Rapidly Characterize Antibody- Drug Conjugates and Derive Drug-to-Antibody Ratios Using LC/MS

Size: px
Start display at page:

Download "Rapidly Characterize Antibody- Drug Conjugates and Derive Drug-to-Antibody Ratios Using LC/MS"

Transcription

1 Rapidly Characterize Antibody- Drug Conjugates and Derive Drug-to-Antibody Ratios Using LC/MS Ning Tang, Ph.D. Agilent Technologies Santa Clara, California, USA

2 Heterogeneity in ADCs Complexity T-DM1 (Genentech) ADC Disulfide shuffling Pyroglutamate mab Drug Deamidation Oxidation Fragmentation Glycosylation (G0, G1, G2) Truncation (Lys 0, 1, 2) Heterogeneity in ADC - More complex than mabs alone - Dependent on linker & payload stability (hydrolysis, degradation, etc.) - Dependent on the conjugation chemistry

3 Mass Spectrometry Always Separate Different Drug Conjugates MS also provides information on relative amounts of antibodies loaded with 1, 2, 3, 4 etc. drugs (without prior separation) MS also provides information on unconjugated antibody MS can detect other conjugation products, e.g. - Cross linked species - Species with linker attached but no drug

4 Agilent DAR Characterization Workflow LC/MS DAR Calculation Report ADC Sample Prep Reduction Deglycosylation LC/MS DAR Calculation Report ADC ADC purification from serum LC/MS DAR Calculation Report ADC Sample Prep Digestion Clean up LC/MS/MS Payload Mapping Report

5 LC/MS Setup LC: Agilent 1290 UHPLC MS: Agilent 6550 ifunnel Q-TOF Column: Agilent PLRP-S 1000A 8 µm 150 x 2.1 mm Column temp: 80 C Flow rate: 0.4 ml/min

6 Conjugation Adds Heterogeneity DAR1 DAR2 DAR3 DAR4 DAR5 DAR6 DAR7 DAR8

7 MassHunter ADC DAR Calculator Automatic calculation of DAR value Intuitive peak integration Built-in support for intact and reduced ADCs Easy analysis of different types of ADC molecules (Lyslinked, Cys-linked and site-specific ADCs) Flexible control to define peaks of interest Dedicated ADC DAR report in PDF and MS Word

8 Intact ADC DAR Calculation calculated DAR DAR peak list shows all components and % area for each species

9 Automated Workflow for Deglycosylation & Reduction in DAR Characterization

10 Reduced ADC DAR Calculation heavy chain light chain

11 Making these technologies accessible A front-end to LC and LC/MS systems that allows investigators to submit samples without being experts in the technology with few instrument specialists who are responsible for multiple systems 11

12 MassHunter Walkup: 3 Step Sample Submission 12

13 MassHunter Walkup: 3 Step Sample Submission 13

14 MassHunter Walkup: 3 Step Sample Submission 14

15 MassHunter Walkup: 3 Step Sample Submission 15

16 DAR Calculation Automation Workflow in Walkup ADC = Antibody Drug Conjugates DAR = Drug Antibody Ratio

17 ADC DAR Determination Workflow for Serum Samples SA- W SA- W Sample Preparation LC/MS DAR Calculation

18 Affinity Purified T-DM1 at 6 Different Loading Amounts AF-1000 ng; ~80ng on column. AF-125 ng; ~10ng on column DAR=3. DAR=3.5 5 DAR=3.5 AF-500 ng; ~40ng on column. AF-62.5 ng; ~5ng on column DAR=3.5 DAR=3.5 AF-250 ng; ~20ng on column. AF ng; ~2.5ng on column. DAR=3.5 DAR=3.4

19 Reproducibility of Affinity Purified T-DM1 at 6 Different Loading Amounts AF: Affinity purified AF-1000 ng; ~80ng on column. AF-500 ng; ~40ng on column. AF-250 ng; ~20ng on column. AF-125 ng; ~10ng on column AF-62.5 ng; ~5ng on column AF ng; ~2.5ng on column.

20 ADC Peptide Mapping Workflow Using AssayMAP Bravo and LC/MS/MS Sample Preparation LC/MS BioConfirm

21 Identification of Conjugated Peptides A T-DM1 20X Herceptin B EIC: T-DM1 Herceptin

22 Signature Elution Pattern and Fragment Ions A LTVDK[ ]SR B b 2 y 2 2+ y 5 y y y b 2 -H O 2 b 3 -H O 2 Drug Fragments C Precursor Drug Fragment GPSVFPLAPSSK[ ] STSGGTAALGCLVK y ion b ion D y 1 x b 4 -H O b 5 -H O Counts vs. Mass-to-Charge (m/z) Drug Fragments b 5 y 5 y 6 b 7 y 7 b 8 y 8 y 11

23 Sequence Coverage and Conjugation Sites Identification Light Chain DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGS RSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTAS VVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC Heavy Chain EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADS VKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKG PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV TVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPG K: Confirmed drug Identified conjugation sequence site (Light-9; Heavy 20) K: Potential drug conjugation site (Heavy 5) K: Unconjugated site identified (Light 4; Heavy 6) Total (Light-13; Heavy31)

24 Summary Determining ADC DAR is an important aspect of ADC characterization Workflow can be enabled in various ways New DAR calculator makes obtaining DAR value easy and straight forward Sample preparation can be streamlined and automated using the AssayMAP Bravo platform for reproducibility and scalability Localization of conjugation sites can be achieved by digesting the protein and analyzing by LC/MS/MS

25 Acknowledgments Application development Jing Chen Alex Zhu Ravindra Gudihal Steve Murphy Maryann Shen Software development Tanner Stevenson Robert Williams

26 Thank you for your attention! To learn more about Agilent s Biopharma Solutions, follow us on LinkedIn at

Precise Characterization of Intact Monoclonal Antibodies by the Agilent 6545XT AdvanceBio LC/Q-TOF

Precise Characterization of Intact Monoclonal Antibodies by the Agilent 6545XT AdvanceBio LC/Q-TOF Precise Characterization of Intact Monoclonal Antibodies by the Agilent 6545XT AdvanceBio LC/Q-TOF Application Note Author David L. Wong Agilent Technologies, Inc. Santa Clara, CA, USA Introduction Monoclonal

More information

PLRP-S Polymeric Reversed-Phase Column for LC/MS Separation of mabs and ADC

PLRP-S Polymeric Reversed-Phase Column for LC/MS Separation of mabs and ADC PLRP-S Polymeric Reversed-Phase Column for LC/MS Separation of mabs and ADC Analysis of Intact and Fragmented mabs and ADC Application Note Biotherapeutics and Biologics Author Suresh Babu C.V. Agilent

More information

Size Exclusion Chromatography/ Mass Spectrometry Analysis of Antibody Drug Conjugates Using the Agilent 1260 Infinity II Bio-Inert LC

Size Exclusion Chromatography/ Mass Spectrometry Analysis of Antibody Drug Conjugates Using the Agilent 1260 Infinity II Bio-Inert LC Size Exclusion Chromatography/ Mass Spectrometry Analysis of Antibody Drug Conjugates Using the Agilent 126 Infinity II Bio-Inert LC Application Note Biologics & Biosimilars Author Sonja Schneider Agilent

More information

BioConfirm B Presentation

BioConfirm B Presentation BioConfirm B.08.00 Presentation 1 Major Enhancements to Increase Your Productivity The Latest Version of our BioConfirm Product, B.08.00 BioConfirm is protein and peptide characterization software using

More information

Antibody-drug Conjugates: Characterization and Control Strategies of Lysine-linked Products

Antibody-drug Conjugates: Characterization and Control Strategies of Lysine-linked Products Antibody-drug Conjugates: Characterization and Control Strategies of Lysine-linked Products Fred Jacobson Protein Analytical Chemistry Genentech, Inc. CASSS CMC Strategy Forum Japan 2013 December 9-10,

More information

Highly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs

Highly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs Technical Overview Highly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs Authors Stephen Madden, Crystal Cody, and Jungkap Park Agilent Technologies, Inc. Santa Clara, California,

More information

Utilizing novel technology for the analysis of therapeutic antibodies and host cell protein contamination

Utilizing novel technology for the analysis of therapeutic antibodies and host cell protein contamination Utilizing novel technology for the analysis of therapeutic antibodies and host cell protein contamination Kelli Jonakin, Ph.D. Senior Field Application Scientist, Seattle, WA Eric Johansen, Ph.D. Senior

More information

Intelligent Disulfide Bond Analysis

Intelligent Disulfide Bond Analysis Intelligent Disulfide Bond Analysis Why Study Disulfide Bonds? Save Money by making cell cultures more efficient! Regulations Process Control Higher Quality biotherapeutics Efficacy Protect from Competition

More information

mabs and ADCs analysis by RP

mabs and ADCs analysis by RP mabs and ADCs analysis by RP Shanhua Lin, Ph.D. The world leader in serving science Protein and mab Separation by HPLC Size difference? YES Size Exclusion Chromatography (SEC) MAbPac SEC-1 NO NO Charge

More information

The clearly better choice

The clearly better choice Agilent Accurate-Mass 6500 Series Q-TOF and 600 Series TOF LC/MS Systems The clearly better choice in TOF and Q-TOF LC/MS Our measure is your success. products applications soft ware services The unmatched

More information

Proteins. Patrick Boyce Biopharmaceutical Marketing Manager Waters Corporation 1

Proteins. Patrick Boyce Biopharmaceutical Marketing Manager Waters Corporation 1 Routine Characterization of mabs and Other Proteins Patrick Boyce Biopharmaceutical Marketing Manager Europe and India 2011 Waters Corporation 1 Agenda Why? What scientific challenges? Technology Example

More information

Characterize Fab and Fc Fragments by Cation-Exchange Chromatography

Characterize Fab and Fc Fragments by Cation-Exchange Chromatography Characterize Fab and Fc Fragments by Cation-Exchange Chromatography Application Note Biologics and Biosimilars Authors Isabel Vandenheede, Emmie Dumont, Pat Sandra, and Koen Sandra Research Institute for

More information

Peptide Mapping of Glycoprotein Erythropoietin by HILIC LC/MS and RP-LC/MS

Peptide Mapping of Glycoprotein Erythropoietin by HILIC LC/MS and RP-LC/MS Peptide Mapping of Glycoprotein Erythropoietin by HILIC LC/MS and RP-LC/MS Application Note BioPharma Authors Alex Zhu, James Martosella, and Phu T Duong Agilent Technologies, Inc Introduction Peptide

More information

Characterization of Glycosylation in the Fc Region of Therapeutic Recombinant Monoclonal Antibody

Characterization of Glycosylation in the Fc Region of Therapeutic Recombinant Monoclonal Antibody Characterization of Glycosylation in the Fc Region of Therapeutic Recombinant Monoclonal Antibody Application Note BioPharma Authors James Martosella, Phu Duong, and Alex Zhu Agilent Technologies, Inc.

More information

Application Note. Kwasi Antwi, Amanda Ribar, Urban A. Kiernan, and Eric E. Niederkofler Thermo Fisher Scientific, Tempe, Arizona

Application Note. Kwasi Antwi, Amanda Ribar, Urban A. Kiernan, and Eric E. Niederkofler Thermo Fisher Scientific, Tempe, Arizona Analysis of an Antibody Drug Conjugate using MSIA D.A.R.T. S. Technology, an Integral Part of Ligand Binding Mass Spectrometric Immunoassay (LB-MSIA) Workflow Application Note Kwasi Antwi, Amanda Ribar,

More information

Maximizing Chromatographic Resolution of Peptide Maps using UPLC with Tandem Columns

Maximizing Chromatographic Resolution of Peptide Maps using UPLC with Tandem Columns Maximizing Chromatographic Resolution of Peptide Maps using UPLC with Tandem Columns Hongwei Xie, Martin Gilar, and Jeff Mazzeo Waters Corporation, Milford, MA U.S. APPLICATION BENEFITS The ACQUITY UPLC

More information

UNIFI: an innovative enabling platform Ken Eglinton Nordic User Training, September 2013

UNIFI: an innovative enabling platform Ken Eglinton Nordic User Training, September 2013 UNIFI: an innovative enabling platform Ken Eglinton Nordic User Training, September 2013 2013 Waters Corporation 1 Waters Laboratory Informatics Product Portfolio MassLynx Mass Spectrometry Software NuGenesis

More information

Application Note. Author. Abstract. Biotherapeutics and Biologics. Sonja Schneider Agilent Technologies, Inc. Waldbronn, Germany

Application Note. Author. Abstract. Biotherapeutics and Biologics. Sonja Schneider Agilent Technologies, Inc. Waldbronn, Germany D-LC/MS Characterization of Charge Variants Using Ion Exchange and Reversed-Phase Chromatography Multiple Heart-Cutting D-LC Analysis of Innovator versus Biosimilar Monoclonal Antibodies Application Note

More information

Advanced QA/QC characterization MS in QC : Multi Attribute Method

Advanced QA/QC characterization MS in QC : Multi Attribute Method Advanced QA/QC characterization MS in QC : Multi Attribute Method Global BioPharma Summit The world leader in serving science A Complex Problem: Drug Safety and Quality Safety Is the product safe to use?

More information

N-Glycan Profiling Analysis of a Monoclonal Antibody Using UHPLC/FLD/Q-TOF

N-Glycan Profiling Analysis of a Monoclonal Antibody Using UHPLC/FLD/Q-TOF N-Glycan Profiling Analysis of a Monoclonal Antibody Using UHPLC/FLD/Q-TOF Application Note Authors Xianming Liu, Wei Zhang, Yi Du, Sheng Yin, Hong Que, and Weichang Zhou WuXi AppTec iopharmaceuticals

More information

Algorithm for Matching Additional Spectra

Algorithm for Matching Additional Spectra Improved Methods for Comprehensive Sample Analysis Using Protein Prospector Peter R. Baker 1, Katalin F. Medzihradszky 1 and Alma L. Burlingame 1 1 Mass Spectrometry Facility, Dept. of Pharmaceutical Chemistry,

More information

Monoclonal Antibody Characterization on Q Exactive and Oribtrap Elite. Yi Zhang, Ph.D Senior Proteomic Marketing Specialist Oct.

Monoclonal Antibody Characterization on Q Exactive and Oribtrap Elite. Yi Zhang, Ph.D Senior Proteomic Marketing Specialist Oct. Monoclonal Antibody Characterization on Q Exactive and Oribtrap Elite Yi Zhang, Ph.D Senior Proteomic Marketing Specialist Oct. 12, 211 Outline Orbitrap Mass Spectrometer in mab Characterization Intact

More information

High-Throughput Peptide Mapping with the Vanquish UHPLC System and the Q Exactive HF Mass Spectrometer

High-Throughput Peptide Mapping with the Vanquish UHPLC System and the Q Exactive HF Mass Spectrometer High-Throughput Peptide Mapping with the Vanquish UHPLC System and the Q Exactive HF Mass Spectrometer Martin Samonig 1, Kai Scheffler 2, Remco Swart 1, and Jonathan Josephs 3 1 Thermo Fisher Scientific,

More information

Tony Mire-Sluis Vice President, Corporate, Product and Device Quality Amgen Inc

Tony Mire-Sluis Vice President, Corporate, Product and Device Quality Amgen Inc The Regulatory Implications of the ever increasing power of Mass Spectrometry and its role in the Analysis of Biotechnology Products Where do we draw the line? Tony Mire-Sluis Vice President, Corporate,

More information

Peptide Mapping: A Quality by Design (QbD) Approach

Peptide Mapping: A Quality by Design (QbD) Approach Peptide Mapping: A Quality by Design (QbD) Approach Application Note Bio-Pharmaceutical Authors Sreelakshmy Menon and Suresh babu C.V. Agilent Technologies, Inc. Richard Verseput S-Matrix Corporation Abstract

More information

Disulfide Linkage Analysis of IgG1 using an Agilent 1260 Infinity Bio inert LC System with an Agilent ZORBAX RRHD Diphenyl sub 2 µm Column

Disulfide Linkage Analysis of IgG1 using an Agilent 1260 Infinity Bio inert LC System with an Agilent ZORBAX RRHD Diphenyl sub 2 µm Column Disulfide Linkage Analysis of IgG1 using an Agilent 126 Infinity Bio inert LC System with an Agilent ZORBAX RRHD Diphenyl sub 2 µm Column Application Note Biotherapeutics & Biosimilars Author M. Sundaram

More information

HDX-MS at Waters Waters Corporation 1

HDX-MS at Waters Waters Corporation 1 HDX-MS at Waters 2011 Waters Corporation 1 Hydrogen Deuterium Exchange MS systems Dedicated standards and UPLC BEH separation chemistries nanoacquity UPLC with HDX technology Xevo G2-S QTof MS and Synapt

More information

Developing Robust and Efficient IEX Methods for Charge Variant Analysis of Biotherapeutics Using ACQUITY UPLC H-Class System and Auto Blend Plus

Developing Robust and Efficient IEX Methods for Charge Variant Analysis of Biotherapeutics Using ACQUITY UPLC H-Class System and Auto Blend Plus Developing Robust and Efficient IEX Methods for Charge Variant Analysis of Biotherapeutics Using ACQUITY UPLC H-Class System and Auto Blend Plus Robert Birdsall, Thomas Wheat, and Weibin Chen Waters Corporation,

More information

Application Note. Authors. Abstract

Application Note. Authors. Abstract Automated, High Precision Tryptic Digestion and SISCAPA-MS Quantification of Human Plasma Proteins Using the Agilent Bravo Automated Liquid Handling Platform Application Note Authors Morteza Razavi, N.

More information

Cell Clone Selection Using the Agilent Bio-Monolith Protein A Column and LC/MS

Cell Clone Selection Using the Agilent Bio-Monolith Protein A Column and LC/MS Cell Clone Selection Using the Agilent Bio-Monolith Protein A Column and LC/MS Application Note Biopharmaceuticals and Biosimilars Authors Emmie Dumont, Isabel Vandenheede, Pat Sandra, Koen Sandra Research

More information

Thermo Scientific BioLC Columns. Monoclonal antibody. characterization

Thermo Scientific BioLC Columns. Monoclonal antibody. characterization Thermo Scientific BioLC Columns Monoclonal antibody characterization Innovative technologies and workflows for increasing productivity and throughput Table of Contents Characterization of Monoclonal Antibodies

More information

Thermo Scientific Peptide Mapping Workflows. Upgrade Your Maps. Fast, confident and more reliable peptide mapping.

Thermo Scientific Peptide Mapping Workflows. Upgrade Your Maps. Fast, confident and more reliable peptide mapping. Thermo Scientific Peptide Mapping Workflows Upgrade Your Maps Fast, confident and more reliable peptide mapping. Smarter Navigation... Peptide mapping is a core analytic in biotherapeutic development.

More information

SMART Digest Kit User Manual. Version 2

SMART Digest Kit User Manual. Version 2 SMART Digest Kit User Manual Version 2 XX21543 Revision A August 2016 SMART Digest Kit Delivering simple, fast and reproducible digestion of proteins Thermo Scientific SMART Digest kits are designed for

More information

Analysis of Intact and C-terminal Digested IgG1 on an Agilent Bio MAb 5 µm Column

Analysis of Intact and C-terminal Digested IgG1 on an Agilent Bio MAb 5 µm Column Analysis of Intact and C-terminal Digested IgG1 on an Agilent Bio MAb µm Column Application Note BioPharma Authors Xiaomi Xu and Phu T Duong Agilent Technologies, Inc. Abstract Nearly all proteins undergo

More information

Generating Automated and Efficient LC/MS Peptide Mapping Results with the Biopharmaceutical Platform Solution with UNIFI

Generating Automated and Efficient LC/MS Peptide Mapping Results with the Biopharmaceutical Platform Solution with UNIFI with the Biopharmaceutical Platform Solution with UNIFI Vera B. Ivleva, Ying Qing Yu, Scott Berger, and Weibin Chen Waters Corporation, Milford, MA, USA A P P L I C AT ION B E N E F I T S The ability to

More information

Confident Pesticides Analysis with the Agilent LC/Triple Quadrupole and TOF/QTOF Solutions

Confident Pesticides Analysis with the Agilent LC/Triple Quadrupole and TOF/QTOF Solutions Confident Pesticides Analysis with the Agilent LC/Triple Quadrupole and TOF/QTOF Solutions Screening and Confirmation Chemical Analysis Solution Unit November, 2009 Page 1 Agilent s New 6540 Ultra High

More information

Asish Chakraborty, St John Skilton, Weibin Chen and John C. Gebler Waters Corporation, Milford, MA, U.S. INTRODUCTION METHODS. Sample preparation

Asish Chakraborty, St John Skilton, Weibin Chen and John C. Gebler Waters Corporation, Milford, MA, U.S. INTRODUCTION METHODS. Sample preparation Com p r e h ensiv e a n d Rou t in e C ha r ac t e riz at io n o f P rot eins a n d P e p t i d e s by LC/MS and LC/MS E Asish Chakraborty, St John Skilton, Weibin Chen and John C. Gebler Waters Corporation,

More information

FPO. BioPharma Compass 2.0. Innovation with Integrity. Accelerate Biopharmaceutical Analysis. Software

FPO. BioPharma Compass 2.0. Innovation with Integrity. Accelerate Biopharmaceutical Analysis. Software FPO BioPharma Compass 2.0 Accelerate Biopharmaceutical Analysis Innovation with Integrity Software Developed with the Biopharma Industry Award-winning biopharmaceutical analysis platform Commercial and

More information

Fast and High-Resolution Reversed-Phase Separation of Synthetic Oligonucleotides

Fast and High-Resolution Reversed-Phase Separation of Synthetic Oligonucleotides Fast and High-Resolution Reversed-Phase Separation of Synthetic Oligonucleotides High-pH-stable, superficially porous particle columns for LC/UV and LC/MS Application Note Biologics and Biosimilars Authors

More information

Rapid Peptide Mapping via Automated Integration of On-line Digestion, Separation and Mass Spectrometry for the Analysis of Therapeutic Proteins

Rapid Peptide Mapping via Automated Integration of On-line Digestion, Separation and Mass Spectrometry for the Analysis of Therapeutic Proteins Rapid Peptide Mapping via Automated Integration of On-line Digestion, Separation and Mass Spectrometry for the Analysis of Therapeutic Proteins Esther Lewis, 1 Kevin Meyer, 2 Zhiqi Hao, 1 Nick Herold,

More information

Optimization of ADC Process Development. Eric LACOSTE PhD, Chemistry and Biotechnology Development Sanofi Aventis R&D, Vitry sur Seine, France 2016

Optimization of ADC Process Development. Eric LACOSTE PhD, Chemistry and Biotechnology Development Sanofi Aventis R&D, Vitry sur Seine, France 2016 Optimization of ADC Process Development Eric LACOSTE PhD, Chemistry and Biotechnology Development Sanofi Aventis R&D, Vitry sur Seine, France 2016 Strictly confidential do not distribute without prior

More information

Monoclonal Antibody Characterization Achieving Higher Throughput and Productivity

Monoclonal Antibody Characterization Achieving Higher Throughput and Productivity Monoclonal Antibody Characterization Achieving Higher Throughput and Productivity Dionex Solutions to Accelerate Monoclonal Antibody R&D and Characterization The throughput and productivity challenge Increasing

More information

Fraction Analysis of Cysteine Linked Antibody-Drug Conjugates Using Hydrophobic Interaction. chromatography. Agilent 1260 Infinity II Bio-Inert System

Fraction Analysis of Cysteine Linked Antibody-Drug Conjugates Using Hydrophobic Interaction. chromatography. Agilent 1260 Infinity II Bio-Inert System Application Note Biologics & Biosimilars Fraction Analysis of Cysteine Linked Antibody-Drug Conjugates Using Hydrophobic Interaction Chromatography Agilent 126 Infinity II Bio-Inert System 7 6 5 4 5. 7.5

More information

rapiflex Innovation with Integrity Designed for Molecules that Matter. MALDI TOF/TOF

rapiflex Innovation with Integrity Designed for Molecules that Matter. MALDI TOF/TOF rapiflex Designed for Molecules that Matter. Innovation with Integrity MALDI TOF/TOF rapiflex TM The first MALDI-TOF/TOF that adapts to your needs. The rapiflex is the most advanced MALDI TOF/TOF system

More information

A Unique LC-MS Assay for Host Cell Proteins(HCPs) ) in Biologics

A Unique LC-MS Assay for Host Cell Proteins(HCPs) ) in Biologics A Unique LC-MS Assay for Host Cell Proteins(HCPs) ) in Biologics Catalin Doneanu,, Ph.D. Biopharmaceutical Sciences, Waters September 16, 2009 Mass Spec 2009 2009 Waters Corporation Host Cell Proteins

More information

ADVANCE ACCURACY AND PRODUCTIVITY FOR FASTER ANALYSIS

ADVANCE ACCURACY AND PRODUCTIVITY FOR FASTER ANALYSIS Agilent AdvanceBio Columns ADVANCE ACCURACY AND PRODUCTIVITY FOR FASTER ANALYSIS with Agilent ZORBAX RRHD 3Å 1.8 µm columns ns Rapid resolution high definition columns for UHPLC protein and peptide separations

More information

Reversed Phase Solutions for the Analysis of Proteins, Peptides, and Oligonucleotides

Reversed Phase Solutions for the Analysis of Proteins, Peptides, and Oligonucleotides Reversed Phase Solutions for the Analysis of Proteins, Peptides, and Oligonucleotides The line, which includes and Proteo, offers various reversed phase solutions for biochromatography. With these two

More information

Thermo Scientific Solutions for Intact-Protein Analysis. Better, Faster Decisions for. Biotherapeutic Development

Thermo Scientific Solutions for Intact-Protein Analysis. Better, Faster Decisions for. Biotherapeutic Development Thermo Scientific Solutions for Intact-Protein Analysis Better, Faster Decisions for Biotherapeutic Development Quickly and Accurately Assess Product Quality and Safety Therapeutic proteins and monoclonal

More information

Development and Characterization of Multi-Platform Antibody Drug Conjugates

Development and Characterization of Multi-Platform Antibody Drug Conjugates Development and Characterization of Multi-Platform Antibody Drug Conjugates Jason A. Starkey Senior Principal Scientist - BioTherapeutics Pharmaceutical Sciences Pfizer, Inc. This document provides an

More information

CaptiveSpray nanobooster

CaptiveSpray nanobooster CaptiveSpray nanobooster The Revolution in Proteomics Ionization Innovation with Integrity LC-MS Source The Key to Performance and Reliability for nano flow MS Bruker CaptiveSpray principle: Stable and

More information

Improved Peptide Maps Using Core-Shell Media: Explaining Better Biopharmaceutical Applications With Kinetex C18 Columns

Improved Peptide Maps Using Core-Shell Media: Explaining Better Biopharmaceutical Applications With Kinetex C18 Columns Improved Peptide Maps Using Core-Shell Media: Explaining Better Biopharmaceutical Applications With Kinetex C18 Columns Michael McGinley, Jeff Layne, and Vita Knudson Phenomenex, Inc., 411 Madrid Ave.,Torrance,

More information

Proudly serving laboratories worldwide since 1979 CALL for Refurbished & Certified Lab Equipment QTRAP 5500

Proudly serving laboratories worldwide since 1979 CALL for Refurbished & Certified Lab Equipment QTRAP 5500 www.ietltd.com Proudly serving laboratories worldwide since 1979 CALL +847.913.0777 for Refurbished & Certified Lab Equipment QTRAP 5500 Powerful synergy results when the world s most sensitive triple

More information

Why do LC MS and LBA

Why do LC MS and LBA Why do LC MS and LBA results differ? A literature evaluation 18 November 2015 Nico van de Merbel An overview In most published BA methods for large molecules, no comparison of platforms (LBA vs LBA, LBA

More information

Method Development Considerations for Reversed-Phase Protein Separations

Method Development Considerations for Reversed-Phase Protein Separations Method Development Considerations for Reversed-Phase Protein Separations Hillary B. Hewitson, Thomas E. Wheat, Paula Hong, Kenneth J. Fountain APPLICATION BENEFITS n The BEH00 C 4 chemistry is available

More information

A Generic Kit-Based Approach for Quantifying Monoclonal Antibody Drugs Through Direct Digestion of Discovery Study Samples

A Generic Kit-Based Approach for Quantifying Monoclonal Antibody Drugs Through Direct Digestion of Discovery Study Samples A Generic Kit-Based Approach for Quantifying Monoclonal Antibody Drugs Through Direct Digestion of Discovery Study Samples Mary Lame, Hua Yang, Sherri Naughton, and Erin Chambers Waters Corporation, Milford,

More information

Agilent BioHPLC Columns PROTEIN IDENTIFICATION AND IMPURITY PROFILING USING REVERSED-PHASE HPLC/UHPLC

Agilent BioHPLC Columns PROTEIN IDENTIFICATION AND IMPURITY PROFILING USING REVERSED-PHASE HPLC/UHPLC Agilent BioHPLC Columns PROTEIN IDENTIFICATION AND IMPURITY PROFILING USING REVERSED-PHASE HPLC/UHPLC REVERSED-PHASE HPLC/UHPLC Agilent can boost your accuracy and productivity Reversed-phase is used to

More information

Xevo G2-S QTof and TransOmics: A Multi-Omics System for the Differential LC/MS Analysis of Proteins, Metabolites, and Lipids

Xevo G2-S QTof and TransOmics: A Multi-Omics System for the Differential LC/MS Analysis of Proteins, Metabolites, and Lipids Xevo G2-S QTof and TransOmics: A Multi-Omics System for the Differential LC/MS Analysis of Proteins, Metabolites, and Lipids Ian Edwards, Jayne Kirk, and Joanne Williams Waters Corporation, Manchester,

More information

Rapid Peptide Catabolite ID using the SCIEX Routine Biotransform Solution

Rapid Peptide Catabolite ID using the SCIEX Routine Biotransform Solution Rapid Peptide Catabolite ID using the SCIEX Routine Biotransform Solution Rapidly Identify Major Catabolites with the SCIEX X500R QTOF System and MetabolitePilot TM 2.0 Software Ian Moore and Jinal Patel

More information

UNIFI: The user environment Ken Eglinton Nordic User Training, September 2013

UNIFI: The user environment Ken Eglinton Nordic User Training, September 2013 UNIFI: The user environment Ken Eglinton Nordic User Training, September 2013 2013 Waters Corporation 1 What is UNIFI? Single Platform for Chromatography, Mass Spectrometry, Data Management and Laboratory

More information

Application Note. Authors. Abstract. Clinical Research

Application Note. Authors. Abstract. Clinical Research Workflow Automation for LC/MS: In-Solution Protein Digestion, Peptide Cleanup, and Strong Cation-Exchange Fractionation of Peptides Enabled by AssayMAP Technology Application Note Clinical Research Authors

More information

Stability of Biological Products

Stability of Biological Products Stability of Biological Products Dr Jurgen Lindner Principal, BioPharma Consulting & Executive Secretary, APIMAA Biological Products Functional Proteins or Polypeptides (mab s, enzymes & inhibitors, growth

More information

MBios 478: Mass Spectrometry Applications [Dr. Wyrick] Slide #1. Lecture 25: Mass Spectrometry Applications

MBios 478: Mass Spectrometry Applications [Dr. Wyrick] Slide #1. Lecture 25: Mass Spectrometry Applications MBios 478: Mass Spectrometry Applications [Dr. Wyrick] Slide #1 Lecture 25: Mass Spectrometry Applications Measuring Protein Abundance o ICAT o DIGE Identifying Post-Translational Modifications Protein-protein

More information

High Sequence Coverage Peptide Mapping of a Monoclonal Antibody

High Sequence Coverage Peptide Mapping of a Monoclonal Antibody High Sequence Coverage Peptide Mapping of a Monoclonal Antibody with UPLC/MS E Hongwei Xie, Martin Gilar, and John C. Gebler Waters Corporation, Milford, MA, U.S.A. INT RODUCTION Monoclonal antibodies

More information

EPA Method 543: Selected Organic Contaminants by Online SPE LC/MS/MS Using the Agilent Flexible Cube

EPA Method 543: Selected Organic Contaminants by Online SPE LC/MS/MS Using the Agilent Flexible Cube EPA Method 543: Selected Organic Contaminants by Online SPE LC/MS/MS Using the Agilent Flexible Cube Application Note Environmental Authors Don Noot, Ralph Hindle Vogon Laboratory Services Cochrane, AB

More information

MassPREP On-Line Desalting Cartridge

MassPREP On-Line Desalting Cartridge CONTENTS I. INTRODUCTION II. INSTALLING THE MASSPREP ON-LINE DESALTING CARTRIDGE INTO THE SENTRY.1 X 1 MM GUARD COLUMN HOLDER III. RECOMMENDED LC/MS SYSTEM CONFIGURATION TO MINIMIZE MS SOURCE CONTAMINATION

More information

Featuring Analyst software under Windows NT for enhanced performance and ease of use. API 150EX. LC/MS System

Featuring Analyst software under Windows NT for enhanced performance and ease of use. API 150EX. LC/MS System Featuring Analyst software under Windows NT for enhanced performance and ease of use. API 15EX LC/MS System compact, rugged, The API 15EX LC/MS System is the most rugged and reliable single quadrupole

More information

Using accurate mass LC/MS/MS in forensic toxicology screening

Using accurate mass LC/MS/MS in forensic toxicology screening Using accurate mass LC/MS/MS in forensic toxicology screening Dr Simon Elliott Consultant Forensic Toxicologist (ROAR) Forensics Ltd Malvern Hills Science Park, Geraldine Rd, Malvern, Worcestershire, WR14

More information

Rapid Soft Spot Analysis using the SCIEX Routine Biotransform Solution

Rapid Soft Spot Analysis using the SCIEX Routine Biotransform Solution Rapid Soft Spot Analysis using the SCIEX Routine Biotransform Solution Rapidly Identify Top Metabolites with the SCIEX X500R QTOF System and MetabolitePilot TM 2.0 Software Shaokun Pang and Ian Moore SCIEX,

More information

SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization

SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization APPLICATION NOTE Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization No. 1159 Authors: Martin Samonig 1, Alexander Schwahn 2, Ken Cook 3, Mike Oliver

More information

Využití cílené proteomiky pro kontrolu falšování potravin: identifikace peptidových markerů v mase pomocí LC- Q Exactive MS/MS

Využití cílené proteomiky pro kontrolu falšování potravin: identifikace peptidových markerů v mase pomocí LC- Q Exactive MS/MS Využití cílené proteomiky pro kontrolu falšování potravin: identifikace peptidových markerů v mase pomocí LC- Q Exactive MS/MS Michal Godula Ph.D. Thermo Fisher Scientific The world leader in serving science

More information

HIGHER IMPACT LC/MS DIAGNOSTICS AGILENT IN VITRO DIAGNOSTIC MEDICAL DEVICES FOR CLINICAL LABORATORIES

HIGHER IMPACT LC/MS DIAGNOSTICS AGILENT IN VITRO DIAGNOSTIC MEDICAL DEVICES FOR CLINICAL LABORATORIES HIGHER IMPACT LC/MS DIAGNOSTICS AGILENT IN VITRO DIAGNOSTIC MEDICAL DEVICES FOR CLINICAL LABORATORIES 2 AGILENT IN THE CLINIC THE PARTNER YOU TRUST Agilent s commitment to quality When a diagnosis is on

More information

The Role of Mass Spectrometry for Developing Biotherapeutics: Regulatory Perspectives

The Role of Mass Spectrometry for Developing Biotherapeutics: Regulatory Perspectives The Role of Mass Spectrometry for Developing Biotherapeutics: Regulatory Perspectives Jun Park, Ph.D. Division of Monoclonal Antibodies Office of Biotechnology Products CDER/FDA CASSS, Applications of

More information

A Complete Workflow Solution for Intact Monoclonal Antibody Characterization Using a New High-Performance Benchtop Quadrupole- Orbitrap LC-MS/MS

A Complete Workflow Solution for Intact Monoclonal Antibody Characterization Using a New High-Performance Benchtop Quadrupole- Orbitrap LC-MS/MS A Complete Workflow Solution for Intact Monoclonal Antibody Characterization Using a New High-Performance Benchtop Quadrupole- Orbitrap LC-MS/MS Zhiqi Hao, 1 Yi Zhang, 1 David Horn, 1 Seema Sharma, 1 Shiaw-Lin

More information

Pharmacokinetic Analysis of the mab Adalimumab by ELISA and Hybrid LBA/LC/MS: A Comparison Study

Pharmacokinetic Analysis of the mab Adalimumab by ELISA and Hybrid LBA/LC/MS: A Comparison Study Pharmacokinetic Analysis of the mab Adalimumab by ELISA and Hybrid LBA/LC/MS: A Comparison Study Featuring the SCIEX BioBA Solution Xi Qu 1, Shuyu Hou 1, Meghan McCann 1, Caroline Becker 1, Xun Wang 1,

More information

Intra-tumor Catabolites (fate of ADC) can Predict ADC Efficacy. Donglu Zhang, Ph.D. Genentech Feb 21, 2017 World ADC Berlin-2017

Intra-tumor Catabolites (fate of ADC) can Predict ADC Efficacy. Donglu Zhang, Ph.D. Genentech Feb 21, 2017 World ADC Berlin-2017 Intra-tumor Catabolites (fate of ADC) can Predict ADC Efficacy Donglu Zhang, Ph.D. Genentech Feb 21, 2017 World ADC Berlin-2017 1 Outline ADC structure and mechanism of action (MOA) Can we use PK or PK-PD

More information

Identification of Critical Product Quality Attributes: Impact of Product Variants on Safety and Efficacy

Identification of Critical Product Quality Attributes: Impact of Product Variants on Safety and Efficacy Identification of Critical Product Quality Attributes: Impact of Product Variants on Safety and Efficacy Ziping Wei, Ph.D. Analytical Biochemistry MedImmune January 25, 2010 Outline Why do we need to identify

More information

HPLC 2016 Short Courses

HPLC 2016 Short Courses HPLC 2016 Short Courses Two days of Educational Short Courses will be offered the Sunday and Monday preceding the conference. The courses are taught by leading academic and industrial scientists and cover

More information

Application Note. Author. Abstract. Biopharmaceuticals. Verified for Agilent 1260 Infinity II LC Bio-inert System. Sonja Schneider

Application Note. Author. Abstract. Biopharmaceuticals. Verified for Agilent 1260 Infinity II LC Bio-inert System. Sonja Schneider Combining small-scale purification and analysis of monoclonal antibodies on one instrument Protein purification with high-volume injection using the Agilent 126 Infinity Bio-inert Quaternary LC System

More information

phab Amine and Thiol Reactive Dyes for Antibody Internalization Studies Nidhi Nath, Ph.D. Group Leader, Protein Analysis Promega Corporation

phab Amine and Thiol Reactive Dyes for Antibody Internalization Studies Nidhi Nath, Ph.D. Group Leader, Protein Analysis Promega Corporation phab Amine and Thiol Reactive Dyes for Antibody Internalization Studies Nidhi Nath, Ph.D. Group Leader, Protein Analysis 1 Outline 1. phab Dyes 2. Protocols for conjugating phab Dyes to antibodies 3. Applications:

More information

Proteomics And Cancer Biomarker Discovery. Dr. Zahid Khan Institute of chemical Sciences (ICS) University of Peshawar. Overview. Cancer.

Proteomics And Cancer Biomarker Discovery. Dr. Zahid Khan Institute of chemical Sciences (ICS) University of Peshawar. Overview. Cancer. Proteomics And Cancer Biomarker Discovery Dr. Zahid Khan Institute of chemical Sciences (ICS) University of Peshawar Overview Proteomics Cancer Aims Tools Data Base search Challenges Summary 1 Overview

More information

Conjugated protein biotherapeutics

Conjugated protein biotherapeutics B i o P r o c e s s TECHNICAL Mass Spectrometric Conjugate Characterization Process Qualification of Recombinant Protein Hapten Conjugation Miao-Fang Lin, Margo Wilson, Michael V. Murray, and Greg W. Adams

More information

Pharma&Biotech. ADC Process Transfer from a CMO Perspective: How to Make a Collaboration Successful

Pharma&Biotech. ADC Process Transfer from a CMO Perspective: How to Make a Collaboration Successful Pharma&Biotech ADC Process Transfer from a CMO Perspective: How to Make a Collaboration Successful Additional Information and Disclaimer Lonza Group Ltd has its headquarters in Basel, Switzerland, and

More information

Regulatory Review Considerations of Drug-Linker Quality in ADCs

Regulatory Review Considerations of Drug-Linker Quality in ADCs Regulatory Review Considerations of Drug-Linker Quality in ADCs Xiao Hong Chen, Ph.D. Acting Quality Assessment Lead Division of New Drug Products I, Branch II ONDP/OPQ/CDER/FDA Outlines ADC IND submissions

More information

LabChip GXII: Antibody Analysis

LabChip GXII: Antibody Analysis WHITE PAPER LabChip GXII: Antibody Analysis Antibody Analysis using microfluidic technology in high throughput Quality by Design Experiments Abstract Current initiatives in Process Analytical Technology

More information

Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005

Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005 Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 9 September 005 Focus concept Purification of a novel seed storage protein allows sequence analysis and

More information

Biologics Bioanalysis

Biologics Bioanalysis Biologics Bioanalysis GUIDE TO INNOVATION Biologics Bioanalysis Guide to Innovation Pharmaceutical companies have leveraged advancements in basic science perhaps more than any other industry. With the

More information

Thermo Scientific TSQ Quantum Access MAX

Thermo Scientific TSQ Quantum Access MAX www.ietltd.com Proudly serving laboratories worldwide since 1979 CALL +847.913.0777 for Refurbished & Certified Lab Equipment Thermo Scientific TSQ Quantum Access MAX UNSURPASSED PRICE TO PERFORMANCE Superior

More information

Trastuzumab Glycan Batch-to-Batch Profiling using a UPLC/FLR/Mass Spectrometry Platform

Trastuzumab Glycan Batch-to-Batch Profiling using a UPLC/FLR/Mass Spectrometry Platform Trastuzumab Glycan Batch-to-Batch Profiling using a UPLC/FLR/Mass Spectrometry Platform Ying Qing Yu, Joomi Ahn, and Martin Gilar Waters Corporation, Milford, MA, U.S. APPLICATION BENEFITS Used together,

More information

quantitate host cell DNA with high sensitivity and throughput resdnaseq Host Cell DNA Quantitation Systems: CHO, E.

quantitate host cell DNA with high sensitivity and throughput resdnaseq Host Cell DNA Quantitation Systems: CHO, E. quantitate host cell DNA with high sensitivity and throughput resdnaseq Host Cell DNA Quantitation Systems: CHO, E. coli, Vero, NS0 Precision counts Integrated real-time qpcr systems for quantitation of

More information

Thermo Scientific Proteomics & Metabolomics Seminar Tour

Thermo Scientific Proteomics & Metabolomics Seminar Tour Proteomics & Seminar Tour Ignite your workflows with our with Cutting Edge LC-MS Technology Stop by to learn the latest advances in mass spectrometry workflows, technologies launched at 2012 ASMS and talk

More information

Investigation of Solid Phase Microextraction as an Alternative to Dried Blood Spot

Investigation of Solid Phase Microextraction as an Alternative to Dried Blood Spot Investigation of Solid Phase Microextraction as an Alternative to Dried Blood Spot Craig Aurand and Robert Shirey Supelco, Div. of Sigma-Aldrich Bellefonte, PA 16823 USA T414068 sigma-aldrich.com/analytical

More information

Kinetics Review. Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets)

Kinetics Review. Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets) Quiz 1 Kinetics Review Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets) I will post the problems with solutions on Toolkit for those that can t make

More information

Application of a Mass Spectrometry Based Multi-Attribute-Method (MAM) for QC Release and Stability Testing of Protein Therapeutics

Application of a Mass Spectrometry Based Multi-Attribute-Method (MAM) for QC Release and Stability Testing of Protein Therapeutics Application of a Mass Spectrometry Based Multi-Attribute-Method (MAM) for QC Release and Stability Testing of Protein Therapeutics Tamer Eris, Principal Scientist Process Development Amgen, Thousand Oaks,

More information

Thank you for joining us! Our Webinar will begin shortly.

Thank you for joining us! Our Webinar will begin shortly. Practical Considerations for LC/MS Bioanalysis of Proteins via the Surrogate Peptide Approach Thank you for joining us! Our Webinar will begin shortly. While you are waiting, please feel free to browse

More information

Thermo Scientific Mass Spectrometric Immunoassay (MSIA) Pipette Tips. Next generation immunoaffinity. Robust quantitative platform

Thermo Scientific Mass Spectrometric Immunoassay (MSIA) Pipette Tips. Next generation immunoaffinity. Robust quantitative platform Thermo Scientific Mass Spectrometric Immunoassay (MSIA) Pipette Tips Next generation immunoaffinity Robust quantitative platform Immunoaffinity sample preparation Thermo Scientific Mass Spectrometric Immunoassay

More information

Purification: Step 1. Lecture 11 Protein and Peptide Chemistry. Cells: Break them open! Crude Extract

Purification: Step 1. Lecture 11 Protein and Peptide Chemistry. Cells: Break them open! Crude Extract Purification: Step 1 Lecture 11 Protein and Peptide Chemistry Cells: Break them open! Crude Extract Total contents of cell Margaret A. Daugherty Fall 2003 Big Problem: Crude extract is not the natural

More information

Purification: Step 1. Protein and Peptide Chemistry. Lecture 11. Big Problem: Crude extract is not the natural environment. Cells: Break them open!

Purification: Step 1. Protein and Peptide Chemistry. Lecture 11. Big Problem: Crude extract is not the natural environment. Cells: Break them open! Lecture 11 Protein and Peptide Chemistry Margaret A. Daugherty Fall 2003 Purification: Step 1 Cells: Break them open! Crude Extract Total contents of cell Big Problem: Crude extract is not the natural

More information

Superdex 200 Increase columns

Superdex 200 Increase columns GE Healthcare Life Sciences Data file 29-452-69 AA Size exclusion chromatography Superdex 2 Increase columns Superdex 2 Increase prepacked columns (Fig 1) are designed for size exclusion chromatography

More information

Monoclonal Antibody Charge Variants: Origins, Physicochemical Characterization, and Pharmacokinetics

Monoclonal Antibody Charge Variants: Origins, Physicochemical Characterization, and Pharmacokinetics Monoclonal Antibody Charge Variants: Origins, Physicochemical Characterization, and Pharmacokinetics Paul Motchnik Protein Analytical Chemistry Genentech, South San Francisco, CA January 10, 2011 Washington,

More information