Rapidly Characterize Antibody- Drug Conjugates and Derive Drug-to-Antibody Ratios Using LC/MS
|
|
- Dorthy Johnston
- 6 years ago
- Views:
Transcription
1 Rapidly Characterize Antibody- Drug Conjugates and Derive Drug-to-Antibody Ratios Using LC/MS Ning Tang, Ph.D. Agilent Technologies Santa Clara, California, USA
2 Heterogeneity in ADCs Complexity T-DM1 (Genentech) ADC Disulfide shuffling Pyroglutamate mab Drug Deamidation Oxidation Fragmentation Glycosylation (G0, G1, G2) Truncation (Lys 0, 1, 2) Heterogeneity in ADC - More complex than mabs alone - Dependent on linker & payload stability (hydrolysis, degradation, etc.) - Dependent on the conjugation chemistry
3 Mass Spectrometry Always Separate Different Drug Conjugates MS also provides information on relative amounts of antibodies loaded with 1, 2, 3, 4 etc. drugs (without prior separation) MS also provides information on unconjugated antibody MS can detect other conjugation products, e.g. - Cross linked species - Species with linker attached but no drug
4 Agilent DAR Characterization Workflow LC/MS DAR Calculation Report ADC Sample Prep Reduction Deglycosylation LC/MS DAR Calculation Report ADC ADC purification from serum LC/MS DAR Calculation Report ADC Sample Prep Digestion Clean up LC/MS/MS Payload Mapping Report
5 LC/MS Setup LC: Agilent 1290 UHPLC MS: Agilent 6550 ifunnel Q-TOF Column: Agilent PLRP-S 1000A 8 µm 150 x 2.1 mm Column temp: 80 C Flow rate: 0.4 ml/min
6 Conjugation Adds Heterogeneity DAR1 DAR2 DAR3 DAR4 DAR5 DAR6 DAR7 DAR8
7 MassHunter ADC DAR Calculator Automatic calculation of DAR value Intuitive peak integration Built-in support for intact and reduced ADCs Easy analysis of different types of ADC molecules (Lyslinked, Cys-linked and site-specific ADCs) Flexible control to define peaks of interest Dedicated ADC DAR report in PDF and MS Word
8 Intact ADC DAR Calculation calculated DAR DAR peak list shows all components and % area for each species
9 Automated Workflow for Deglycosylation & Reduction in DAR Characterization
10 Reduced ADC DAR Calculation heavy chain light chain
11 Making these technologies accessible A front-end to LC and LC/MS systems that allows investigators to submit samples without being experts in the technology with few instrument specialists who are responsible for multiple systems 11
12 MassHunter Walkup: 3 Step Sample Submission 12
13 MassHunter Walkup: 3 Step Sample Submission 13
14 MassHunter Walkup: 3 Step Sample Submission 14
15 MassHunter Walkup: 3 Step Sample Submission 15
16 DAR Calculation Automation Workflow in Walkup ADC = Antibody Drug Conjugates DAR = Drug Antibody Ratio
17 ADC DAR Determination Workflow for Serum Samples SA- W SA- W Sample Preparation LC/MS DAR Calculation
18 Affinity Purified T-DM1 at 6 Different Loading Amounts AF-1000 ng; ~80ng on column. AF-125 ng; ~10ng on column DAR=3. DAR=3.5 5 DAR=3.5 AF-500 ng; ~40ng on column. AF-62.5 ng; ~5ng on column DAR=3.5 DAR=3.5 AF-250 ng; ~20ng on column. AF ng; ~2.5ng on column. DAR=3.5 DAR=3.4
19 Reproducibility of Affinity Purified T-DM1 at 6 Different Loading Amounts AF: Affinity purified AF-1000 ng; ~80ng on column. AF-500 ng; ~40ng on column. AF-250 ng; ~20ng on column. AF-125 ng; ~10ng on column AF-62.5 ng; ~5ng on column AF ng; ~2.5ng on column.
20 ADC Peptide Mapping Workflow Using AssayMAP Bravo and LC/MS/MS Sample Preparation LC/MS BioConfirm
21 Identification of Conjugated Peptides A T-DM1 20X Herceptin B EIC: T-DM1 Herceptin
22 Signature Elution Pattern and Fragment Ions A LTVDK[ ]SR B b 2 y 2 2+ y 5 y y y b 2 -H O 2 b 3 -H O 2 Drug Fragments C Precursor Drug Fragment GPSVFPLAPSSK[ ] STSGGTAALGCLVK y ion b ion D y 1 x b 4 -H O b 5 -H O Counts vs. Mass-to-Charge (m/z) Drug Fragments b 5 y 5 y 6 b 7 y 7 b 8 y 8 y 11
23 Sequence Coverage and Conjugation Sites Identification Light Chain DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGS RSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS VVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC Heavy Chain EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADS VKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKG PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV TVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPG K: Confirmed drug Identified conjugation sequence site (Light-9; Heavy 20) K: Potential drug conjugation site (Heavy 5) K: Unconjugated site identified (Light 4; Heavy 6) Total (Light-13; Heavy31)
24 Summary Determining ADC DAR is an important aspect of ADC characterization Workflow can be enabled in various ways New DAR calculator makes obtaining DAR value easy and straight forward Sample preparation can be streamlined and automated using the AssayMAP Bravo platform for reproducibility and scalability Localization of conjugation sites can be achieved by digesting the protein and analyzing by LC/MS/MS
25 Acknowledgments Application development Jing Chen Alex Zhu Ravindra Gudihal Steve Murphy Maryann Shen Software development Tanner Stevenson Robert Williams
26 Thank you for your attention! To learn more about Agilent s Biopharma Solutions, follow us on LinkedIn at
Precise Characterization of Intact Monoclonal Antibodies by the Agilent 6545XT AdvanceBio LC/Q-TOF
Precise Characterization of Intact Monoclonal Antibodies by the Agilent 6545XT AdvanceBio LC/Q-TOF Application Note Author David L. Wong Agilent Technologies, Inc. Santa Clara, CA, USA Introduction Monoclonal
More informationPLRP-S Polymeric Reversed-Phase Column for LC/MS Separation of mabs and ADC
PLRP-S Polymeric Reversed-Phase Column for LC/MS Separation of mabs and ADC Analysis of Intact and Fragmented mabs and ADC Application Note Biotherapeutics and Biologics Author Suresh Babu C.V. Agilent
More informationSize Exclusion Chromatography/ Mass Spectrometry Analysis of Antibody Drug Conjugates Using the Agilent 1260 Infinity II Bio-Inert LC
Size Exclusion Chromatography/ Mass Spectrometry Analysis of Antibody Drug Conjugates Using the Agilent 126 Infinity II Bio-Inert LC Application Note Biologics & Biosimilars Author Sonja Schneider Agilent
More informationBioConfirm B Presentation
BioConfirm B.08.00 Presentation 1 Major Enhancements to Increase Your Productivity The Latest Version of our BioConfirm Product, B.08.00 BioConfirm is protein and peptide characterization software using
More informationAntibody-drug Conjugates: Characterization and Control Strategies of Lysine-linked Products
Antibody-drug Conjugates: Characterization and Control Strategies of Lysine-linked Products Fred Jacobson Protein Analytical Chemistry Genentech, Inc. CASSS CMC Strategy Forum Japan 2013 December 9-10,
More informationHighly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs
Technical Overview Highly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs Authors Stephen Madden, Crystal Cody, and Jungkap Park Agilent Technologies, Inc. Santa Clara, California,
More informationUtilizing novel technology for the analysis of therapeutic antibodies and host cell protein contamination
Utilizing novel technology for the analysis of therapeutic antibodies and host cell protein contamination Kelli Jonakin, Ph.D. Senior Field Application Scientist, Seattle, WA Eric Johansen, Ph.D. Senior
More informationIntelligent Disulfide Bond Analysis
Intelligent Disulfide Bond Analysis Why Study Disulfide Bonds? Save Money by making cell cultures more efficient! Regulations Process Control Higher Quality biotherapeutics Efficacy Protect from Competition
More informationmabs and ADCs analysis by RP
mabs and ADCs analysis by RP Shanhua Lin, Ph.D. The world leader in serving science Protein and mab Separation by HPLC Size difference? YES Size Exclusion Chromatography (SEC) MAbPac SEC-1 NO NO Charge
More informationThe clearly better choice
Agilent Accurate-Mass 6500 Series Q-TOF and 600 Series TOF LC/MS Systems The clearly better choice in TOF and Q-TOF LC/MS Our measure is your success. products applications soft ware services The unmatched
More informationProteins. Patrick Boyce Biopharmaceutical Marketing Manager Waters Corporation 1
Routine Characterization of mabs and Other Proteins Patrick Boyce Biopharmaceutical Marketing Manager Europe and India 2011 Waters Corporation 1 Agenda Why? What scientific challenges? Technology Example
More informationCharacterize Fab and Fc Fragments by Cation-Exchange Chromatography
Characterize Fab and Fc Fragments by Cation-Exchange Chromatography Application Note Biologics and Biosimilars Authors Isabel Vandenheede, Emmie Dumont, Pat Sandra, and Koen Sandra Research Institute for
More informationPeptide Mapping of Glycoprotein Erythropoietin by HILIC LC/MS and RP-LC/MS
Peptide Mapping of Glycoprotein Erythropoietin by HILIC LC/MS and RP-LC/MS Application Note BioPharma Authors Alex Zhu, James Martosella, and Phu T Duong Agilent Technologies, Inc Introduction Peptide
More informationCharacterization of Glycosylation in the Fc Region of Therapeutic Recombinant Monoclonal Antibody
Characterization of Glycosylation in the Fc Region of Therapeutic Recombinant Monoclonal Antibody Application Note BioPharma Authors James Martosella, Phu Duong, and Alex Zhu Agilent Technologies, Inc.
More informationApplication Note. Kwasi Antwi, Amanda Ribar, Urban A. Kiernan, and Eric E. Niederkofler Thermo Fisher Scientific, Tempe, Arizona
Analysis of an Antibody Drug Conjugate using MSIA D.A.R.T. S. Technology, an Integral Part of Ligand Binding Mass Spectrometric Immunoassay (LB-MSIA) Workflow Application Note Kwasi Antwi, Amanda Ribar,
More informationMaximizing Chromatographic Resolution of Peptide Maps using UPLC with Tandem Columns
Maximizing Chromatographic Resolution of Peptide Maps using UPLC with Tandem Columns Hongwei Xie, Martin Gilar, and Jeff Mazzeo Waters Corporation, Milford, MA U.S. APPLICATION BENEFITS The ACQUITY UPLC
More informationUNIFI: an innovative enabling platform Ken Eglinton Nordic User Training, September 2013
UNIFI: an innovative enabling platform Ken Eglinton Nordic User Training, September 2013 2013 Waters Corporation 1 Waters Laboratory Informatics Product Portfolio MassLynx Mass Spectrometry Software NuGenesis
More informationApplication Note. Author. Abstract. Biotherapeutics and Biologics. Sonja Schneider Agilent Technologies, Inc. Waldbronn, Germany
D-LC/MS Characterization of Charge Variants Using Ion Exchange and Reversed-Phase Chromatography Multiple Heart-Cutting D-LC Analysis of Innovator versus Biosimilar Monoclonal Antibodies Application Note
More informationAdvanced QA/QC characterization MS in QC : Multi Attribute Method
Advanced QA/QC characterization MS in QC : Multi Attribute Method Global BioPharma Summit The world leader in serving science A Complex Problem: Drug Safety and Quality Safety Is the product safe to use?
More informationN-Glycan Profiling Analysis of a Monoclonal Antibody Using UHPLC/FLD/Q-TOF
N-Glycan Profiling Analysis of a Monoclonal Antibody Using UHPLC/FLD/Q-TOF Application Note Authors Xianming Liu, Wei Zhang, Yi Du, Sheng Yin, Hong Que, and Weichang Zhou WuXi AppTec iopharmaceuticals
More informationAlgorithm for Matching Additional Spectra
Improved Methods for Comprehensive Sample Analysis Using Protein Prospector Peter R. Baker 1, Katalin F. Medzihradszky 1 and Alma L. Burlingame 1 1 Mass Spectrometry Facility, Dept. of Pharmaceutical Chemistry,
More informationMonoclonal Antibody Characterization on Q Exactive and Oribtrap Elite. Yi Zhang, Ph.D Senior Proteomic Marketing Specialist Oct.
Monoclonal Antibody Characterization on Q Exactive and Oribtrap Elite Yi Zhang, Ph.D Senior Proteomic Marketing Specialist Oct. 12, 211 Outline Orbitrap Mass Spectrometer in mab Characterization Intact
More informationHigh-Throughput Peptide Mapping with the Vanquish UHPLC System and the Q Exactive HF Mass Spectrometer
High-Throughput Peptide Mapping with the Vanquish UHPLC System and the Q Exactive HF Mass Spectrometer Martin Samonig 1, Kai Scheffler 2, Remco Swart 1, and Jonathan Josephs 3 1 Thermo Fisher Scientific,
More informationTony Mire-Sluis Vice President, Corporate, Product and Device Quality Amgen Inc
The Regulatory Implications of the ever increasing power of Mass Spectrometry and its role in the Analysis of Biotechnology Products Where do we draw the line? Tony Mire-Sluis Vice President, Corporate,
More informationPeptide Mapping: A Quality by Design (QbD) Approach
Peptide Mapping: A Quality by Design (QbD) Approach Application Note Bio-Pharmaceutical Authors Sreelakshmy Menon and Suresh babu C.V. Agilent Technologies, Inc. Richard Verseput S-Matrix Corporation Abstract
More informationDisulfide Linkage Analysis of IgG1 using an Agilent 1260 Infinity Bio inert LC System with an Agilent ZORBAX RRHD Diphenyl sub 2 µm Column
Disulfide Linkage Analysis of IgG1 using an Agilent 126 Infinity Bio inert LC System with an Agilent ZORBAX RRHD Diphenyl sub 2 µm Column Application Note Biotherapeutics & Biosimilars Author M. Sundaram
More informationHDX-MS at Waters Waters Corporation 1
HDX-MS at Waters 2011 Waters Corporation 1 Hydrogen Deuterium Exchange MS systems Dedicated standards and UPLC BEH separation chemistries nanoacquity UPLC with HDX technology Xevo G2-S QTof MS and Synapt
More informationDeveloping Robust and Efficient IEX Methods for Charge Variant Analysis of Biotherapeutics Using ACQUITY UPLC H-Class System and Auto Blend Plus
Developing Robust and Efficient IEX Methods for Charge Variant Analysis of Biotherapeutics Using ACQUITY UPLC H-Class System and Auto Blend Plus Robert Birdsall, Thomas Wheat, and Weibin Chen Waters Corporation,
More informationApplication Note. Authors. Abstract
Automated, High Precision Tryptic Digestion and SISCAPA-MS Quantification of Human Plasma Proteins Using the Agilent Bravo Automated Liquid Handling Platform Application Note Authors Morteza Razavi, N.
More informationCell Clone Selection Using the Agilent Bio-Monolith Protein A Column and LC/MS
Cell Clone Selection Using the Agilent Bio-Monolith Protein A Column and LC/MS Application Note Biopharmaceuticals and Biosimilars Authors Emmie Dumont, Isabel Vandenheede, Pat Sandra, Koen Sandra Research
More informationThermo Scientific BioLC Columns. Monoclonal antibody. characterization
Thermo Scientific BioLC Columns Monoclonal antibody characterization Innovative technologies and workflows for increasing productivity and throughput Table of Contents Characterization of Monoclonal Antibodies
More informationThermo Scientific Peptide Mapping Workflows. Upgrade Your Maps. Fast, confident and more reliable peptide mapping.
Thermo Scientific Peptide Mapping Workflows Upgrade Your Maps Fast, confident and more reliable peptide mapping. Smarter Navigation... Peptide mapping is a core analytic in biotherapeutic development.
More informationSMART Digest Kit User Manual. Version 2
SMART Digest Kit User Manual Version 2 XX21543 Revision A August 2016 SMART Digest Kit Delivering simple, fast and reproducible digestion of proteins Thermo Scientific SMART Digest kits are designed for
More informationAnalysis of Intact and C-terminal Digested IgG1 on an Agilent Bio MAb 5 µm Column
Analysis of Intact and C-terminal Digested IgG1 on an Agilent Bio MAb µm Column Application Note BioPharma Authors Xiaomi Xu and Phu T Duong Agilent Technologies, Inc. Abstract Nearly all proteins undergo
More informationGenerating Automated and Efficient LC/MS Peptide Mapping Results with the Biopharmaceutical Platform Solution with UNIFI
with the Biopharmaceutical Platform Solution with UNIFI Vera B. Ivleva, Ying Qing Yu, Scott Berger, and Weibin Chen Waters Corporation, Milford, MA, USA A P P L I C AT ION B E N E F I T S The ability to
More informationConfident Pesticides Analysis with the Agilent LC/Triple Quadrupole and TOF/QTOF Solutions
Confident Pesticides Analysis with the Agilent LC/Triple Quadrupole and TOF/QTOF Solutions Screening and Confirmation Chemical Analysis Solution Unit November, 2009 Page 1 Agilent s New 6540 Ultra High
More informationAsish Chakraborty, St John Skilton, Weibin Chen and John C. Gebler Waters Corporation, Milford, MA, U.S. INTRODUCTION METHODS. Sample preparation
Com p r e h ensiv e a n d Rou t in e C ha r ac t e riz at io n o f P rot eins a n d P e p t i d e s by LC/MS and LC/MS E Asish Chakraborty, St John Skilton, Weibin Chen and John C. Gebler Waters Corporation,
More informationFPO. BioPharma Compass 2.0. Innovation with Integrity. Accelerate Biopharmaceutical Analysis. Software
FPO BioPharma Compass 2.0 Accelerate Biopharmaceutical Analysis Innovation with Integrity Software Developed with the Biopharma Industry Award-winning biopharmaceutical analysis platform Commercial and
More informationFast and High-Resolution Reversed-Phase Separation of Synthetic Oligonucleotides
Fast and High-Resolution Reversed-Phase Separation of Synthetic Oligonucleotides High-pH-stable, superficially porous particle columns for LC/UV and LC/MS Application Note Biologics and Biosimilars Authors
More informationRapid Peptide Mapping via Automated Integration of On-line Digestion, Separation and Mass Spectrometry for the Analysis of Therapeutic Proteins
Rapid Peptide Mapping via Automated Integration of On-line Digestion, Separation and Mass Spectrometry for the Analysis of Therapeutic Proteins Esther Lewis, 1 Kevin Meyer, 2 Zhiqi Hao, 1 Nick Herold,
More informationOptimization of ADC Process Development. Eric LACOSTE PhD, Chemistry and Biotechnology Development Sanofi Aventis R&D, Vitry sur Seine, France 2016
Optimization of ADC Process Development Eric LACOSTE PhD, Chemistry and Biotechnology Development Sanofi Aventis R&D, Vitry sur Seine, France 2016 Strictly confidential do not distribute without prior
More informationMonoclonal Antibody Characterization Achieving Higher Throughput and Productivity
Monoclonal Antibody Characterization Achieving Higher Throughput and Productivity Dionex Solutions to Accelerate Monoclonal Antibody R&D and Characterization The throughput and productivity challenge Increasing
More informationFraction Analysis of Cysteine Linked Antibody-Drug Conjugates Using Hydrophobic Interaction. chromatography. Agilent 1260 Infinity II Bio-Inert System
Application Note Biologics & Biosimilars Fraction Analysis of Cysteine Linked Antibody-Drug Conjugates Using Hydrophobic Interaction Chromatography Agilent 126 Infinity II Bio-Inert System 7 6 5 4 5. 7.5
More informationrapiflex Innovation with Integrity Designed for Molecules that Matter. MALDI TOF/TOF
rapiflex Designed for Molecules that Matter. Innovation with Integrity MALDI TOF/TOF rapiflex TM The first MALDI-TOF/TOF that adapts to your needs. The rapiflex is the most advanced MALDI TOF/TOF system
More informationA Unique LC-MS Assay for Host Cell Proteins(HCPs) ) in Biologics
A Unique LC-MS Assay for Host Cell Proteins(HCPs) ) in Biologics Catalin Doneanu,, Ph.D. Biopharmaceutical Sciences, Waters September 16, 2009 Mass Spec 2009 2009 Waters Corporation Host Cell Proteins
More informationADVANCE ACCURACY AND PRODUCTIVITY FOR FASTER ANALYSIS
Agilent AdvanceBio Columns ADVANCE ACCURACY AND PRODUCTIVITY FOR FASTER ANALYSIS with Agilent ZORBAX RRHD 3Å 1.8 µm columns ns Rapid resolution high definition columns for UHPLC protein and peptide separations
More informationReversed Phase Solutions for the Analysis of Proteins, Peptides, and Oligonucleotides
Reversed Phase Solutions for the Analysis of Proteins, Peptides, and Oligonucleotides The line, which includes and Proteo, offers various reversed phase solutions for biochromatography. With these two
More informationThermo Scientific Solutions for Intact-Protein Analysis. Better, Faster Decisions for. Biotherapeutic Development
Thermo Scientific Solutions for Intact-Protein Analysis Better, Faster Decisions for Biotherapeutic Development Quickly and Accurately Assess Product Quality and Safety Therapeutic proteins and monoclonal
More informationDevelopment and Characterization of Multi-Platform Antibody Drug Conjugates
Development and Characterization of Multi-Platform Antibody Drug Conjugates Jason A. Starkey Senior Principal Scientist - BioTherapeutics Pharmaceutical Sciences Pfizer, Inc. This document provides an
More informationCaptiveSpray nanobooster
CaptiveSpray nanobooster The Revolution in Proteomics Ionization Innovation with Integrity LC-MS Source The Key to Performance and Reliability for nano flow MS Bruker CaptiveSpray principle: Stable and
More informationImproved Peptide Maps Using Core-Shell Media: Explaining Better Biopharmaceutical Applications With Kinetex C18 Columns
Improved Peptide Maps Using Core-Shell Media: Explaining Better Biopharmaceutical Applications With Kinetex C18 Columns Michael McGinley, Jeff Layne, and Vita Knudson Phenomenex, Inc., 411 Madrid Ave.,Torrance,
More informationProudly serving laboratories worldwide since 1979 CALL for Refurbished & Certified Lab Equipment QTRAP 5500
www.ietltd.com Proudly serving laboratories worldwide since 1979 CALL +847.913.0777 for Refurbished & Certified Lab Equipment QTRAP 5500 Powerful synergy results when the world s most sensitive triple
More informationWhy do LC MS and LBA
Why do LC MS and LBA results differ? A literature evaluation 18 November 2015 Nico van de Merbel An overview In most published BA methods for large molecules, no comparison of platforms (LBA vs LBA, LBA
More informationMethod Development Considerations for Reversed-Phase Protein Separations
Method Development Considerations for Reversed-Phase Protein Separations Hillary B. Hewitson, Thomas E. Wheat, Paula Hong, Kenneth J. Fountain APPLICATION BENEFITS n The BEH00 C 4 chemistry is available
More informationA Generic Kit-Based Approach for Quantifying Monoclonal Antibody Drugs Through Direct Digestion of Discovery Study Samples
A Generic Kit-Based Approach for Quantifying Monoclonal Antibody Drugs Through Direct Digestion of Discovery Study Samples Mary Lame, Hua Yang, Sherri Naughton, and Erin Chambers Waters Corporation, Milford,
More informationAgilent BioHPLC Columns PROTEIN IDENTIFICATION AND IMPURITY PROFILING USING REVERSED-PHASE HPLC/UHPLC
Agilent BioHPLC Columns PROTEIN IDENTIFICATION AND IMPURITY PROFILING USING REVERSED-PHASE HPLC/UHPLC REVERSED-PHASE HPLC/UHPLC Agilent can boost your accuracy and productivity Reversed-phase is used to
More informationXevo G2-S QTof and TransOmics: A Multi-Omics System for the Differential LC/MS Analysis of Proteins, Metabolites, and Lipids
Xevo G2-S QTof and TransOmics: A Multi-Omics System for the Differential LC/MS Analysis of Proteins, Metabolites, and Lipids Ian Edwards, Jayne Kirk, and Joanne Williams Waters Corporation, Manchester,
More informationRapid Peptide Catabolite ID using the SCIEX Routine Biotransform Solution
Rapid Peptide Catabolite ID using the SCIEX Routine Biotransform Solution Rapidly Identify Major Catabolites with the SCIEX X500R QTOF System and MetabolitePilot TM 2.0 Software Ian Moore and Jinal Patel
More informationUNIFI: The user environment Ken Eglinton Nordic User Training, September 2013
UNIFI: The user environment Ken Eglinton Nordic User Training, September 2013 2013 Waters Corporation 1 What is UNIFI? Single Platform for Chromatography, Mass Spectrometry, Data Management and Laboratory
More informationApplication Note. Authors. Abstract. Clinical Research
Workflow Automation for LC/MS: In-Solution Protein Digestion, Peptide Cleanup, and Strong Cation-Exchange Fractionation of Peptides Enabled by AssayMAP Technology Application Note Clinical Research Authors
More informationStability of Biological Products
Stability of Biological Products Dr Jurgen Lindner Principal, BioPharma Consulting & Executive Secretary, APIMAA Biological Products Functional Proteins or Polypeptides (mab s, enzymes & inhibitors, growth
More informationMBios 478: Mass Spectrometry Applications [Dr. Wyrick] Slide #1. Lecture 25: Mass Spectrometry Applications
MBios 478: Mass Spectrometry Applications [Dr. Wyrick] Slide #1 Lecture 25: Mass Spectrometry Applications Measuring Protein Abundance o ICAT o DIGE Identifying Post-Translational Modifications Protein-protein
More informationHigh Sequence Coverage Peptide Mapping of a Monoclonal Antibody
High Sequence Coverage Peptide Mapping of a Monoclonal Antibody with UPLC/MS E Hongwei Xie, Martin Gilar, and John C. Gebler Waters Corporation, Milford, MA, U.S.A. INT RODUCTION Monoclonal antibodies
More informationEPA Method 543: Selected Organic Contaminants by Online SPE LC/MS/MS Using the Agilent Flexible Cube
EPA Method 543: Selected Organic Contaminants by Online SPE LC/MS/MS Using the Agilent Flexible Cube Application Note Environmental Authors Don Noot, Ralph Hindle Vogon Laboratory Services Cochrane, AB
More informationMassPREP On-Line Desalting Cartridge
CONTENTS I. INTRODUCTION II. INSTALLING THE MASSPREP ON-LINE DESALTING CARTRIDGE INTO THE SENTRY.1 X 1 MM GUARD COLUMN HOLDER III. RECOMMENDED LC/MS SYSTEM CONFIGURATION TO MINIMIZE MS SOURCE CONTAMINATION
More informationFeaturing Analyst software under Windows NT for enhanced performance and ease of use. API 150EX. LC/MS System
Featuring Analyst software under Windows NT for enhanced performance and ease of use. API 15EX LC/MS System compact, rugged, The API 15EX LC/MS System is the most rugged and reliable single quadrupole
More informationUsing accurate mass LC/MS/MS in forensic toxicology screening
Using accurate mass LC/MS/MS in forensic toxicology screening Dr Simon Elliott Consultant Forensic Toxicologist (ROAR) Forensics Ltd Malvern Hills Science Park, Geraldine Rd, Malvern, Worcestershire, WR14
More informationRapid Soft Spot Analysis using the SCIEX Routine Biotransform Solution
Rapid Soft Spot Analysis using the SCIEX Routine Biotransform Solution Rapidly Identify Top Metabolites with the SCIEX X500R QTOF System and MetabolitePilot TM 2.0 Software Shaokun Pang and Ian Moore SCIEX,
More informationSMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization
APPLICATION NOTE Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization No. 1159 Authors: Martin Samonig 1, Alexander Schwahn 2, Ken Cook 3, Mike Oliver
More informationVyužití cílené proteomiky pro kontrolu falšování potravin: identifikace peptidových markerů v mase pomocí LC- Q Exactive MS/MS
Využití cílené proteomiky pro kontrolu falšování potravin: identifikace peptidových markerů v mase pomocí LC- Q Exactive MS/MS Michal Godula Ph.D. Thermo Fisher Scientific The world leader in serving science
More informationHIGHER IMPACT LC/MS DIAGNOSTICS AGILENT IN VITRO DIAGNOSTIC MEDICAL DEVICES FOR CLINICAL LABORATORIES
HIGHER IMPACT LC/MS DIAGNOSTICS AGILENT IN VITRO DIAGNOSTIC MEDICAL DEVICES FOR CLINICAL LABORATORIES 2 AGILENT IN THE CLINIC THE PARTNER YOU TRUST Agilent s commitment to quality When a diagnosis is on
More informationThe Role of Mass Spectrometry for Developing Biotherapeutics: Regulatory Perspectives
The Role of Mass Spectrometry for Developing Biotherapeutics: Regulatory Perspectives Jun Park, Ph.D. Division of Monoclonal Antibodies Office of Biotechnology Products CDER/FDA CASSS, Applications of
More informationA Complete Workflow Solution for Intact Monoclonal Antibody Characterization Using a New High-Performance Benchtop Quadrupole- Orbitrap LC-MS/MS
A Complete Workflow Solution for Intact Monoclonal Antibody Characterization Using a New High-Performance Benchtop Quadrupole- Orbitrap LC-MS/MS Zhiqi Hao, 1 Yi Zhang, 1 David Horn, 1 Seema Sharma, 1 Shiaw-Lin
More informationPharmacokinetic Analysis of the mab Adalimumab by ELISA and Hybrid LBA/LC/MS: A Comparison Study
Pharmacokinetic Analysis of the mab Adalimumab by ELISA and Hybrid LBA/LC/MS: A Comparison Study Featuring the SCIEX BioBA Solution Xi Qu 1, Shuyu Hou 1, Meghan McCann 1, Caroline Becker 1, Xun Wang 1,
More informationIntra-tumor Catabolites (fate of ADC) can Predict ADC Efficacy. Donglu Zhang, Ph.D. Genentech Feb 21, 2017 World ADC Berlin-2017
Intra-tumor Catabolites (fate of ADC) can Predict ADC Efficacy Donglu Zhang, Ph.D. Genentech Feb 21, 2017 World ADC Berlin-2017 1 Outline ADC structure and mechanism of action (MOA) Can we use PK or PK-PD
More informationIdentification of Critical Product Quality Attributes: Impact of Product Variants on Safety and Efficacy
Identification of Critical Product Quality Attributes: Impact of Product Variants on Safety and Efficacy Ziping Wei, Ph.D. Analytical Biochemistry MedImmune January 25, 2010 Outline Why do we need to identify
More informationHPLC 2016 Short Courses
HPLC 2016 Short Courses Two days of Educational Short Courses will be offered the Sunday and Monday preceding the conference. The courses are taught by leading academic and industrial scientists and cover
More informationApplication Note. Author. Abstract. Biopharmaceuticals. Verified for Agilent 1260 Infinity II LC Bio-inert System. Sonja Schneider
Combining small-scale purification and analysis of monoclonal antibodies on one instrument Protein purification with high-volume injection using the Agilent 126 Infinity Bio-inert Quaternary LC System
More informationphab Amine and Thiol Reactive Dyes for Antibody Internalization Studies Nidhi Nath, Ph.D. Group Leader, Protein Analysis Promega Corporation
phab Amine and Thiol Reactive Dyes for Antibody Internalization Studies Nidhi Nath, Ph.D. Group Leader, Protein Analysis 1 Outline 1. phab Dyes 2. Protocols for conjugating phab Dyes to antibodies 3. Applications:
More informationProteomics And Cancer Biomarker Discovery. Dr. Zahid Khan Institute of chemical Sciences (ICS) University of Peshawar. Overview. Cancer.
Proteomics And Cancer Biomarker Discovery Dr. Zahid Khan Institute of chemical Sciences (ICS) University of Peshawar Overview Proteomics Cancer Aims Tools Data Base search Challenges Summary 1 Overview
More informationConjugated protein biotherapeutics
B i o P r o c e s s TECHNICAL Mass Spectrometric Conjugate Characterization Process Qualification of Recombinant Protein Hapten Conjugation Miao-Fang Lin, Margo Wilson, Michael V. Murray, and Greg W. Adams
More informationPharma&Biotech. ADC Process Transfer from a CMO Perspective: How to Make a Collaboration Successful
Pharma&Biotech ADC Process Transfer from a CMO Perspective: How to Make a Collaboration Successful Additional Information and Disclaimer Lonza Group Ltd has its headquarters in Basel, Switzerland, and
More informationRegulatory Review Considerations of Drug-Linker Quality in ADCs
Regulatory Review Considerations of Drug-Linker Quality in ADCs Xiao Hong Chen, Ph.D. Acting Quality Assessment Lead Division of New Drug Products I, Branch II ONDP/OPQ/CDER/FDA Outlines ADC IND submissions
More informationLabChip GXII: Antibody Analysis
WHITE PAPER LabChip GXII: Antibody Analysis Antibody Analysis using microfluidic technology in high throughput Quality by Design Experiments Abstract Current initiatives in Process Analytical Technology
More informationCase 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005
Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 9 September 005 Focus concept Purification of a novel seed storage protein allows sequence analysis and
More informationBiologics Bioanalysis
Biologics Bioanalysis GUIDE TO INNOVATION Biologics Bioanalysis Guide to Innovation Pharmaceutical companies have leveraged advancements in basic science perhaps more than any other industry. With the
More informationThermo Scientific TSQ Quantum Access MAX
www.ietltd.com Proudly serving laboratories worldwide since 1979 CALL +847.913.0777 for Refurbished & Certified Lab Equipment Thermo Scientific TSQ Quantum Access MAX UNSURPASSED PRICE TO PERFORMANCE Superior
More informationTrastuzumab Glycan Batch-to-Batch Profiling using a UPLC/FLR/Mass Spectrometry Platform
Trastuzumab Glycan Batch-to-Batch Profiling using a UPLC/FLR/Mass Spectrometry Platform Ying Qing Yu, Joomi Ahn, and Martin Gilar Waters Corporation, Milford, MA, U.S. APPLICATION BENEFITS Used together,
More informationquantitate host cell DNA with high sensitivity and throughput resdnaseq Host Cell DNA Quantitation Systems: CHO, E.
quantitate host cell DNA with high sensitivity and throughput resdnaseq Host Cell DNA Quantitation Systems: CHO, E. coli, Vero, NS0 Precision counts Integrated real-time qpcr systems for quantitation of
More informationThermo Scientific Proteomics & Metabolomics Seminar Tour
Proteomics & Seminar Tour Ignite your workflows with our with Cutting Edge LC-MS Technology Stop by to learn the latest advances in mass spectrometry workflows, technologies launched at 2012 ASMS and talk
More informationInvestigation of Solid Phase Microextraction as an Alternative to Dried Blood Spot
Investigation of Solid Phase Microextraction as an Alternative to Dried Blood Spot Craig Aurand and Robert Shirey Supelco, Div. of Sigma-Aldrich Bellefonte, PA 16823 USA T414068 sigma-aldrich.com/analytical
More informationKinetics Review. Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets)
Quiz 1 Kinetics Review Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets) I will post the problems with solutions on Toolkit for those that can t make
More informationApplication of a Mass Spectrometry Based Multi-Attribute-Method (MAM) for QC Release and Stability Testing of Protein Therapeutics
Application of a Mass Spectrometry Based Multi-Attribute-Method (MAM) for QC Release and Stability Testing of Protein Therapeutics Tamer Eris, Principal Scientist Process Development Amgen, Thousand Oaks,
More informationThank you for joining us! Our Webinar will begin shortly.
Practical Considerations for LC/MS Bioanalysis of Proteins via the Surrogate Peptide Approach Thank you for joining us! Our Webinar will begin shortly. While you are waiting, please feel free to browse
More informationThermo Scientific Mass Spectrometric Immunoassay (MSIA) Pipette Tips. Next generation immunoaffinity. Robust quantitative platform
Thermo Scientific Mass Spectrometric Immunoassay (MSIA) Pipette Tips Next generation immunoaffinity Robust quantitative platform Immunoaffinity sample preparation Thermo Scientific Mass Spectrometric Immunoassay
More informationPurification: Step 1. Lecture 11 Protein and Peptide Chemistry. Cells: Break them open! Crude Extract
Purification: Step 1 Lecture 11 Protein and Peptide Chemistry Cells: Break them open! Crude Extract Total contents of cell Margaret A. Daugherty Fall 2003 Big Problem: Crude extract is not the natural
More informationPurification: Step 1. Protein and Peptide Chemistry. Lecture 11. Big Problem: Crude extract is not the natural environment. Cells: Break them open!
Lecture 11 Protein and Peptide Chemistry Margaret A. Daugherty Fall 2003 Purification: Step 1 Cells: Break them open! Crude Extract Total contents of cell Big Problem: Crude extract is not the natural
More informationSuperdex 200 Increase columns
GE Healthcare Life Sciences Data file 29-452-69 AA Size exclusion chromatography Superdex 2 Increase columns Superdex 2 Increase prepacked columns (Fig 1) are designed for size exclusion chromatography
More informationMonoclonal Antibody Charge Variants: Origins, Physicochemical Characterization, and Pharmacokinetics
Monoclonal Antibody Charge Variants: Origins, Physicochemical Characterization, and Pharmacokinetics Paul Motchnik Protein Analytical Chemistry Genentech, South San Francisco, CA January 10, 2011 Washington,
More information