Tony Mire-Sluis Vice President, Corporate, Product and Device Quality Amgen Inc
|
|
- Lesley Holmes
- 6 years ago
- Views:
Transcription
1 The Regulatory Implications of the ever increasing power of Mass Spectrometry and its role in the Analysis of Biotechnology Products Where do we draw the line? Tony Mire-Sluis Vice President, Corporate, Product and Device Quality Amgen Inc
2 The Sensitivity of Mass Spectrometer (MS) Methods is Progressing Rapidly Year Detection limit of peptide (pmol) 2
3 Mass Spectrometry Is Not ne Method MS applied to biologics is a rapidly evolving field and as such, it is important to relay the rationale for the method of choice for a particular application and if it is adequate for the intended use, for example: Ion Trap for sequencing due to its MS n capability TF for identifying whole mass and impurities due to mass accuracy Resolution (M/ M peptide mass) Ion trap: 1,000-4,000 Q-TF: 10,000-50,000 rbitrap: 10, ,000 FT-ICR: 50,000 1,000,000 Mass Accuracy (Low ppm) Ion trap: ~200 ppm Q-TF: ~5 ppm (with an internal calibrant) rbitrap: ~ 4 ppm FT-ICR: ~ 2 ppm
4 The Power of Fragment Assignment is Method/Equipment Specific N L = 4. 7 e N L = 1. 6 e N L = 1. 4 e m / z m / z m / z Ion trap Resolution (M/ M) ~ 3,000 Accuracy ~ 300ppm Q-TF Resolution ~ 10,000 Accuracy ~ 50 ppm Simulated spectra rbitrap Resolution ~ 30,000 Accuracy ~ 4 ppm
5 Sensitivity improvements in Mass Spectrometry are Allowing Increasing Detection of Product Variants but also Faces Challenges MS ionization, transmission and detection improvements enable peptide mapping based detection of minor species as low as 0.001% compared to the expected species These improvements can be applied to: Sequence Variants (errors in the DNA) Misincorporations (errors in transcription or translation) Post-translational Modifications due to cellular processes PTM s due to storage stability studies Key Concept: ionization efficiency of a specific species can be impacted by sequence changes and matrix effects Example: a methionine oxidation variant elutes at a different retention time and is suppressed in the presence of a major expected peptide.
6 Sensitivity improvements in Mass Spectrometry are Allowing Increasing Detection of Product Variants but also Faces Challenges Advantages: Increases the likelihood of observing variant species that coelute with expected peptides (i.e. not observable using UV) Increases the likelihood of observing variants that are below the LD of UV detection By comparing the signal intensity between samples, relative differences can be determined Disadvantages: Absolute quantitation requires isotope labeled standards Making isotypic RS, running under specific mode for each species, generating calibration curves etc. requires significant effort Ionization efficiency differences can greatly impact detection: A small peptide from a Lys variant does not bind to the column Two peptides formed due to a Lys variant have improved ionization and are over-represented compared to the expected peptide Difficult to assess the relevance of a variant at < 1%.
7 Implementing MS Technologies Into a Control Strategy Data from orthogonal methods should support nonunequivocal MS data interpretation MS analysis that leads to peak assignments for other coupled analytics is an important characterization tool but it should be linked to relevance of the assigned peak. e.g., is the peak critical for potency and functionality of the product? MS should help inform a control strategy program on the most adequate release and stability analytical methodology needed for the particular product.
8 Implementing MS Technologies Into a Traditional Analytical Program Need extensive knowledge of method capability: Reproducibility/Ruggedness Factors that affect Mass Spec results: m/z working range Non-linear MS effects, non-specific peaks, matrix effects, high background noise Analyte specific fragmentation efficiency Coupling techniques should be carefully evaluated for compatibility with MS (e.g., use of adequate chromatography method, matrix compatibility) Identification of species Differential ionization efficiency may drive the need to have different ionization conditions and detection Data interpretation Relationship to other methods
9 Conventional Bottom Up Protein Characterization Protease MS/MS MS/MS MS/MS MS/MS GLSDGEWQQVLNV VEADIAGHGQE LFTGHPETLEK FDKFKHLKTEAE ASEDLKKHGTV GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASED
10 Bottom-Up methods have Advantages and Disadvantages The digestion improves the ability to detect posttranslational modifications and ability to perform sequence analysis but: The entire molecule often not covered A high analyte concentration is required for digestion May be difficult to achieve sometimes Artifacts can occur during digestion Reduction Alkylation Proteolysis Disulfide formation or scrambling Carbamylation in the presence of urea Transpeptidation Amino acid rearrangements Loss of labile modifications (e.g., succinimide)
11 Digestion artifacts Asparagine turns into aspartic/isoaspartic acid (deamidation) Aspartic acid turns into isoaspartic acid (isomerization) Succinimide turns into aspartic/isoaspartic acid N H NH 2 H N N H N N H H H N Aspartic acid Asparagine Succinimide intermediate HN HN H isoaspartic acid
12 MS/MS of intact proteins Top Down MS/MS GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKA SEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSK HPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG
13 Top Down Mass Spectrometry Also Has Advantages and Disadvantages Advantages: Entire molecule examined Reduced sample concentration requirement Speed Minutes/hours vs. days Reduced artifacts due to minimal sample manipulation Compliments bottom-up method Disadvantages: Availability of the instruments Very expensive Training of Analysts Data Analysis Software (Mass Analyzer) developed in-house Extensive experience still required to appropriately interpret the data For large proteins, only certain part of the molecule may be analyzed Generally cannot cut through intact disulfide bonds Degradation analysis is an average
14 Assessing Conformational Differences by MS Conformational differences can be assessed by MS in the: Gas phase - Ion mobility or charge state distribution differences Fast analysis using low sample amounts. The meaning of gas phase differences is not universally correlated to solution phase differences and the precision of the % change may not be sensitive to minor species. Solution phase chemical labeling (H/D, covalent labeling) Improvements in reproducibility and throughput enable small % differences in conformation to be detected. However, the specific structure of the conformational change is not known making it difficult to assess the biological relevance.
15 Existing Regulatory Issue Identity vs. Purity FDA is challenging use of any method solely for identity testing if it reveals other information about the purity of the product. This thinking can also be extended to characterization. For Mass Spec this will necessitate: Better understanding of variability of peaks More work on identifying peaks So does the increasing power of MS provide incremental value? More justification of conforms to standard What other product or process related substances could appear on Mass Spec Spectra?
16 The Need To Understand What Affects Mass Spec Results Interpretation of any method relies on knowledge of what is real and what is artifact the more sensitive you get, the more this is essential to understand complex data Sample preparation is critical in MS applications. There should be a careful consideration on sample treatment and how representative is the data obtained of that sample when compared to the drug product material that will be administered to the patient: Buffer/matrix changes to make the sample compatible with chosen MS application How representative is the sample coming out of the analytical method coupled to MS (e.g., chromatography)
17 Implementation of MS Technologies Providing the Necessary Supporting Data There is a need to develop standards and controls that provide a better understanding of the data: Purified product variants Develop orthogonal identification methods accounting for method matrices Scientifically justified method acceptance criteria Relevant experimental controls Appropriate reference materials that illustrate method variability
18 NIST Mass Spectral Library: Consensus Spectra Building High Quality MS Reference Data Peptide Library 500,000 peptides for 8 species Data from the NIST program kindly provided by Stephen Stein and Mike Tarlov of NIST NIST/EPA/NIH Mass Spectral Library EI spectra of 212K compounds IgG Library with NIST reference material peptides glycopeptides Small Molecule Tandem MS 7,020 compounds Ion Trap/Collision Cell glycans intact & large fragments?
19 Consensus vs. Single Spectrum Consensus of 38 Spectra HCD 42eV TKPREEQYNSTYR Individual Spectrum HCD 42eV Consensus spectra can distinguish between noise and real signals, e.g., low intensity peaks between 1010 and 1275 m/z might be interpreted as noise and discarded, but consensus spectra indicate these are real species.
20 NA2G1F from Rituximab Matches Library Rituximab Head to Tail Comparison Glycan Library
21 Protein Structure: Reference Mass Spectral (MS) Library of Antibody Therapeutics Antibody Library with NIST reference material peptides glycans glycopeptides intact & large fragments? Real spectra of species High quality data: consensus spectra Confident identification Faster data analysis
22 Automation vs Manual Interpretation Automation enables identification of variant species but computational decisions are based on statistical confidence. Manual confirmation is an important component for confirming nature and site of variants. Example: Identification of methionine oxidation when there are two Met s and a Trp residue in the peptide. Advantages: Identification can be made for species that would not be found using manual interpretation. Disadvantages: A thousand times more data to review and correlate with sample handling. Difficult to assess cause and impact due to a specific change. Clinical scale deamidation at 0.1%; Commercial scale at 1%.
23 Implementing MS Technologies Into an Analytical Program The Equipment Equipment availability Sole sourcing Lot to lot variability of equipment Transferability of method Lifecycle of method Vendor changes Upgrades of hardware Upgrades of software etc.
24 Implementing MS Technologies Proving it Works in a QC Environment Method Qualification/Validation Identifying appropriate parameters Ability to control method Creating appropriate standards/controls Reagent quality control Training
25 Summary for Successful Implementation of Lot Release/Stability Commercial MS Based Methods Performance: Low failure rate Method operation and data interpretation not analyst dependent Characteristics Robust from sample prep through instrumental analysis and data interpretation Automated integration preferred (integration guideline) utlier data points determined mathematically and not by analyst interpretation Highest possible throughput without sacrificing robustness Practical run time relative to analyst shifts
26 Summary for Successful Implementation of Lot Release/Stability Commercial MS Based Methods Cost effective; doesn t waste significant amount of sample Audit compliant Not dependent on poorly available instrumentation or reagents No patent interference Validatable Clearly defined purpose with respect to product attribute(s) under evaluation Targeting multiple quality attributes desirable as long as don t sacrifice robustness
27 Conclusions It is important for you and regulators to fully understand the technology you are using Industry can help the regulators through meetings, publications and regulatory submissions Industry must evaluate mass spectrometry technologies depending on their use (e.g. characterization vs. lot release), the nature of the product and what provides real value in understanding safety, efficacy and consistency of our products How relevant is 0.1% of your product?
28 Acknowledgments Joseph Phillips Izydor Apostle Stephen Stein (NIST) Mike Tarlov (NIST) Brent Kendrick Dean Pettit Dave Hambly
Chromatographic Workflows for Biopharmaceutical Characterization
Chromatographic Workflows for Biopharmaceutical Characterization Dr. Ken Cook European Bioseparation Sales Support Expert Thermo Fisher Scientific, Hemel Hempstead/Germany The world leader in serving science
More informationProMass HR Applications!
ProMass HR Applications! ProMass HR Features Ø ProMass HR includes features for high resolution data processing. Ø ProMass HR includes the standard ProMass deconvolution algorithm as well as the full Positive
More informationHongwei Xie, Martin Gilar, and John C. Gebler Waters Corporation, Milford, MA, U.S.A. INTRODUCTION EXPERIMENTAL
Analysis of Deamidation and Oxidation in MONOCLONAL Antibody Using Peptide Mapping with UPLC/MS E Hongwei Xie, Martin Gilar, and John C. Gebler Waters Corporation, Milford, MA, U.S.A. INTRODUCTION Monoclonal
More informationAnswers, Simple and Streamlined. Solutions for Biotherapeutic Intact Mass Analysis
Answers, Simple and Streamlined Solutions for Biotherapeutic Intact Mass Analysis Expert Functionality for Mass Spec Non-Experts SCIEX OS on the X500B QTOF system dramatically improves the user experience,
More informationB05 - PEPTIDE MAPPING(Revision 1) INTRODUCTION
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 B05 - PEPTIDE MAPPING(Revision 1) INTRODUCTION Proteins can exist as large complex structures, with some molecules in the population
More informationValidation of Analytical Methods used for the Characterization, Physicochemical and Functional Analysis and of Biopharmaceuticals.
Validation of Analytical Methods used for the Characterization, Physicochemical and Functional Analysis and of Biopharmaceuticals. 1 Analytical Method Validation: 1..1 Philosophy: Method validation is
More informationRegulatory Consideration for the Characterization of HOS in Biotechnology Products
Regulatory Consideration for the Characterization of HOS in Biotechnology Products Maria Teresa Gutierrez Lugo, Ph.D. OBP/CDER/FDA 5 th International Symposium on Higher Order Structure of Protein Therapeutics
More informationAdvanceBio Peptide Mapping
AdvanceBio Peptide Mapping An HPLC Column Technology for Faster Protein Biocharacterizations Tim Rice BioColumn Technical Specialist 1 What Is Peptide Mapping? The chemical or enzymatic treatment of a
More informationApplication of a Mass Spectrometry Based Multi-Attribute-Method (MAM) for QC Release and Stability Testing of Protein Therapeutics
Application of a Mass Spectrometry Based Multi-Attribute-Method (MAM) for QC Release and Stability Testing of Protein Therapeutics Tamer Eris, Principal Scientist Process Development Amgen, Thousand Oaks,
More informationComparability Analysis of Protein Therapeutics by Bottom-Up LC-MS with Stable Isotope-Tagged Reference Standards
Comparability Analysis of Protein Therapeutics by Bottom-Up LC-MS with Stable Isotope-Tagged Reference Standards 16 September 2011 Abbott Bioresearch Center, Worcester, MA USA Manuilov, A. V., C. H. Radziejewski
More informationTable 1: CE-MS: Unexploited Opportunities in Process Development?
Table 1: CE-MS: Unexploited Opportunities in Process Development? Session 1 Facilitator: Mei Han, Amgen Inc. Scribe: Yunan Wang, Amgen Inc. Session 2 Facilitator: Göran Hübner, Boehringer Ingelheim Pharma
More informationSimple, Robust, High Quality Intact Mass Analysis A Biosimilars Case Study
3 Conjugation Site (ADC) 4 34 35 1 1 35 34 CASE STUDY 3 National Institute for Bioprocessing 3 4 Research and Training 1 35 31 5 31 3 6 9 3 9 5 6 7 7 6 8 8 3 1 19 16 17 19 18 7 9 11 11 5 17 9 7 3 1 9 9
More informationrapiflex Innovation with Integrity Designed for Molecules that Matter. MALDI TOF/TOF
rapiflex Designed for Molecules that Matter. Innovation with Integrity MALDI TOF/TOF rapiflex TM The first MALDI-TOF/TOF that adapts to your needs. The rapiflex is the most advanced MALDI TOF/TOF system
More informationfor MA and Beyond John Gabrielson CASSS 2 nd International Symposium on Higher Order Structure of Protein Therapeutics
Higher Order Structure Characterization for MA and Beyond John Gabrielson CASSS 2 nd International Symposium on Higher Order Structure of Protein Therapeutics February 12, 2013 Proteins form multiple levels
More informationHighly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs
Technical Overview Highly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs Authors Stephen Madden, Crystal Cody, and Jungkap Park Agilent Technologies, Inc. Santa Clara, California,
More informationChromatography column for therapeutic protein analysis
PRODUCT SPECIFICATIONS ProPac Elite WCX Column Chromatography column for therapeutic protein analysis Benefits Superior resolution power for proteins, monoclonal antibodies, and associated charge variants
More informationThermo Scientific Peptide Mapping Workflows. Upgrade Your Maps. Fast, confident and more reliable peptide mapping.
Thermo Scientific Peptide Mapping Workflows Upgrade Your Maps Fast, confident and more reliable peptide mapping. Smarter Navigation... Peptide mapping is a core analytic in biotherapeutic development.
More informationProteinPilot Report for ProteinPilot Software
ProteinPilot Report for ProteinPilot Software Detailed Analysis of Protein Identification / Quantitation Results Automatically Sean L Seymour, Christie Hunter SCIEX, USA Powerful mass spectrometers like
More informationAssessment of Active Biopharmaceutical Ingredients Prior To and Following Removal of Interfering Excipients
Assessment of Active Biopharmaceutical Ingredients Prior To and Following Removal of Interfering Excipients Andrew J Reason and Howard R Morris BioPharmaSpec Ltd, and BioPharmaSpec Inc, The EMA guideline
More informationStreamlined and Complete LC-MS Workflow for MAM
Streamlined and Complete LC-MS Workflow for MAM Multiple Attribute Methodology (MAM) for Biotherapeutic Attribute Monitoring and Purity Testing BV MAM WORKFLOW Define Track Quantify Purity New Peaks Report
More informationEnsure your Success with Agilent s Biopharma Workflows
Ensure your Success with Agilent s Biopharma Workflows Steve Madden Software Product Manager Agilent Technologies, Inc. June 5, 2018 Agenda Agilent BioPharma Workflow Platform for LC/MS Intact Proteins
More informationMass Spectrometry for Characterization of Monoclonal Antibodies: Regulatory Considerations
Mass Spectrometry for Characterization of Monoclonal Antibodies: Regulatory Considerations Jun Park, Ph.D. Division of Monoclonal Antibodies Office of Biotechnology Products OPS/CDER Food and Drug Administration
More informationApplication Note # ET-20 BioPharma Compass: A fully Automated Solution for Characterization and QC of Intact and Digested Proteins
Application Note # ET-20 BioPharma Compass: A fully Automated Solution for Characterization and QC of Intact and Digested Proteins BioPharma Compass TM is a fully automated solution for the rapid characterization
More informationAdvanced QA/QC characterization MS in QC : Multi Attribute Method
Advanced QA/QC characterization MS in QC : Multi Attribute Method Global BioPharma Summit The world leader in serving science A Complex Problem: Drug Safety and Quality Safety Is the product safe to use?
More informationPrecise Characterization of Intact Monoclonal Antibodies by the Agilent 6545XT AdvanceBio LC/Q-TOF
Precise Characterization of Intact Monoclonal Antibodies by the Agilent 6545XT AdvanceBio LC/Q-TOF Application Note Author David L. Wong Agilent Technologies, Inc. Santa Clara, CA, USA Introduction Monoclonal
More informationExamples of regulatory expectations for analytical characterization and testing
Examples of regulatory expectations for analytical characterization and testing AT Europe 2016, 18 March 2016 Vicki Venizelos Quality RA B.V. Leiden, the Netherlands Overview What are the regulatory expectations?
More informationADVANCING ATTRIBUTE CONTROL OF ANTIBODIES AND ITS DERIVATIVES USING HIGH RESOLUTION ANALYTICS
ADVANCING ATTRIBUTE CONTROL OF ANTIBODIES AND ITS DERIVATIVES USING HIGH RESOLUTION ANALYTICS Henry Shion 1, Jing Fang 1, William Alley 1, Barbara Sullivan 2, Nick Tomczyk 3, Liuxi Chen 1, Ying-Qing Yu
More informationVICH Topic GL2 (Validation: Methodology) GUIDELINE ON VALIDATION OF ANALYTICAL PROCEDURES: METHODOLOGY
The European Agency for the Evaluation of Medicinal Products Veterinary Medicines Evaluation Unit CVMP/VICH/591/98-FINAL London, 10 December 1998 VICH Topic GL2 (Validation: Methodology) Step 7 Consensus
More informationMAbPac RP Column. High-performance reverse phase chromatography column for monoclonal antibody analysis
CHROMATOGRAPHY MAbPac RP Column High-performance reverse phase chromatography column for monoclonal antibody analysis Product Specifications The Thermo Scientific MAbPac RP is a reverse phase (RP) liquid
More informationThermo Scientific Q Exactive HF Orbitrap LC-MS/MS System. Higher-Quality Data, Faster Than Ever. Speed Productivity Confidence
Thermo Scientific Q Exactive HF Orbitrap LC-MS/MS System Higher-Quality Data, Faster Than Ever Speed Productivity Confidence Transforming discovery quantitation The Thermo Scientific Q Exactive HF hybrid
More informationIMPORTANCE OF CELL CULTURE MEDIA TO THE BIOPHARMACEUTICAL INDUSTRY
IMPORTANCE OF CELL CULTURE MEDIA TO THE BIOPHARMACEUTICAL INDUSTRY Research, development and production of biopharmaceuticals is growing rapidly, thanks to the increase of novel therapeutics and biosimilar
More informationFaster, easier, flexible proteomics solutions
Agilent HPLC-Chip LC/MS Faster, easier, flexible proteomics solutions Our measure is your success. products applications soft ware services Phospho- Anaysis Intact Glycan & Glycoprotein Agilent s HPLC-Chip
More informationph gradient analysis of IgG1 therapeutic monoclonal antibodies using a 5 µm WCX column
APPLICATION NOTE 21845 ph gradient analysis of IgG1 therapeutic monoclonal antibodies using a 5 µm WCX column Authors Julia Baek, Shane Bechler, Shanhua Lin, Stacy Tremintin Thermo Fisher Scientific, Sunnyvale,
More informationLC/MS Based Quantitation of Intact Proteins for Bioanalytical Applications
LC/MS Based Quantitation of Intact Proteins for Bioanalytical Applications Alex Zhu, Ph.D. Agilent Technologies Wilmington, DE ASMS,2017-06 1 Outline Introduction on intact protein quantitation Agilent
More informationNIST: Mission, Metrology, and Standards. NBMC Workshop Blood, Sweat, & Tears III November 2-3, 2016
NIST: Mission, Metrology, and Standards NBMC Workshop Blood, Sweat, & Tears III November 2-3, 2016 Peter M. Vallone, Ph.D. Leader, Applied Genetics Group NIST Gaithersburg, MD USA WHY AM I HERE PRECISION
More informationAnalysis of Protein Biopharmaceuticals
Analysis of Protein Biopharmaceuticals Comprehensive cgmp Services at Every Stage of Drug Development Amazing where you can go At Solvias, we work closely with you Solvias provides comprehensive services
More informationVALIDATION OF ANALYTICAL PROCEDURES: METHODOLOGY *)
VALIDATION OF ANALYTICAL PROCEDURES: METHODOLOGY *) Guideline Title Validation of Analytical Procedures: Methodology Legislative basis Directive 75/318/EEC as amended Date of first adoption December 1996
More informationBiochromatography Bring more Zen into your life and laboratory
Seminar Biochromatography Bring more Zen into your life and laboratory Method development and maintaining peptide, protein, glycan and anti-body analyses by LC or LC-MS can be very time consuming and might
More informationTurboMass GC/MS Software
TurboMass GC/MS Software GAS CHROMATOGRAPHY / MASS SPECTROMETRY P R O D U C T N O T E Today s demanding laboratory requires software that is easy to learn yet offers sophisticated instrument control, robust
More informationFast and Efficient Peptide Mapping of a Monoclonal Antibody (mab): UHPLC Performance with Superficially Porous Particles
Fast and Efficient Peptide Mapping of a Monoclonal Antibody (mab): UHPLC Performance with Superficially Porous Particles Application Note Biotherapeutics and Biosimilars Authors James Martosella, Alex
More informationAdvantages of Ion Mobility QTOF for Characterization of BioPharma Molecules
Advantages of Ion Mobility QTOF for Characterization of BioPharma Molecules Add a New Dimension to your Research Capability with Agilent s New Drift Ion Mobility QTOF System David Wong, Ph.D. Sr. Application
More informationQuantification of Host Cell Protein Impurities Using the Agilent 1290 Infinity II LC Coupled with the 6495B Triple Quadrupole LC/MS System
Application Note Biotherapeutics Quantification of Host Cell Protein Impurities Using the Agilent 9 Infinity II LC Coupled with the 6495B Triple Quadrupole LC/MS System Authors Linfeng Wu and Yanan Yang
More informationComprehensive characterization of three IgG forms using CESI-MS
Comprehensive characterization of three IgG forms using CESI-MS Bryan Fonslow 1, Olga V. Friese 2, and K. Steven Cook 2 1 SCIEX, Brea, CA and 2 Pfizer, Chesterfield, MO mabs, ADCs, biosimilars, and biobetters
More informationCritical Quality Attributes for Biotechnology Products: A Regulatory Perspective
Critical Quality Attributes for Biotechnology Products: A Regulatory Perspective Patrick G. Swann, Ph.D. Deputy Director Division of Monoclonal Antibodies Office of Biotechnology Products Office of Pharmaceutical
More informationSeparation of Native Monoclonal Antibodies and Identification of Charge Variants:
Separation of Native Monoclonal Antibodies and Identification of Charge Variants: Teamwork of the Agilent 31 OFFGEL Fractionator, Agilent 21 Bioanalyzer and Agilent LC/MS Systems Application Note Biosimilar
More informationProudly serving laboratories worldwide since 1979 CALL for Refurbished & Certified Lab Equipment QTRAP 5500
www.ietltd.com Proudly serving laboratories worldwide since 1979 CALL +847.913.0777 for Refurbished & Certified Lab Equipment QTRAP 5500 Powerful synergy results when the world s most sensitive triple
More informationAnalytical Procedures and Methods Validation for Drugs and Biologics
Final Guidance for Industry Analytical Procedures and Methods Validation for Drugs and Biologics Analytical procedures and Method Validation June 21, 2016 Lokesh Bhattacharyya Chief, LACBRP/DBSQC OCBQ/CBER/FDA
More informationMonoclonal Antibody Analysis on a Reversed-Phase C4 Polymer Monolith Column
Monoclonal Antibody Analysis on a Reversed-Phase C4 Polymer Monolith Column Shane Bechler 1, Ken Cook 2, and Kelly Flook 1 1 Thermo Fisher Scientific, Sunnyvale, CA, USA; 2 Thermo Fisher Scientific, Runcorn,
More informationImportant Information for MCP Authors
Guidelines to Authors for Publication of Manuscripts Describing Development and Application of Targeted Mass Spectrometry Measurements of Peptides and Proteins and Submission Checklist The following Guidelines
More informationfor water and beverage analysis
Thermo Scientific EQuan MAX Plus Systems Automated, high-throughput LC-MS solutions for water and beverage analysis Pesticides Pharmaceuticals Personal care products Endocrine disruptors Perfluorinated
More informationMonoclonal Antibody Characterization on Q Exactive and Oribtrap Elite. Yi Zhang, Ph.D Senior Proteomic Marketing Specialist Oct.
Monoclonal Antibody Characterization on Q Exactive and Oribtrap Elite Yi Zhang, Ph.D Senior Proteomic Marketing Specialist Oct. 12, 211 Outline Orbitrap Mass Spectrometer in mab Characterization Intact
More informationFDA recommendations for comparability studies to support manufacturing changes. Joslyn Brunelle, PhD Office of Biotechnology Products OPQ/CDER/FDA
FDA recommendations for comparability studies to support manufacturing changes Joslyn Brunelle, PhD Office of Biotechnology Products OPQ/CDER/FDA The views and opinions expressed here should not be used
More informationThermo Scientific MAbPac HIC Columns. Novel Hydrophobic Interaction HPLC Columns. Designed for Monoclonal Antibody Analysis
Thermo Scientific MAbPac HIC Columns Novel Hydrophobic Interaction HPLC Columns Designed for Monoclonal Antibody Analysis Introduction The Thermo Scientific MAbPac HIC column family is designed for separations
More informationThermo Scientific Solutions for Intact-Protein Analysis. Better, Faster Decisions for. Biotherapeutic Development
Thermo Scientific Solutions for Intact-Protein Analysis Better, Faster Decisions for Biotherapeutic Development Quickly and Accurately Assess Product Quality and Safety Therapeutic proteins and monoclonal
More informationPut the PRO in Protein Characterization
Put the PRO in Protein Characterization Aaron Boice LC/Q-TOF Product Manager 5-June-2017 Agenda The Right Tools for the Job Tackling Intact Proteins Break it Down Peptides and PTMs Sweet Success Released
More informationProteins. Patrick Boyce Biopharmaceutical Marketing Manager Waters Corporation 1
Routine Characterization of mabs and Other Proteins Patrick Boyce Biopharmaceutical Marketing Manager Europe and India 2011 Waters Corporation 1 Agenda Why? What scientific challenges? Technology Example
More informationStrategies for Quantitative Proteomics. Atelier "Protéomique Quantitative" La Grande Motte, France - June 26, 2007
Strategies for Quantitative Proteomics Atelier "Protéomique Quantitative", France - June 26, 2007 Bruno Domon, Ph.D. Institut of Molecular Systems Biology ETH Zurich Zürich, Switzerland OUTLINE Introduction
More informationUtilizing novel technology for the analysis of therapeutic antibodies and host cell protein contamination
Utilizing novel technology for the analysis of therapeutic antibodies and host cell protein contamination Kelli Jonakin, Ph.D. Senior Field Application Scientist, Seattle, WA Eric Johansen, Ph.D. Senior
More informationProteomics. Proteomics is the study of all proteins within organism. Challenges
Proteomics Proteomics is the study of all proteins within organism. Challenges 1. The proteome is larger than the genome due to alternative splicing and protein modification. As we have said before we
More informationDetecting Challenging Post Translational Modifications (PTMs) using CESI-MS
Detecting Challenging Post Translational Modifications (PTMs) using CESI-MS Sensitive workflow for the detection of PTMs in biological samples from small sample volumes Klaus Faserl, 1 Bettina Sarg, 1
More informationPractical challenges in the CMC development of biosimilars. Simon Hotchin Executive Director Regulatory Affairs Amgen Inc.
Practical challenges in the CMC development of biosimilars Simon Hotchin Executive Director Regulatory Affairs Amgen Inc. Overview Introduction Statistical methodologies in the assessment of analytical
More informationIMPROVE SPEED AND ACCURACY OF MONOCLONAL ANTIBODY BIOANALYSIS USING NANOTECHNOLOGY AND LCMS
IMPROVE SPEED AND ACCURACY OF MONOCLONAL ANTIBODY BIOANALYSIS USING NANOTECHNOLOGY AND LCMS As scientists gain an advanced understanding of diseases at the molecular level, the biopharmaceutical industry
More informationIsotopic Resolution of Chromatographically Separated IdeS Subunits Using the X500B QTOF System
Isotopic Resolution of Chromatographically Separated IdeS Subunits Using the X500B QTOF System Fan Zhang 2, Sean McCarthy 1 1 SCIEX, MA, USA, 2 SCIEX, CA USA Analysis of protein subunits using high resolution
More informationA highly sensitive and robust 150 µm column to enable high-throughput proteomics
APPLICATION NOTE 21744 Robust LC Separation Optimized MS Acquisition Comprehensive Data Informatics A highly sensitive and robust 15 µm column to enable high-throughput proteomics Authors Xin Zhang, 1
More informationAnalysis of Intact Monoclonal Antibodies Using an M3 MicroLC with the TripleTOF 6600
Procedures Analysis of Intact Monoclonal Antibodies Using an M3 MicroLC with the TripleTOF 66 Robust and Sensitive Workflow for Qualitative and Quantitative Analysis of Biotherapeutic IgGs Khatereh Motamedchaboki,
More informationBasic protein and peptide science for proteomics. Henrik Johansson
Basic protein and peptide science for proteomics Henrik Johansson Proteins are the main actors in the cell Membranes Transport and storage Chemical factories DNA Building proteins Structure Proteins mediate
More informationCommon Issues in Qualification and Validation of Analytical Procedures
Common Issues in Qualification and Validation of Analytical Procedures Alexey Khrenov, PhD OTAT/CBER/FDA CMC Strategy Forum January 29, 2018 - Washington, DC Disclaimer These comments are an informal communication
More informationAgilent MassHunter BioConfirm Software NEW FRONTIERS IN THE CHARACTERIZATION OF BIOMOLECULES
Agilent MassHunter BioConfirm oftware NEW FRONTIER IN THE CHARACTERIZATION OF BIOMOLECULE NEW WORKFLOW FOR INTACT PROTEIN AND PROTEIN DIGET Biopharmaceutical discovery and development labs demand speed
More informationMaximizing Chromatographic Resolution of Peptide Maps using UPLC with Tandem Columns
Maximizing Chromatographic Resolution of Peptide Maps using UPLC with Tandem Columns Hongwei Xie, Martin Gilar, and Jeff Mazzeo Waters Corporation, Milford, MA U.S. APPLICATION BENEFITS The ACQUITY UPLC
More informationRapid Extraction of Therapeutic Oligonucleotides from Primary Tissues for LC/ MS Analysis Using Clarity OTX, an Oligonucleotide Extraction Cartridge
Rapid Extraction of Therapeutic Oligonucleotides from Primary Tissues for LC/ MS Analysis Using Clarity OTX, an Oligonucleotide Extraction Cartridge G. Scott*, H. Gaus #, B. Rivera*, and M. McGinley* *Phenomenex,
More informationApplication Note. Authors. Abstract. Ravindra Gudihal Agilent Technologies India Pvt. Ltd. Bangalore, India
Quantitation of Oxidation Sites on a Monoclonal Antibody Using an Agilent 1260 Infinity HPLC-Chip/MS System Coupled to an Accurate-Mass 6520 Q-TOF LC/MS Application Note Authors Ravindra Gudihal Agilent
More informationSGS Delivering Excellence in Compliant Extractables and Leachables Testing
SGS CASE STUDY SGS Delivering Excellence in Compliant Extractables and Leachables Testing A case study in unknown impurity identification & quantification SGS is a world leading inspection, verification,
More informationEnabling routine characterization of proteins. Agilent MassHunter BioConfirm software
Enabling routine characterization of proteins Agilent MassHunter BioConfirm software Bioconfirm a key component of your major biopharma workflows Intact protein analysis BioConfirm will rapidly deconvolute
More informationKinetics Review. Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets)
Quiz 1 Kinetics Review Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets) I will post the problems with solutions on Toolkit for those that can t make
More information[ VION IMS QTOF ] BEYOND RESOLUTION
[ VION IMS QTOF ] BEYOND RESOLUTION THE BENEFITS ARE CLEAR and routinely available, Complex samples give complex data with overlapping spectra and background interferences, making compound identification
More informationUnderstanding life WITH NEXT GENERATION PROTEOMICS SOLUTIONS
Innovative services and products for highly multiplexed protein discovery and quantification to help you understand the biological processes that shape life. Understanding life WITH NEXT GENERATION PROTEOMICS
More informationCase Study on Application of Analytical Life Cycle Management and Risk Management
Case Study on Application of Analytical Life Cycle Management and Risk Management Jianmei, Ph.D. Genzyme, a Sanofi Company AAPS 2015 Dione Pompe disease Brazil www.genzyme.com Outline Introduction of Concepts
More informationThermo Scientific Orbitrap Fusion Lumos Tribrid Mass Spectrometer. Breakthrough Gains for Quantitative Biology. Sensitivity Transformed
Thermo Scientific rbitrap Fusion Lumos Tribrid Mass Spectrometer Breakthrough Gains for Quantitative Biology Sensitivity Transformed The Most Advanced Instrument Built for the Most Challenging Experiments
More informationRegulatory Perspective on Analytical Method Validation During Product Development
Regulatory Perspective on Analytical Method Validation During Product Development CASSS CMC Strategy Forum 2018 Jacek Cieslak CDER/OPQ/OBP FDA Disclaimer This presentation reflects the views of the author
More informationichemistry SOLUTIONS Integrated chemistries to boost mass spectrometry workflows
ichemistry SOLUTIONS Integrated chemistries to boost mass spectrometry workflows ichemistry SOLUTIONS ichemistry solutions ichemistry solutions are the world s only reagents and consumables that are customdesigned
More informationLC/MS. Why is it the fastest growing analytical technique?
LC/MS Why is it the fastest growing analytical technique? Discussion topics Evolution of LC/MS Advantages of API Why should I use LC/MS? LC/MS markets Evolution of LC/MS interfaces 1970s to Present Moving
More informationHigh-Throughput Peptide Mapping with the Vanquish UHPLC System and the Q Exactive HF Mass Spectrometer
High-Throughput Peptide Mapping with the Vanquish UHPLC System and the Q Exactive HF Mass Spectrometer Martin Samonig 1, Kai Scheffler 2, Remco Swart 1, and Jonathan Josephs 3 1 Thermo Fisher Scientific,
More informationAn Industry Perspective on Established Conditions in the Analytical Control System. Christof Finkler, F. Hoffmann-La Roche
An Industry Perspective on Established Conditions in the Analytical Control System Christof Finkler, F. Hoffmann-La Roche Control System Development INPUT: Process Parameter OUTPUT: Quality Attribute CPPs
More informationAnalysis and Purification of Polypeptides by Reversed-Phase HPLC
Analysis and Purification of Polypeptides by Reversed-Phase HPLC Reversed-phase HPLC is a valuable tool for the analysis and purification of proteins and peptides. It is effective in separating peptide
More informationQuantitatitive Analysis of Phosphorothioate Oligonucleotide in Human Plasma Using LC-MS/MS with On-Line Extraction
Laixin Wang, Sherry Liu, Qiuying Zhu, Scott Reuschel and Min Meng Tandem Labs Quantitatitive Analysis of Phosphorothioate Oligonucleotide in Human Plasma Using LC-MS/MS with On-Line Extraction Introduction
More informationRegulatory Considerations on. Office of Biotechnology Products
Regulatory Considerations on Multiproduct t Facilities for Biotechnology Products Jun Park, Ph.D. Division of Monoclonal Antibodies Office of Biotechnology Products OPS/CDER/FDA 2011 CASSS CMC Strategy
More informationACCURACY THE FIRST TIME. Reliable testing with performance, productivity and value combined AB SCIEX 3200MD SERIES MASS SPECTROMETERS
ACCURACY THE FIRST TIME Reliable testing with performance, productivity and value combined AB SCIEX 3200MD SERIES MASS SPECTROMETERS Reliability, reproducibility, and confidence in your data Your routine
More informationChallenges in peptide mapping mass spectrometry of biopharmaceuticals
Challenges in peptide mapping mass spectrometry of biopharmaceuticals Will Burkitt, Ben Holmes, Johanna Paris, Nisha Patel, John O Hara 07.MAR.2018 Characterisation within UCB 2 Context to the type of
More informationThe Role of Mass Spectrometry for Developing Biotherapeutics: Regulatory Perspectives
The Role of Mass Spectrometry for Developing Biotherapeutics: Regulatory Perspectives Jun Park, Ph.D. Division of Monoclonal Antibodies Office of Biotechnology Products CDER/FDA CASSS, Applications of
More informationDemonstrating Biosimilarity of a Therapeutic Protein Product to a Reference Product ICH Guidance
Demonstrating Biosimilarity of a Therapeutic Protein Product to a Reference Product ICH Guidance Derek Bradley M.Sc. BioClin Research Laboratories 13 th May 2016 Agenda Brief overview of biosimilars ICH
More informationANALYTICAL VALIDATION CHALLENGES DURING THE RAPID DEVELOPMENT OF KEYTRUDA
ANALYTICAL VALIDATION CHALLENGES DURING THE RAPID DEVELOPMENT OF KEYTRUDA January 29, 2018 CMC Strategy Forum Industry Considerations for Phase-Appropriate Method Validations Athena Nagi Abstract and Outline
More informationProudly serving laboratories worldwide since 1979 CALL for Refurbished & Certified Lab Equipment
www.ietltd.com Proudly serving laboratories worldwide since 1979 CALL +1.847.913.0777 for Refurbished & Certified Lab Equipment API 3000 LC/MS/MS Unprecedented Performance: An advanced LC/MS/MS system
More informationMass Detection for the Chromatographer Waters ACQUITY QDa Detector
Mass Detection for the Chromatographer Waters ACQUITY QDa Detector Warren B Potts III Senior Director Americas Marketing warren_potts@waters.com 2017 Waters Corporation 1 Agenda Overview of technology
More informationApplication Note. Authors. Abstract. Ravindra Gudihal Agilent Technologies India Pvt. Ltd. Bangalore India
Characterization of bacteriophage derived anti-staphylococcal protein (P28) from production to purification using Agilent HPLC-Chip Q-TOF LC/MS system Application Note Authors Ravindra Gudihal Agilent
More informationAPPLYING SCIENTIFIC CONSIDERATIONS AND STATISTICAL APPROACHES IN ANALYTICAL SIMILARITY ASSESSMENT
APPLYING SCIENTIFIC CONSIDERATIONS AND STATISTICAL APPROACHES IN ANALYTICAL SIMILARITY ASSESSMENT JENNIFER LIU CASSS CMC STRATEGY FORUM EUROPE 2017, MAY 22-24 BIOSIMILAR DEVELOPMENT BEGINS WITH THOROUGH
More informationDevelopment of a hybrid assay for the quantification of a mab drug in human serum at the low ng/ml levels
Development of a hybrid assay for the quantification of a mab drug in human serum at the low ng/ml levels EBF Open Symposium 21-23 November 2018 marco.michi@aptuit.com Presentation Topics Current scenario
More informationRapidly Characterize Antibody- Drug Conjugates and Derive Drug-to-Antibody Ratios Using LC/MS
Rapidly Characterize Antibody- Drug Conjugates and Derive Drug-to-Antibody Ratios Using LC/MS Ning Tang, Ph.D. Agilent Technologies Santa Clara, California, USA Heterogeneity in ADCs Complexity T-DM1 (Genentech)
More informationSpectrum Mill MS Proteomics Workbench. Comprehensive tools for MS proteomics
Spectrum Mill MS Proteomics Workbench Comprehensive tools for MS proteomics Meeting the challenge of proteomics data analysis Mass spectrometry is a core technology for proteomics research, but large-scale
More informationAgilent InfinityLab LC/MSD Series EXTEND THE BOUNDARIES OF YOUR ANALYSIS
Agilent InfinityLab LC/MSD Series EXTEND THE BUNDARIES F YUR ANALYSIS RIGHT FRM THE START For results that are unmistakably clear, combine highly efficient liquid chromatography with easy-to-use mass selective
More informationautoflex max Practical Power, Maximum Utility Innovation with Integrity MALDI-TOF MS
autoflex max Practical Power, Maximum Utility Innovation with Integrity MALDI-TOF MS Wide application versatility with enhanced dynamic range The autoflex max series is based on Bruker s robust and efficient
More information