (full-length) 34. BACTERIAL PRODUCTION PEF # GENE NAME EXPRESSION VECTOR MOLECULAR WEIGHT 2015-XXXX XXXX pet-32a 50.9 kda (full-length) 34.0 kda (cleaved) EXPRESSION METHOD OVERVIEW: Plasmid DNA was transformed into BL21

More information

Supplementary Figure S1. Growth patterns of WT and siz1-2 plants and the effect of different nitrogen sources on their growth. After germination on

Supplementary Figure S1. Growth patterns of WT and siz1-2 plants and the effect of different nitrogen sources on their growth. After germination on Supplementary Figure S1. Growth patterns of WT and siz1-2 plants and the effect of different nitrogen sources on their growth. After germination on MS media, seedlings were transferred to soil and treated

More information

Protocol for in vitro transcription

Protocol for in vitro transcription Protocol for in vitro transcription Assemble the reaction at room temperature in the following order: Component 10xTranscription Buffer rntp T7 RNA Polymerase Mix grna PCR DEPC H 2 O volume 2μl 2μl 2μl

More information

GST Fusion Protein Purification Kit

GST Fusion Protein Purification Kit Glutathione Resin GST Fusion Protein Purification Kit Cat. No. L00206 Cat. No. L00207 Technical Manual No. TM0185 Version 01042012 Index 1. Product Description 2. Related Products 3. Purification Procedure

More information

Superexpression of tuberculosis antigens in plant leaves

Superexpression of tuberculosis antigens in plant leaves Superexpression of tuberculosis antigens in plant leaves Tuberculosis Volume 87, Issue 3, May 2007, Pages 218-224 Yuri L. Dorokhov, a,, Anna A. Shevelevaa, Olga Y. Frolovaa, Tatjana V. Komarovaa, Anna

More information

Supporting Information

Supporting Information Supporting Information Su et al. 10.1073/pnas.1211604110 SI Materials and Methods Cell Culture and Plasmids. Tera-1 and Tera-2 cells (ATCC: HTB- 105/106) were maintained in McCoy s 5A medium with 15% FBS

More information

pt7ht vector and over-expressed in E. coli as inclusion bodies. Cells were lysed in 6 M

pt7ht vector and over-expressed in E. coli as inclusion bodies. Cells were lysed in 6 M Supplementary Methods MIG6 production, purification, inhibition, and kinase assays MIG6 segment 1 (30mer, residues 334 364) peptide was synthesized using standard solid-phase peptide synthesis as described

More information

HOOK 6X His Protein Purification (Yeast)

HOOK 6X His Protein Purification (Yeast) G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name HOOK 6X His Protein Purification (Yeast) For The Purification of His Tagged Proteins from

More information

Glutathione Resin. (Cat. # , , , ) think proteins! think G-Biosciences

Glutathione Resin. (Cat. # , , , ) think proteins! think G-Biosciences 191PR 05 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Glutathione Resin (Cat. # 786 280, 786 310, 786 311, 786 312) think proteins! think

More information

IgG TrueBlot Protocol for Mouse, Rabbit or Goatderived Antibodies - For Research Use Only

IgG TrueBlot Protocol for Mouse, Rabbit or Goatderived Antibodies - For Research Use Only IgG TrueBlot Protocol for Mouse, Rabbit or Goatderived Antibodies - For Research Use Only Introduction The IgG TrueBlot for mouse, rabbit, or goat-derived antibodies represents unique series of respective

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION The Supplementary Information (SI) Methods Cell culture and transfections H1299, U2OS, 293, HeLa cells were maintained in DMEM medium supplemented with 10% fetal bovine serum. H1299 and 293 cells were

More information

HOOK 6X His Protein Purification (Bacteria)

HOOK 6X His Protein Purification (Bacteria) 182PR-02 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name HOOK 6X His Protein Purification (Bacteria) For The Purification Of His-Tagged Proteins

More information

5.2 Protein purification

5.2 Protein purification Purification of a His 6 -tagged Green Fluorescent Protein (GFP). Protein purification.. Purification of a His 6 -tagged Green Fluorescent Protein (GFP) Principle You can add either a N- or C-terminal His

More information

Supplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons

Supplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons Neuron, Volume 61 Supplemental Data LMO4 Controls the Balance between Excitatory and Inhibitory Spinal V2 Interneurons Kaumudi Joshi, Seunghee Lee, Bora Lee, Jae W. Lee, and Soo-Kyung Lee Supplemental

More information

Supplementary information

Supplementary information Supplementary information The E3 ligase RNF8 regulates KU80 removal and NHEJ repair Lin Feng 1, Junjie Chen 1 1 Department of Experimental Radiation Oncology, The University of Texas M. D. Anderson Cancer

More information

ab Ran Activation Assay Kit

ab Ran Activation Assay Kit ab173247 Ran Activation Assay Kit Instructions for Use For the simple and fast measurement of Ran activation. This product is for research use only and is not intended for diagnostic use. Version 1 Last

More information

Gα 13 Activation Assay Kit

Gα 13 Activation Assay Kit A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Gα 13 Activation Assay Kit Catalog Number: 80401 20 assays NewEast Biosciences 1 Table of Content Product

More information

Supplemental Experimental Procedures

Supplemental Experimental Procedures Supplemental Experimental Procedures Generation of BLM protein segments and mutants. For immunoprecipitation experiments with topoisomerase IIα, BLM N-terminal segments were generated by PCR amplification

More information

driven by unfolded protein response elements-upre s). E. coli BL21(DE3) lysogens

driven by unfolded protein response elements-upre s). E. coli BL21(DE3) lysogens Supporting Online Material Materials and Methods Strains and Plasmids: The ire1 yeast strain PWY260 ( ire1::trp1; his3-11,-15::his + UPRE-lacZ; leu2-3,- 112::LEU2 + UPRE-lacZ; ura3-1) used in this study

More information

At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in

At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in Supplementary Materials and Methods Barrier function assays At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in acidic X-gal mix (100 mm phosphate buffer at ph4.3, 3 mm

More information

Attenuation of synaptic toxicity and MARK4/PAR1-mediated Tau phosphorylation by

Attenuation of synaptic toxicity and MARK4/PAR1-mediated Tau phosphorylation by Supplementary Methods and Figures Attenuation of synaptic toxicity and MARK4/PAR1-mediated Tau phosphorylation by methylene blue for Alzheimer s disease treatment Wenchao Sun 1, Seongsoo Lee 1,2, Xiaoran

More information

HOOK 6X His Protein Spin Purification (Bacteria)

HOOK 6X His Protein Spin Purification (Bacteria) 222PR 03 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name HOOK 6X His Protein Spin Purification (Bacteria) For the Purification of His Tagged

More information

Antibodies against PCNA were previously described [1]. To deplete PCNA from Xenopus egg

Antibodies against PCNA were previously described [1]. To deplete PCNA from Xenopus egg Supplementary information Supplementary methods PCNA antibody and immunodepletion Antibodies against PCNA were previously described [1]. To deplete PCNA from Xenopus egg extracts, one volume of protein

More information

RhoC Activation Assay Kit

RhoC Activation Assay Kit Product Manual RhoC Activation Assay Kit Catalog Number STA-403-C 20 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Small GTP-binding proteins (or GTPases) are a family

More information

Protein A Agarose Immunoprecipitation Kit

Protein A Agarose Immunoprecipitation Kit Protein A Agarose Immunoprecipitation Kit Catalog Number KA0568 20 Reactions Version: 01 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information...

More information

GST Elution Buffer. (Cat. # ) think proteins! think G-Biosciences

GST Elution Buffer. (Cat. # ) think proteins! think G-Biosciences 191PR-05 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name GST Elution Buffer (Cat. #786-541) think proteins! think G-Biosciences www.gbiosciences.com

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION R2A MASNSEKNPLL-SDEKPKSTEENKSS-KPESASGSSTSSAMP---GLNFNAFDFSNMASIL 56 R2B MASSSEKTPLIPSDEKNDTKEESKSTTKPESGSGAPPSPS-PTDPGLDFNAFDFSGMAGIL 60 R2A NDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVNTMQQVMHNPEFK

More information

ab G alpha i Activation Assay Kit

ab G alpha i Activation Assay Kit ab173234 G alpha i Activation Assay Kit Instructions for Use For the simple and fast measurement of G alpha i activation. This product is for research use only and is not intended for diagnostic use. Version

More information

Glutathione Resin. (Cat. # , , , ) think proteins! think G-Biosciences

Glutathione Resin. (Cat. # , , , ) think proteins! think G-Biosciences 191PR-05 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Glutathione Resin (Cat. # 786-280, 786-310, 786-311, 786-312) think proteins! think

More information

Quantitative and non-quantitative RT-PCR. cdna was generated from 500ng RNA (iscript;

Quantitative and non-quantitative RT-PCR. cdna was generated from 500ng RNA (iscript; Supplemental Methods Quantitative and non-quantitative RT-PCR. cdna was generated from 500ng RNA (iscript; Bio-Rad, Hercules, CA, USA) and standard RT-PCR experiments were carried out using the 2X GoTaq

More information

A General Protocol for GST Pull-down Lili Jing *

A General Protocol for GST Pull-down Lili Jing * A General Protocol for GST Pull-down Lili Jing * Department of Cell and Molecular Biology, University of Pennsylvania, Philadelphia, USA *For correspondence: lilijingcn@gmail.com [Abstract] GST pull-down

More information

Supplemental Information

Supplemental Information FOOT-AND-MOUTH DISEASE VIRUS PROTEIN 2C IS A HEXAMERIC AAA+ PROTEIN WITH A COORDINATED ATP HYDROLYSIS MECHANISM. Trevor R. Sweeney 1, Valentina Cisnetto 1, Daniel Bose 2, Matthew Bailey 3, Jon R. Wilson

More information

Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions

Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Supporting Information Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Lise Schoonen, b Sjors Maassen, b Roeland J. M. Nolte b and Jan C. M. van

More information

OPPF-UK Standard Protocols: Mammalian Expression

OPPF-UK Standard Protocols: Mammalian Expression OPPF-UK Standard Protocols: Mammalian Expression Joanne Nettleship joanne@strubi.ox.ac.uk Table of Contents 1. Materials... 3 2. Cell Maintenance... 4 3. 24-Well Transient Expression Screen... 5 4. DNA

More information

Supplemental Information. OprG Harnesses the Dynamics of its Extracellular. Loops to Transport Small Amino Acids across

Supplemental Information. OprG Harnesses the Dynamics of its Extracellular. Loops to Transport Small Amino Acids across Structure, Volume 23 Supplemental Information OprG Harnesses the Dynamics of its Extracellular Loops to Transport Small Amino Acids across the Outer Membrane of Pseudomonas aeruginosa Iga Kucharska, Patrick

More information

Human Viperin Causes Radical SAM Dependent Elongation of E. coli Hinting at its Physiological Role

Human Viperin Causes Radical SAM Dependent Elongation of E. coli Hinting at its Physiological Role Supporting Information Human Viperin Causes Radical SAM Dependent Elongation of E. coli Hinting at its Physiological Role Micah T. Nelp, Anthony P. Young, Branden M. Stepanski, Vahe Bandarian* Department

More information

Anti-CLOCK (Mouse) mab

Anti-CLOCK (Mouse) mab Page 1 For Research Use Only. Not for use in diagnostic procedures. Anti-CLOCK (Mouse) mab CODE No. D349-3 CLONALITY CLONE ISOTYPE QUANTITY SOURCE IMMUNOGEN FORMURATION STORAGE Monoclonal CLSP4 Mouse IgG1

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementary Methods Protein expression and in vitro binding studies. Recombinant baculovirus carrying GST, GST-mCC, GST-mSec, GST-mSecA and GST-mSecD were generated according to the manufacturer s instructions

More information

Supplemental Data. Noncoding Transcription by RNA Polymerase Pol IVb/Pol V Mediates Transcriptional Silencing of Overlapping and Adjacent Genes

Supplemental Data. Noncoding Transcription by RNA Polymerase Pol IVb/Pol V Mediates Transcriptional Silencing of Overlapping and Adjacent Genes Cell, Volume 135 Supplemental Data Noncoding Transcription by RNA Polymerase Pol IVb/Pol V Mediates Transcriptional Silencing of Overlapping and Adjacent Genes Andrzej T. Wierzbicki, Jeremy R. Haag, and

More information

Purification of GST-tagged proteins using PureCube Glutathione Agarose

Purification of GST-tagged proteins using PureCube Glutathione Agarose Purification GST-tagged proteins using PureCube Glutathione Agarose Overview This protocol describes the generation a cleared lysate from 200 ml E. coli cell culture, and the purification GST-tagged proteins

More information

Supplementary Information: Materials and Methods. GST and GST-p53 were purified according to standard protocol after

Supplementary Information: Materials and Methods. GST and GST-p53 were purified according to standard protocol after Supplementary Information: Materials and Methods Recombinant protein expression and in vitro kinase assay. GST and GST-p53 were purified according to standard protocol after induction with.5mm IPTG for

More information

CHAPTER 4 Cloning, expression, purification and preparation of site-directed mutants of NDUFS3 and NDUFS7

CHAPTER 4 Cloning, expression, purification and preparation of site-directed mutants of NDUFS3 and NDUFS7 CHAPTER 4 Cloning, expression, purification and preparation of site-directed mutants of NDUFS3 and NDUFS7 subunits of human mitochondrial Complex-I Q module N DUFS2, 3, 7 and 8 form the core subunits of

More information

GeNei TM Transformation Teaching Kit Manual

GeNei TM Transformation Teaching Kit Manual Teaching Kit Manual Cat No. New Cat No. KT07 107385 KT07A 106220 Revision No.: 00060505 CONTENTS Page No. Objective 3 Principle 3 Kit Description 6 Materials Provided 7 Procedure 9 Observation & Interpretation

More information

Kinase Reaction and Alkylation Protocol

Kinase Reaction and Alkylation Protocol Kinase Reaction and Alkylation Protocol Protocol for the treatment of substrates prior to detection by Thiophosphate Ester antibodies This product is for research use only and is not intended for diagnostic

More information

Fisher (Fairlawn, NJ) and Sigma-Aldrich (St. Louis, MO) and were used without further. (Promega) and DpnI (New England Biolabs, Beverly, MA).

Fisher (Fairlawn, NJ) and Sigma-Aldrich (St. Louis, MO) and were used without further. (Promega) and DpnI (New England Biolabs, Beverly, MA). 175 Appendix III Chapter 4 Methods General. Unless otherwise noted, reagents were purchased from the commercial suppliers Fisher (Fairlawn, NJ) and Sigma-Aldrich (St. Louis, MO) and were used without further

More information

supplementary information

supplementary information DOI: 1.138/ncb1839 a b Control 1 2 3 Control 1 2 3 Fbw7 Smad3 1 2 3 4 1 2 3 4 c d IGF-1 IGF-1Rβ IGF-1Rβ-P Control / 1 2 3 4 Real-time RT-PCR Relative quantity (IGF-1/ mrna) 2 1 IGF-1 1 2 3 4 Control /

More information

Supplemental Data. Lee et al. Plant Cell. (2010) /tpc Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2.

Supplemental Data. Lee et al. Plant Cell. (2010) /tpc Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2. Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2. (A) Protein structures of DWA1 and DWA2. WD40 region was determined based on the NCBI conserved domain databases (B, C) Schematic representation

More information

Table S1 Yeast strains used in this study Strain Genotype JSY7452* MAT ade2-1 leu2-3 his3-11,15 trp1-1 ura3-1 can1-100 JSY7453* MAT ade2-1 leu2-3

Table S1 Yeast strains used in this study Strain Genotype JSY7452* MAT ade2-1 leu2-3 his3-11,15 trp1-1 ura3-1 can1-100 JSY7453* MAT ade2-1 leu2-3 Table S1 Yeast strains used in this study Strain Genotype JSY7452* MAT ade2-1 leu2-3 his3-11,15 trp1-1 ura3-1 can1-100 JSY7453* MAT ade2-1 leu2-3 his3-11,15 trp1-1 ura3-1 can1-100 mfb1::his3 JSY8272 MAT

More information

Immunoprecipitation (IP)

Immunoprecipitation (IP) BlueGene Biotech Co.,Ltd. Tel: 0086-21-61471242 Fax: 0086-21-61471242 ext 806 E-mail: sales@bluegene.cc tech@bluegene.cc www.elisakit.cc www.bluegene.cc Immunoprecipitation (IP) Immunoprecipitation is

More information

Immunoprecipitation Protocol

Immunoprecipitation Protocol Immunoprecipitation Protocol Immunoprecipitation is a general method to obtain the enrichment of a specific protein from tissue lysate and cell lysate. It can be used to purify a specific protein, to identify

More information

Index 1. Product Description 2. Purification Procedure 3. Troubleshooting 4. Ordering Information

Index 1. Product Description 2. Purification Procedure 3. Troubleshooting 4. Ordering Information High Affinity Ni-Charged Resin Cat. No. L00223 Technical Manual No. TM0217 Version 07132010 Index 1. Product Description 2. Purification Procedure 3. Troubleshooting 4. Ordering Information 1. Product

More information

Yeast Nuclei Isolation Kit

Yeast Nuclei Isolation Kit Yeast Nuclei Isolation Kit Catalog Number KA3951 50 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 General Information...

More information

Supplemental Materials and Methods:

Supplemental Materials and Methods: Supplemental Materials and Methods: Cloning: Oligonucleotides used in the subcloning steps are listed in Supplemental Table 1. Human FANCI (isoform 1, KIAA1794) was subcloned from pcmv6-xl4 [FANCI] in

More information

Checkpoint Kinase Activity Immunoblot Kit

Checkpoint Kinase Activity Immunoblot Kit Product Manual Checkpoint Kinase Activity Immunoblot Kit Catalog Number STA- 413 20 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Cdc25C is a protein phosphatase responsible

More information

Supplemental Information

Supplemental Information Supplemental Information ATP-dependent unwinding of U4/U6 snrnas by the Brr2 helicase requires the C-terminus of Prp8 Corina Maeder 1,3, Alan K. Kutach 1,2,3, and Christine Guthrie 1 1 Department of Biochemistry

More information

Strep-Spin Protein Miniprep Kit Catalog No. P2004, P2005

Strep-Spin Protein Miniprep Kit Catalog No. P2004, P2005 INSTRUCTION MANUAL Strep-Spin Protein Miniprep Kit Catalog No. P2004, P2005 Highlights Fast protocol to purify Strep-tagged proteins from cell-free extracts Screen your recombinant colonies directly for

More information

Supporting Information

Supporting Information Supporting Information Krieg et al. 10.1073/pnas.0907131106 SI Text Reagents. Recombinant human TNF- was from Peprotech. Monoclonal rat anti-rip2 was purchased from Alexis, whereas monoclonal mouse anti-xiap

More information

NOTE ACRYLAMIDE IS NEUROTOXIN YOU MUST WEAR GLOVES.

NOTE ACRYLAMIDE IS NEUROTOXIN YOU MUST WEAR GLOVES. GST Purfication and Pulldown Part I Instructor: David Deitcher TA: Kristy Lawton In order to study the function of a protein it is often useful to have that protein purified away from others in the cell.

More information

PROCEDURE FOR USE NICKEL NTA Magnetic Agarose Beads (5%)

PROCEDURE FOR USE NICKEL NTA Magnetic Agarose Beads (5%) 1 AFFINITY HIS-TAG PURIFICATION PROCEDURE FOR USE NICKEL NTA Magnetic Agarose Beads (5%) DESCRIPTION Nickel NTA Magnetic Agarose Beads are products that allow rapid and easy small-scale purification of

More information

Supplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/-

Supplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- #1074683s 1 Supplemental Online Material Materials and Methods Cell lines and tissue culture The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- knock-out animals

More information

Fig. S1. CrgA intracellular levels in M. tuberculosis. Ten and twenty micrograms of

Fig. S1. CrgA intracellular levels in M. tuberculosis. Ten and twenty micrograms of Supplementary data Fig. S1. CrgA intracellular levels in M. tuberculosis. Ten and twenty micrograms of cell free protein lysates from WT M. tuberculosis (Rv) together with various known concentrations

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION SUPPLEMENTARY MATERIALS AND METHODS Antibodies and sirna The antibodies against BAF170, BAF155, BAF60a, BAF57 and BAF53 were purchased from Santa Cruz (TX), and the antibodies

More information

Chromatin Immunoprecipitation (ChIP)

Chromatin Immunoprecipitation (ChIP) de Lange Lab Chromatin Immunoprecipitation (ChIP) Required Solutions IP Wash A 0.1% SDS 1% Triton X-100 2 mm EDTA ph 8.0 20 mm Tris-HCl ph 8.0 150 mm NaCl 1 mm PMSF 1 µg/ml Leupeptin 1 µg/ml Aprotinin

More information

5.36 Biochemistry Laboratory Spring 2009

5.36 Biochemistry Laboratory Spring 2009 MIT OpenCourseWare http://ocw.mit.edu 5.36 Biochemistry Laboratory Spring 2009 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms. Laboratory Manual for URIECA

More information

Protein Translation Study Label Protein with S35 Methionine in Cells Salma Hasan and Isabelle Plo *

Protein Translation Study Label Protein with S35 Methionine in Cells Salma Hasan and Isabelle Plo * Protein Translation Study Label Protein with S35 Methionine in Cells Salma Hasan and Isabelle Plo * INSERM U1009, Gustave Roussy, Villejuif, France *For correspondence: isabelle.plo@gustaveroussy.fr [Abstract]

More information

Jan 25, 05 His Bind Kit (Novagen)

Jan 25, 05 His Bind Kit (Novagen) Jan 25, 05 His Bind Kit (Novagen) (1) Prepare 5ml of 1X Charge buffer (stock is 8X= 400mM NiSO4): 0.625ml of the stock + 4.375ml DH2O. (2) Prepare 13ml of 1X Binding buffer (stock is 8X = 40mM imidazole,

More information

Supplementary Figure 1 - Characterization of rbag3 binding on macrophages cell surface.

Supplementary Figure 1 - Characterization of rbag3 binding on macrophages cell surface. Supplementary Figure 1 - Characterization of rbag3 binding on macrophages cell surface. (a) Human PDAC cell lines were treated as indicated in Figure 1 panel F. Cells were analyzed for FITC-rBAG3 binding

More information

Supplemental Information. PARP1 Represses PAP and Inhibits Polyadenylation during Heat Shock

Supplemental Information. PARP1 Represses PAP and Inhibits Polyadenylation during Heat Shock Molecular Cell, Volume 49 Supplemental Information PARP1 Represses PAP and Inhibits Polyadenylation during Heat Shock Dafne Campigli Di Giammartino, Yongsheng Shi, and James L. Manley Supplemental Information

More information

Supporting Information

Supporting Information Supporting Information Development of a 2,4-Dinitrotoluene-Responsive Synthetic Riboswitch in E. coli cells Molly E. Davidson, Svetlana V. Harbaugh, Yaroslav G. Chushak, Morley O. Stone, Nancy Kelley-

More information

AminTRAP HIS Prepacked Column

AminTRAP HIS Prepacked Column INDEX Ordering Information... 3 Intended Use... 3 Product Description... 3 Purification Procedure... 4 Sample Preparation... 5 Sample Purification... 6 Analysis... 6 Regeneration Procedure... 6 Use and

More information

CHAPTER 5 PTP-1B CLONING AND RECOMBINANT PROTEIN EXPRESSION. Recombinant DNA technology has revolutionized molecular biology and

CHAPTER 5 PTP-1B CLONING AND RECOMBINANT PROTEIN EXPRESSION. Recombinant DNA technology has revolutionized molecular biology and 204 CHAPTER 5 PTP-1B CLONING AND RECOMBINANT PROTEIN EXPRESSION SUMMARY Recombinant DNA technology has revolutionized molecular biology and genetics. Today, virtually any segment of DNA, the genetic material

More information

ChIP protocol Chromatin fragmentation using the Covaris S2 sonicator by Ethan Ford (version 12/1/11) X- link Cells

ChIP protocol Chromatin fragmentation using the Covaris S2 sonicator by Ethan Ford (version 12/1/11) X- link Cells ChIP protocol Chromatin fragmentation using the Covaris S2 sonicator by Ethan Ford (version 12/1/11) X- link Cells 1. Grow six 15 cm plates of HeLa cells to 90% confluency. 2. Remove media and add wash

More information

SUPPLEMENTAL INFORMATION

SUPPLEMENTAL INFORMATION SUPPLEMENTAL INFORMATION SUPPLEMENTAL DATA Table S1: Related to Figure 4. DnaA screen for divalent cations and nucleotides. Concentration of reagents, T m and F fold30 75. Reagent Conc T m (±SEM) mm C

More information

HiChIP Protocol Mumbach et al. (CHANG), p. 1 Chang Lab, Stanford University. HiChIP Protocol

HiChIP Protocol Mumbach et al. (CHANG), p. 1 Chang Lab, Stanford University. HiChIP Protocol HiChIP Protocol Mumbach et al. (CHANG), p. 1 HiChIP Protocol Citation: Mumbach et. al., HiChIP: Efficient and sensitive analysis of protein-directed genome architecture. Nature Methods (2016). Cell Crosslinking

More information

Expression and Purification of the Thermus thermophilus Argonaute Protein Daan C. Swarts *, Matthijs M. Jore and John van der Oost

Expression and Purification of the Thermus thermophilus Argonaute Protein Daan C. Swarts *, Matthijs M. Jore and John van der Oost Expression and Purification of the Thermus thermophilus Argonaute Protein Daan C. Swarts *, Matthijs M. Jore and John van der Oost Department of Agrotechnology and Food Sciences, Wageningen University,

More information

RNP-IP (Modified Method)-Getting Majority RNA from RNA Binding Protein in the Cytoplasm Fengzhi Liu *

RNP-IP (Modified Method)-Getting Majority RNA from RNA Binding Protein in the Cytoplasm Fengzhi Liu * RNP-IP (Modified Method)-Getting Majority RNA from RNA Binding Protein in the Cytoplasm Fengzhi Liu * School of Biomedical Sciences, Thomas Jefferson University, Philadelphia, USA *For correspondence:

More information

LINGO-1, A TRANSMEMBRANE SIGNALING PROTEIN, INHIBITS OLIGODENDROCYTE DIFFERENTIATION AND MYELINATION THROUGH INTERCELLULAR SELF- INTERACTIONS.

LINGO-1, A TRANSMEMBRANE SIGNALING PROTEIN, INHIBITS OLIGODENDROCYTE DIFFERENTIATION AND MYELINATION THROUGH INTERCELLULAR SELF- INTERACTIONS. Supplemental Data: LINGO-1, A TRANSMEMBRANE SIGNALING PROTEIN, INHIBITS OLIGODENDROCYTE DIFFERENTIATION AND MYELINATION THROUGH INTERCELLULAR SELF- INTERACTIONS. Scott Jepson, Bryan Vought, Christian H.

More information

Supplementary Materials and Methods

Supplementary Materials and Methods Supplementary Materials and Methods sirna sequences used in this study The sequences of Stealth Select RNAi for ALK and FLOT-1 were as follows: ALK sense no.1 (ALK): 5 -AAUACUGACAGCCACAGGCAAUGUC-3 ; ALK

More information

TECHNICAL BULLETIN. EZview Red ANTI-FLAG M2 Affinity Gel. Catalog Number F2426 Storage Temperature 20 C

TECHNICAL BULLETIN. EZview Red ANTI-FLAG M2 Affinity Gel. Catalog Number F2426 Storage Temperature 20 C EZview Red ANTI-FLAG M2 Affinity Gel Catalog Number F2426 Storage Temperature 20 C TECHNICAL BULLETIN Product Description EZview Red ANTI-FLAG M2 Affinity Gel is a highly visible, red colored ANTI-FLAG

More information

Electronic Supplementary Information. and purified according to previously published procedures(1). GlcNAc and Phos-FLAG were

Electronic Supplementary Information. and purified according to previously published procedures(1). GlcNAc and Phos-FLAG were Electronic Supplementary Information Experimental details: Synthesis and purification of sugars. GlcN, 4 GlcN, and 4 GlcN were synthesized and purified according to previously published procedures(1).

More information

Supplementary Material

Supplementary Material Supplementary Material Supplementary Methods Cell synchronization. For synchronized cell growth, thymidine was added to 30% confluent U2OS cells to a final concentration of 2.5mM. Cells were incubated

More information

Transfection of CRISPR/Cas9 Nuclease NLS ribonucleoprotein (RNP) into adherent mammalian cells using Lipofectamine RNAiMAX

Transfection of CRISPR/Cas9 Nuclease NLS ribonucleoprotein (RNP) into adherent mammalian cells using Lipofectamine RNAiMAX Transfection of CRISPR/Cas9 Nuclease NLS ribonucleoprotein (RNP) into adherent mammalian cells using Lipofectamine RNAiMAX INTRODUCTION The CRISPR/Cas genome editing system consists of a single guide RNA

More information

OPPF-UK Standard Protocols: Insect Cell Purification

OPPF-UK Standard Protocols: Insect Cell Purification OPPF-UK Standard Protocols: Insect Cell Purification Last Updated 6 th October 2016 Joanne Nettleship joanne@strubi.ox.ac.uk OPPF-UK SOP: Insect Cell Purification Table of Contents Suggested Schedule...

More information

Strep-Spin Protein Miniprep Kit Catalog No. P2004 & P2005

Strep-Spin Protein Miniprep Kit Catalog No. P2004 & P2005 INSTRUCTION MANUAL Strep-Spin Protein Miniprep Kit Catalog No. P2004 & P2005 Highlights Fast & Simple: Purify Strep-tagged proteins from cell-free extracts using a spin-column in 7 minutes High-Quality:

More information

Comparison of different methods for purification analysis of a green fluorescent Strep-tag fusion protein. Application

Comparison of different methods for purification analysis of a green fluorescent Strep-tag fusion protein. Application Comparison of different methods for purification analysis of a green fluorescent Strep-tag fusion protein Application Petra Sebastian Meike Kuschel Stefan Schmidt Abstract This Application Note describes

More information

Supplemental Information

Supplemental Information Supplemental Information Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome * Qihong Zhang 1#, Dahai

More information

EPIGENTEK. EpiQuik Tissue Chromatin Immunoprecipitation Kit. Base Catalog # P-2003 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE

EPIGENTEK. EpiQuik Tissue Chromatin Immunoprecipitation Kit. Base Catalog # P-2003 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE EpiQuik Tissue Chromatin Immunoprecipitation Kit Base Catalog # P-2003 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik Tissue Chromatin Immunoprecipitation Kit is suitable for combining the specificity

More information

Ral Activation Assay Kit

Ral Activation Assay Kit Product Manual Ral Activation Assay Kit Catalog Number STA-408 20 assays FOR RESEARCH USE ONLY Not for use in diagnostic procedures Introduction Small GTP-binding proteins (or GTPases) are a family of

More information

Fig. S1 TGF RI inhibitor SB effectively blocks phosphorylation of Smad2 induced by TGF. FET cells were treated with TGF in the presence of

Fig. S1 TGF RI inhibitor SB effectively blocks phosphorylation of Smad2 induced by TGF. FET cells were treated with TGF in the presence of Fig. S1 TGF RI inhibitor SB525334 effectively blocks phosphorylation of Smad2 induced by TGF. FET cells were treated with TGF in the presence of different concentrations of SB525334. Cells were lysed and

More information

For Research Use Only. Not for use in diagnostic procedures. Anti-NRF2 mab

For Research Use Only. Not for use in diagnostic procedures. Anti-NRF2 mab Page 1 For Research Use Only. Not for use in diagnostic procedures. Anti-NRF2 mab CODE No. M200-3 CLONALITY CLONE ISOTYPE QUANTITY SOURCE IMMUNOGEN FORMURATION STORAGE Monoclonal 1F2 Mouse IgG1 100 L,

More information