Supplemental Material for: Nutritional control of antibiotic resistance via an interface between the phosphotransferase system and
|
|
- Emerald Ellis
- 6 years ago
- Views:
Transcription
1 Supplemental Material for: Nutritional control of antibiotic resistance via an interface between the phosphotransferase system and a two-component signaling system Holly Snyder, Stephanie L Kellogg, Laura M Skarda, Jaime L Little, and Christopher J Kristich* 1
2 Table S1. Median minimal inhibitory concentrations a for antibiotics (μg/ml) in MHB. Strain b ceftazidime (cephalosphorin) chloramphenicol (ribosomal inhibitor) Wild-type ΔptsH a MICs were determined after 24 h at 37 C in MHB from a minimum of 3 independent experiments. b Strains used were: Wild-type, OG1; ΔptsH2, JL395. 2
3 Table S2. E. faecalis HPr mutants exhibiting impaired in vivo association with CroR but not HPr Mutation E2G Secondary structure element in HPr β strand A F29L loop 2 S31T loop 2 V55D loop 5 G67V loop 6 E70G M74T M74R M74K Q82H helix C helix C helix C helix C helix C 3
4 Table S3. Strains and plasmids used in this study Strain or plasmid Relevant genotype or description Source or reference Strains E. coli TOP10 routine cloning host Invitrogen Mach1-T1 R cloning host during Gateway constructions Invitrogen DH5α cloning host for pcjk218-based plasmids lab stock E. faecalis OG1 Wild-type reference strain (MLST 1) (1) JL395 OG1 ΔptsH2 This work JL422 OG1 ptsh E2G This work JL425 OG1 ptsh E70G This work SB23 OG1 ΔcroR2 This work SB27 JL425 ΔcroR2 This work SB31 JL422 ΔcroR2 This work SB39 JL395 ΔcroR2 This work OG1RF Spontaneous rifampicin and fusidic acid-resistant derivative of (2) OG1 T1 (SS498) Wild-type (MLST 21), CDC reference strain (3) E. faecium Com12 Fecal isolate (4) 1,141,733 Clinical isolate (4) Plasmids pcjk106 Plasmid carrying cror -lacz fusion (Em R ) C. Kristich, pcjk218 E. faecalis allelic exchange vector (Cm R ) (5) pjll80 ΔptsH2 (ΔH15-L81) in pcjk218 This work pjll85 ptsh E2G in pcjk218 This work pjll88 ptsh E70G in pcjk218 This work pslb38 ΔcroR2 (ΔI46-Q217) in pcjk218 This work pjrg8 E. faecalis expression vector w/ constitutive P23s promoter (6) (Em R ) pjll92 P ptsh -ptsh in pjrg8 (contains 275 nt upstream of ptsh) This work pjll100 P ptsh -ptsh H15A in pjrg8 This work pjll101 P ptsh -ptsh S46A in pjrg8 This work pjll102 P ptsh -ptsh H15A S46A in pjrg8 This work plms154 ptsh-f [1,2] in pjrg8 This work plms1749f12 hprk-f [1,2] in pjrg8 This work plms3289f12 cror-f [1,2] in pjrg8 This work pci3340 E. coli/e. faecalis shuttle vector (Cm R ) (7) pjrg9 constitutive P23s promoter in pci3340 (Cm R ) This work plms148 cror-f [3] in pjrg9 This work plms152 ptsh-f [3] in pjrg9 This work plms ptsh E2G-F [3] in pjrg9 This work plms ptsh E70G-F [3] in pjrg9 This work 4
5 plms168 ptsh H15A-F [3] in pjrg9 This work plms170 ptsh S46A-F [3] in pjrg9 This work pat18 E. coli/e. faecalis shuttle vector (Em R ) (8) pbk200 E. faecalis expression vector, constitutive P23 promoter (Em R ) This work phs11 cror-strep in pbk200 This work pdonr221 Gateway entry clone vector Invitrogen pdonr221- EF1039 pdonr221- EF1714 Gateway entry clone containing EF1039 ORF H. He and C. Kristich, Gateway entry clone containing EF1714 ORF H. He and C. Kristich, phh3 Gateway destination vector based on pjrg8 for fusion to F [1,2] H. He and C. Kristich, phh6 Gateway destination vector based on pbk200 for fusion to Strep H. He and C. Kristich, phh8 Gateway destination vector based on pjrg9 for fusion to F [3] H. He and C. Kristich, phs12 EF1714-Strep in phh6 This work phs13 EF1714-F [1,2] in phh3 This work phs14 EF1039-F [3] in phh8 This work phs22 ptsh H15A S46A-F [3] in pjrg9 This work puab100 source of mdhfr F [1,2] fragment (9) puab200 source of mdhfr F [3] fragment (9) Supplemental References 1. Gold, O. G., H. V. Jordan, and J. van Houte The prevalence of enterococci in the human mouth and their pathogenicity in animal models. Arch. Oral Biol. 20: Dunny, G. M., B. L. Brown, and D. B. Clewell Induced cell aggregation and mating in Streptococcus faecalis: evidence for a bacterial sex pheromone. Proc. Natl. Acad. Sci. U.S.A. 75: Maekawa, S., M. Yoshioka, and Y. Kumamoto Proposal of a new scheme for the serological typing of Enterococcus faecalis strains. Microbiol Immunol 36: Palmer, K. L., P. Godfrey, A. Griggs, V. N. Kos, J. Zucker, C. Desjardins, G. Cerqueira, D. Gevers, S. Walker, J. Wortman, M. Feldgarden, B. Haas, B. Birren, and M. S. Gilmore Comparative genomics of enterococci: variation in Enterococcus faecalis, clade structure in E. faecium, and defining characteristics of E. gallinarum and E. casseliflavus. MBio 3:e Vesic, D., and C. J. Kristich A Rex family transcriptional repressor influences H 2 O 2 accumulation by Enterococcus faecalis. J. Bacteriol. 195: Kristich, C. J., J. L. Little, C. L. Hall, and J. S. Hoff Reciprocal regulation of cephalosporin resistance in Enterococcus faecalis. MBio 2:e Hayes, F., C. Daly, and G. F. Fitzgerald Identification of the Minimal Replicon of Lactococcus lactis subsp. lactis UC317 Plasmid pci305. Appl. Environ. Microbiol. 56:
6 8. Trieu-Cuot, P., C. Carlier, C. Poyart-Salmeron, and P. Courvalin Shuttle vectors containing a multiple cloning site and a lacz alpha gene for conjugal transfer of DNA from Escherichia coli to gram-positive bacteria. Gene 102: Singh, A., D. Mai, A. Kumar, and A. J. Steyn Dissecting virulence pathways of Mycobacterium tuberculosis through protein-protein association. Proc. Natl. Acad. Sci. U.S.A. 103:
7 Fig S1. Fig S1. Simplified overview of the PTS in Gram-positive bacteria. Enzyme I (Enz I) and HPr are general PTS proteins that function in transport of all PTS substrates. During uptake of carbohydrates that are substrates of the PTS, Enz I uses phosphoenol pyruvate (PEP)) to autophosphorylate. This phosphoryl group is transferred to HPr on His15 in an intermediate step. HPr-His15-P subsequently transfers this phosphoryl group to a carbohydrate-specific transporter known as an Enzyme II ( Enz II). Enz IIs are comprised of several domains, minimally including the Enz IIa, Enz IIb, and integral membrane Enz IIc domains. The phosphoryl group is passed from HPr-His15-P (glucose in this example) that passes through the Enz IIc component. HPr can also be reversibly phosphorylated on Ser46 by the bifunctional kinase/phos phorylase HprK, whose activities are modulatedd by metabolites (not shown). HPr-Ser46-PP interacts as a co-repressor with the DNA-binding transcription factor CcpA, enabling the complex to bind DNA and modulate transcriptionn of target genes (catabolite repression or activation). Our results indicate that HPr can also associate with CroR, the response regulator component of the CroR/S two-component signaling system that is required forr cephalosporin resistance in E. faecalis, to modulate CroR-dependent gene expression and cephalosporin resistance. We have not yet established with isoform of HPr is important for association with CroR and thereforee have depicted potential associations with HPr-His15-P or HPr-Ser46-P. Association of CroR with unphosphorylated HPr is also a formal possibility, although our results suggest this is the least likely to Enz IIa and subsequently to Enz IIb before transfer to the incoming carbohydrate alternative. 7
8 Fig S2. Fig S2. HPr mutants with substitutions at the sites of phosphorylation are impaired at association with CroR. Mutants of E. faecalis HPr with substitutions at the sites of phosphorylation exhibit impaired association with CroR in vivo. (A) E. faecalis strains co-expressing the indicated fusions weree subjected to 10-fold serial dilutions and inoculated on MH agar supplemented with Cm and Em (for plasmid selection) in the presence or absence of trimethoprim. The HPr mutants exhibit a moderately reduced ability to promote growth in the presence of trimethoprim compared to wild-type HPr (colony formation reduced by 10-fold compared to wild-type), OG1RF; plasmid combinations were: plms3289f12 + plms152 (top); plms3289f12 + plms168 (upper middle); plms3289f12 + plms170 (lower middle); and plms3289f12 + phs22 (bottom) (B) Co-immunoprecipitation from E. faecalis lysates using anti-f [3] antisera. Lysates and immunoprecipitates were subjected to immunoblot analysis with antiseraa specific for the strep or F [3] fusions, revealing that CroR no longer co-precipitates with non-phosphorylatable HPr. Host strain was E. faecalis OG1RF; plasmid combinations were: phs11 + plms152 (left lane) and phs11 + phs22 (right lane). Lysates corresponds to the whole-cell lysates used as input for co-immunoprecipitation; IP corresponds to the immune complexes recovered after co-immunoprecipitation. indicative of reduced in vivo association of the fusions. Host strain was E. faecalis 8
9 Fig S3. Fig S3. mdhfr analysis of HPr mutants with impaired CroR association. Mutants of E. faecalis HPr that exhibit impaired association with CroR in vivo weree identified using mdhfr PCA, as described in Materials and Methods. E. faecalis strains co-expressing the indicated fusions were subjected to 10-fold serial dilutions and inoculated on MH agar supplemented with Cm and Em (for plasmid selection) and trimethoprim at 1 μg/ml. Whereas thee wild-type HPr-F [3] fusion enables growth when co-expressed with F [1,2] fusionss of both CroR (left) andd HPr (right),, indicative of in vivo association, the HPr mutants only enable growth when co-expressed with HPr. Host strain was E. faecalis OG1RF. 9
10 Fig S4 Fig S4. HPr point mutants that do not interact with CroR, as determined by mdhfr PCA, also do not co-immunoprecipitate with CroR. Association of CroR and HPr in whole-cell lysates of E. faecalis was assessed by co-immunoprecipitation with anti-f [3] antisera. CroR-Strep was co-expressed with wild-type HPr, HPr E2G, or HPr E70G fused to mdhfr F [3] as indicated. Lysates and immunoprecipitates weree subjected to immunoblot analysis with antisera specific for the Strep or F [3] fusions, revealing that CroR specifically co-precipitates with wild-type HPr but not the HPr mutants. Host strain was E. faecalis OG1RF. Lysates corresponds to the whole-cell lysatess used as input for co-immunoprecipitation; IP corresponds to the immune complexes recovered after coimmunoprecipitation. 10
Supporting Information-Tables
Supporting Information-Tables Table S1. Bacterial strains and plasmids used in this work Bacterial strains Description Source of reference Streptococcus pneumoniae 1 Cp1015 non-capsulated and βl susceptible
More informationConfirming the Phenotypes of E. coli Strains
Confirming the Phenotypes of E. coli Strains INTRODUCTION Before undertaking any experiments, we need to confirm that the phenotypes of the E. coli strains we intend to use in the planned experiments correspond
More informationTable S5. Bacterial strains, phages, plasmids and primers.
Table S5. Bacterial strains, phages, plasmids and primers. Strains, phages, plasmids and primers Characteristics and/or description Reference/source Enterococcus faecalis V583 Human blood isolate; Vm R,
More informationBCH 462 Competent Cells Formation and Transformation of Competent Cells with plasmid DNA.
Lab#2 BCH 462 Competent Cells Formation and Transformation of Competent Cells with plasmid DNA. Outlines: 1-Insertion of foreign gene to the plasmid. 2-Competent cell. 3-Transformation of bacterial cell.
More informationThe GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity
Promega Notes Magazine Number 62, 1997, p. 02 The GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity By Christine Andrews and Scott Lesley Promega
More informationThe Regulation of Bacterial Gene Expression
The Regulation of Bacterial Gene Expression Constitutive genes are expressed at a fixed rate Other genes are expressed only as needed Inducible genes Repressible genes Catabolite repression Pre-transcriptional
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature10163 Supplementary Table 1 Efficiency of vector construction. Process wells recovered efficiency (%) Recombineering* 480 461 96 Intermediate plasmids 461 381 83 Recombineering efficiency
More informationBACTERIAL CONJUGATION. To demonstrate the technical procedure to monitor the conjugational transfer of genetic material from one cell to another.
BACTERIAL CONJUGATION I. OBJECTIVES To demonstrate the technical procedure to monitor the conjugational transfer of genetic material from one cell to another. To learn about the various genetic elements
More informationYeast Two Hybrid Assay: A Fishing Tale
KEYWORDS: yeast two hybrid, molecular interactions, galactose metabolism Special section on techniques: Yeast Two Hybrid Assay: A Fishing Tale Solmaz Sobhanifar Pathology, University of British Columbia
More informationSupplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/-
#1074683s 1 Supplemental Online Material Materials and Methods Cell lines and tissue culture The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- knock-out animals
More informationCloning and Sequencing of the Gene Encoding Curvaticin FS47, an Anti- Listerial Bacteriocin Produced by Lactobacillus curvatus FS47
Cloning and Sequencing of the Gene Encoding Curvaticin FS47, an Anti- Listerial Bacteriocin Produced by Lactobacillus curvatus FS47 S. Macwana, L. Ma, M.A. Cousin, and P.M. Muriana Story in Brief Curvaticin
More informationAll MGC premier clones are 100% guaranteed to match their published sequence.
MGC premier full length cdna and ORF clones TCH1003, TCM1004, TCR1005, TCB1006, TCL1007, TCT1008, TCZ1009, TOH6003, TOM6004, TOZ6009, TCHS1003, TCMS1004, TCRS1005, TCBS1006, TCLS1007, TCTS1008 MGC premier
More informationREGULATION OF GENE EXPRESSION
REGULATION OF GENE EXPRESSION Each cell of a living organism contains thousands of genes. But all genes do not function at a time. Genes function according to requirements of the cell. Genes control the
More informationGENE REGULATION IN PROKARYOTES
GENE REGULATION IN PROKARYOTES Prepared by Brenda Leady, University of Toledo Copyright (c) The McGraw-Hill Companies, Inc. Permission required for reproduction or display. 1 Gene regulation refers to
More informationSTRUCTURAL BIOLOGY. α/β structures Closed barrels Open twisted sheets Horseshoe folds
STRUCTURAL BIOLOGY α/β structures Closed barrels Open twisted sheets Horseshoe folds The α/β domains Most frequent domain structures are α/β domains: A central parallel or mixed β sheet Surrounded by α
More informationGene Transfer 11/4/13. Fredrick Griffith in the 1920s did an experiment. Not until 1944 was DNA shown to be the moveable element
Gene Transfer Fredrick Griffith in the 1920s did an experiment. Not until 19 was DN shown to be the moveable element Dead pathogen cells able to make a capsule were able to pass this ability to the live
More informationAnswers to Module 1. An obligate aerobe is an organism that has an absolute requirement of oxygen for growth.
Answers to Module 1 Short Answers 1) What is an obligate aerobe? An obligate aerobe is an organism that has an absolute requirement of oxygen for growth. What about facultative anaerobe? 2) Distinguish
More informationONTARIO SCIENCE CENTRE. Teacher Guide. Way to Glow Program
ONTARIO SCIENCE CENTRE Teacher Guide Way to Glow Program Table of Contents Bacterial transformation background information 3 Experimental procedure 5 Expected results 7 Post-program activity sheet 8 Post-program
More information7 Gene Isolation and Analysis of Multiple
Genetic Techniques for Biological Research Corinne A. Michels Copyright q 2002 John Wiley & Sons, Ltd ISBNs: 0-471-89921-6 (Hardback); 0-470-84662-3 (Electronic) 7 Gene Isolation and Analysis of Multiple
More informationCassette denotes the ORFs expressed by the expression cassette targeted by the PCR primers used to
Stanyon, C.A., Limjindaporn, T., and Finley, Jr., R.L. Simultaneous transfer of open reading frames into several different expression vectors. Biotechniques, 35, 520-536, 2003. http://www.biotechniques.com
More informationSelf-test Quiz for Chapter 12 (From DNA to Protein: Genotype to Phenotype)
Self-test Quiz for Chapter 12 (From DNA to Protein: Genotype to Phenotype) Question#1: One-Gene, One-Polypeptide The figure below shows the results of feeding trials with one auxotroph strain of Neurospora
More informationThe Two-Hybrid System
Encyclopedic Reference of Genomics and Proteomics in Molecular Medicine The Two-Hybrid System Carolina Vollert & Peter Uetz Institut für Genetik Forschungszentrum Karlsruhe PO Box 3640 D-76021 Karlsruhe
More informationAP Biology Gene Expression/Biotechnology REVIEW
AP Biology Gene Expression/Biotechnology REVIEW Multiple Choice Identify the choice that best completes the statement or answers the question. 1. Gene expression can be a. regulated before transcription.
More informationSupplemental Materials. DNA preparation. Dehalogenimonas lykanthroporepellens strain BL-DC-9 T (=ATCC
Supplemental Materials DNA preparation. Dehalogenimonas lykanthroporepellens strain BL-DC-9 T (=ATCC BAA-1523 = JCM 15061) was grown in defined basal medium amended with 0.5 mm 1,1,2- trichloroethane (1,1,2-TCA)
More informationThe Mosaic Nature of Genomes
The Mosaic Nature of Genomes n DNA sequence is not static Mutations of single bases Large deletions Large insertions of sequence n Transferred from other species n New functions useful in particular situations
More informationCHAPTER 9 DNA Technologies
CHAPTER 9 DNA Technologies Recombinant DNA Artificially created DNA that combines sequences that do not occur together in the nature Basis of much of the modern molecular biology Molecular cloning of genes
More informationKOD -Plus- Mutagenesis Kit
Instruction manual KOD -Plus- Mutagenesis Kit 0811 F0936K KOD -Plus- Mutagenesis Kit SMK-101 20 reactions Store at -20 C Contents [1] Introduction [2] Flow chart [3] Components [4] Notes [5] Protocol 1.
More informationLecture 25 (11/15/17)
Lecture 25 (11/15/17) Reading: Ch9; 328-332 Ch25; 990-995, 1005-1012 Problems: Ch9 (study-guide: applying); 1,2 Ch9 (study-guide: facts); 7,8 Ch25 (text); 1-3,5-7,9,10,13-15 Ch25 (study-guide: applying);
More informationRecombinant DNA Technology. The Role of Recombinant DNA Technology in Biotechnology. yeast. Biotechnology. Recombinant DNA technology.
PowerPoint Lecture Presentations prepared by Mindy Miller-Kittrell, North Carolina State University C H A P T E R 8 Recombinant DNA Technology The Role of Recombinant DNA Technology in Biotechnology Biotechnology?
More informationMicrobial Biotechnology agustin krisna wardani
Microbial Biotechnology agustin krisna wardani 1. The Structure of Microbes Microbes (microorganisms) are tiny organisms that are too small to be seen individually by the naked eye and must be viewed with
More informationAntisense RNA Insert Design for Plasmid Construction to Knockdown Target Gene Expression
Vol. 1:7-15 Antisense RNA Insert Design for Plasmid Construction to Knockdown Target Gene Expression Ji, Tom, Lu, Aneka, Wu, Kaylee Department of Microbiology and Immunology, University of British Columbia
More informationBacterial defense mechanisms against bacteriophages. B.G.E.T Jayashantha B.Sc (ug) Microbiology (Special), University of Kelaniya, Sri Lanka
Bacterial defense mechanisms against bacteriophages B.G.E.T Jayashantha B.Sc (ug) Microbiology (Special), University of Kelaniya, Sri Lanka Objective To study the defense mechanisms associated with bacteria
More information2054, Chap. 13, page 1
2054, Chap. 13, page 1 I. Microbial Recombination and Plasmids (Chapter 13) A. recombination = process of combining genetic material from 2 organisms to produce a genotype different from either parent
More informationRequirement for a Functional int Product in Temperature Inductions of
JOURNAL OF VIROLOGY, SePt. 1970, p. 320-325 Vol. 6, No. 3 Copyright 1970 American Society for Microbiology Prinited in U.S.A. Requirement for a Functional int Product in Temperature Inductions of Prophage
More informationLectures of Dr.Mohammad Alfaham. The Bacterial Genetics
Lectures of Dr.Mohammad Alfaham The Bacterial Genetics is the total collection of genes carried by a bacterium both on its chromosome and on its extrachromosomal genetic elements (plasmids) A Gene A gene
More informationOptimizing Synthetic DNA for Metabolic Engineering Applications. Howard Salis Penn State University
Optimizing Synthetic DNA for Metabolic Engineering Applications Howard Salis Penn State University Synthetic Biology Specify a function Build a genetic system (a DNA molecule) Genetic Pseudocode call producequorumsignal(luxi
More informationTightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter
TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter L M Guzman et al. (1995) Journal of Bacteriology 177: 4121-4130 Outline 1. Introduction 2. Objective 3.
More information7.06 Cell Biology EXAM #2 March 20, 2003
7.06 Cell Biology EXAM #2 March 20, 2003 This is an open book exam, and you are allowed access to books, a calculator, and notes but not computers or any other types of electronic devices. Please write
More informationSpostiamo ora la nostra attenzione sui batteri, e batteriofagi
Spostiamo ora la nostra attenzione sui batteri, e batteriofagi Bacteria Mutate Spontaneously and Grow at an Exponential Rate. Useful for genetics studies, development of genetic engineering Teoria dell'adattamento
More informationSupplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling
Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Glendining KA 1, Markie D 2, Gardner RJM 4, Franz EA 3, Robertson SP 4, Jasoni CL 1 Supplementary
More informationHow Do You Clone a Gene?
S-20 Edvo-Kit #S-20 How Do You Clone a Gene? Experiment Objective: The objective of this experiment is to gain an understanding of the structure of DNA, a genetically engineered clone, and how genes are
More informationEfficient Multi-site-directed Mutagenesis directly from Genomic Template.
Efficient Multi-site-directed Mutagenesis directly from Genomic Template. Fengtao Luo 1, Xiaolan Du 1, Tujun Weng 1, Xuan Wen 1, Junlan Huang 1, Lin Chen 1 Running title: Multi-site-directed Mutagenesis
More information7.1 The lac Operon 7-1
7.1 The lac Operon The lac operon was the first operon discovered It contains 3 genes coding for E. coli proteins that permit the bacteria to use the sugar lactose Galactoside permease (lacy) which transports
More informationEinführung in die Genetik
Einführung in die Genetik Prof. Dr. Kay Schneitz (EBio Pflanzen) http://plantdev.bio.wzw.tum.de schneitz@wzw.tum.de Prof. Dr. Claus Schwechheimer (PlaSysBiol) http://wzw.tum.de/sysbiol claus.schwechheimer@wzw.tum.de
More informationThe dialkylglycine decarboxylase repressor DgdR. Functional aspects and relation to other LysR proteins
11/29/2011 1 The dialkylglycine decarboxylase repressor DgdR. Functional aspects and relation to other LysR proteins 1. Dialkylglycine amino acids 2. In vivo and in vitro studies on the DgdR repressor
More informationGenetics Lecture Notes Lectures 17 19
Genetics Lecture Notes 7.03 2005 Lectures 17 19 Lecture 17 Gene Regulation We are now going to look at ways that genetics can be used to study gene regulation. The issue is how cells adjust the expression
More informationGeNei TM Transformation Teaching Kit Manual
Teaching Kit Manual Cat No. New Cat No. KT07 107385 KT07A 106220 Revision No.: 00060505 CONTENTS Page No. Objective 3 Principle 3 Kit Description 6 Materials Provided 7 Procedure 9 Observation & Interpretation
More informationTECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits
In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits Catalog Numbers APPA001 In Vitro Bacterial Split GFP "Fold 'n' Glow" Solubility Assay Kit (Green) APPA008 In Vitro Bacterial
More informationHow antimicrobial agents work
Physical and Chemical Control of Microbes Physical Agents heat or radiation Chemical Agents disinfectants or antiseptics Important Terms 1. Sterilization process of killing all viable microbes 2. Bactericide
More information320 MBIO Microbial Diagnosis. Aljawharah F. Alabbad Noorah A. Alkubaisi 2017
320 MBIO Microbial Diagnosis Aljawharah F. Alabbad Noorah A. Alkubaisi 2017 Primary Media for Isolation of Microorganisms As we know, many clinical specimens contain a mixed flora of microorganisms. Thus
More informationMolecular Cell Biology - Problem Drill 11: Recombinant DNA
Molecular Cell Biology - Problem Drill 11: Recombinant DNA Question No. 1 of 10 1. Which of the following statements about the sources of DNA used for molecular cloning is correct? Question #1 (A) cdna
More informationPatentability/Literature Research
Patentability/Literature Research The probiotic-based solution to combat cholera as presented here comprises of two major innovative components: (1) the metabolite-dependent pathogen inhibition by a probiotic
More informationpvivo1-gfp/lacz An innovative multigenic plasmid for high levels of expression of the GFP and LacZ reporter genes in tumors Catalog # pvivo1-gfp-lacz
pvivo1-gfp/lacz An innovative multigenic plasmid for high levels of expression of the GFP and LacZ reporter genes in tumors Catalog # pvivo1-gfp-lacz For research use only Version # 12H31-MM PROduCT information
More informationSupplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons
Neuron, Volume 61 Supplemental Data LMO4 Controls the Balance between Excitatory and Inhibitory Spinal V2 Interneurons Kaumudi Joshi, Seunghee Lee, Bora Lee, Jae W. Lee, and Soo-Kyung Lee Supplemental
More informationHI-Control BL21(DE3) & HI-Control 10G Chemically Competent Cells
HI-Control BL21(DE3) & HI-Control 10G Chemically Competent Cells FOR RESEARCH USE ONLY. NOT FOR HUMAN OR DIAGNOSTIC USE MA156 Rev.31OCT2016 Table of Contents Components & Storage Conditions... 3 HI-Control
More informationDiversity of the fsr-gele Region of the Enterococcus faecalis Genome but Conservation in Strains with Partial Deletions of the fsr Operon
APPLIED AND ENVIRONMENTAL MICROBIOLOGY, Jan. 2011, p. 442 451 Vol. 77, No. 2 0099-2240/11/$12.00 doi:10.1128/aem.00756-10 Copyright 2011, American Society for Microbiology. All Rights Reserved. Diversity
More informationCloning and Expression of a Haloacid Dehalogenase Enzyme. By: Skyler Van Senior Research Advisor: Dr. Anne Roberts
Cloning and Expression of a Haloacid Dehalogenase Enzyme By: Skyler Van Senior Research Advisor: Dr. Anne Roberts utline The gene being cloned is JHP1130 from Helicobacter pylori (H. pylori) JHP1130 is
More informationReceived 31 October 1996/Accepted 18 March 1997
JOURNAL OF BACTERIOLOGY, May 1997, p. 3250 3259 Vol. 179, No. 10 0021-9193/97/$04.00 0 Copyright 1997, American Society for Microbiology Regulation of Transfer of the Enterococcus faecalis Pheromone- Responding
More informationSection A: Prokaryotes Types and Structure 1. What is microbiology?
Section A: Prokaryotes Types and Structure 1. What is microbiology? 2. Compare and contrast characteristics of each bacterial type: Eubacteria and Archaebacteria. Eubacteria Both Archaebacteria 3. Label
More informationMIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr.
MIT Department of Biology 7.01: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. Claudette Gardel iv) Would Xba I be useful for cloning? Why or why not?
More informationBETA STRAND Prof. Alejandro Hochkoeppler Department of Pharmaceutical Sciences and Biotechnology University of Bologna
Prof. Alejandro Hochkoeppler Department of Pharmaceutical Sciences and Biotechnology University of Bologna E-mail: a.hochkoeppler@unibo.it C-ter NH and CO groups: right, left, right (plane of the slide)
More informationCell Growth and DNA Extraction- Technion igem HS
Growing Cells and DNA Extraction Goals 1. Become familiar with the process of growing bacteria 2. Get to know the DNA extraction process 3. Perform miniprep in the lab Keywords 1. Growth stages 6. Techniques
More informationSupplemental Information. Natural RNA Polymerase Aptamers. Regulate Transcription in E. coli
Molecular Cell, Volume 67 Supplemental Information Natural RNA Polymerase Aptamers Regulate Transcription in E. coli Nadezda Sedlyarova, Philipp Rescheneder, Andrés Magán, Niko Popitsch, Natascha Rziha,
More informationCHAPTER 20 DNA TECHNOLOGY AND GENOMICS. Section A: DNA Cloning
Section A: DNA Cloning 1. DNA technology makes it possible to clone genes for basic research and commercial applications: an overview 2. Restriction enzymes are used to make recombinant DNA 3. Genes can
More informationGenome Sequence Assembly
Genome Sequence Assembly Learning Goals: Introduce the field of bioinformatics Familiarize the student with performing sequence alignments Understand the assembly process in genome sequencing Introduction:
More informationLecture 9 Controlling gene expression
Lecture 9 Controlling gene expression BIOLOGY Campbell, Reece and Mitchell Chapter 18 334- (352-356) Every cell in your body contains the same number of genes approximately 35, 000 DNA is wound around
More informationEinführung in die Genetik
Einführung in die Genetik Prof. Dr. Kay Schneitz (EBio Pflanzen) http://plantdev.bio.wzw.tum.de schneitz@wzw.tum.de Twitter: @PlantDevTUM, #genetiktum FB: Plant Development TUM Prof. Dr. Claus Schwechheimer
More informationSupporting Information
Supporting Information Beauregard et al. 10.1073/pnas.1218984110 Fig. S1. Model depicting the regulatory pathway leading to expression of matrix genes. The master regulator Spo0A can be directly or indirectly
More informationSuperScript IV Reverse Transcriptase as a better alternative to AMV-based enzymes
WHITE PAPER SuperScript IV Reverse Transcriptase SuperScript IV Reverse Transcriptase as a better alternative to AMV-based enzymes Abstract Reverse transcriptases (RTs) from avian myeloblastosis virus
More information6/28/2016. Control of Microbial Growth. Method. Terminology. Disinfectants and Antiseptics
Control of Microbial Growth Disinfectants and Antiseptics 1 Method Three approaches for the control of microbial growth Chemical Disinfectants and antiseptics Physical Heat Ultraviolet Irradiations Mechanical
More informationBio 311 Learning Objectives
Bio 311 Learning Objectives This document outlines the learning objectives for Biol 311 (Principles of Genetics). Biol 311 is part of the BioCore within the Department of Biological Sciences; therefore,
More informationDNA Structure and Properties Basic Properties Predicting Melting Temperature. Dinesh Yadav
DNA Structure and Properties Basic Properties Predicting Melting Temperature Dinesh Yadav Nucleic Acid Structure Question: Is this RNA or DNA? Molecules of Life, pp. 15 2 Nucleic Acid Bases Molecules of
More informationThe Fertility Factor, or F
The Fertility Factor, or F Pili Contains pili genes, tra genes, replication genes, but no genes essential for cell survival or growth. Chromosome F factor 100,000 bp Closely related R factor contains multiply
More informationGENE REGULATION slide shows by Kim Foglia modified Slides with blue edges are Kim s
GENE REGULATION slide shows by Kim Foglia modified Slides with blue edges are Kim s 2007-2008 Bacterial metabolism Bacteria need to respond quickly to changes in their environment STOP GO if they have
More informationSI Results Peculiarities in the consumption of ammonium and glucose by AmtB- strains SI Materials and Methods Strain Construction
SI Results Peculiarities in the consumption of ammonium and glucose by AmtB - strains. The AmtB - strain failed to consume all the ammonium in the medium under NH 3 -limiting conditions (.5 mm total ammonium
More informationHeterologous protein expression systems
IMBB-FORTH Heterologous protein expression systems What are they? Protein expression systems producing desired polypeptides from recombinant genes. Plasmids carry and express the desired recombinant genes
More informationViruses and Bacteria Notes
Viruses and Bacteria Notes A. Virus Structure: Viruses are in contrast to bacteria. Viruses are (DNA or RNA) enclosed in a coat called a. Also some viruses have a that helps them infect their host. These
More informationCloning and Characterization of E. meningoseptica Beta Lactamase
Cloning and Characterization of E. meningoseptica Beta Lactamase Authors: Lindsey Purcell, Jessica Matts, Patricia Canaan* Department of Biochemistry and Molecular Biology Abstract Elizabethkingia meningoseptica
More informationSupplemental Fig. S1. Key to underlines: Key to amino acids:
AspA-F1 AspA 1 MKQMETKGYGYFRKTKAYGLVCGIT--------------LAGALTLGTTSVSADDVTTLNPATNLTTLQTPPTADQTQLAHQAGQQSGELVSEVSNTEWD 86 SspB 1 MQKREV--FG-FRKSKVAKTLCGAV-LGAALIAIADQQVLADEVTETNSTANVAVTTTGNPATNLPEAQGEATEAASQSQAQAGSKDGALPVEVSADDLN
More information3 Designing Primers for Site-Directed Mutagenesis
3 Designing Primers for Site-Directed Mutagenesis 3.1 Learning Objectives During the next two labs you will learn the basics of site-directed mutagenesis: you will design primers for the mutants you designed
More informationEukaryotic Transcription
Eukaryotic Transcription I. Differences between eukaryotic versus prokaryotic transcription. II. (core vs holoenzyme): RNA polymerase II - Promotor elements. - General Pol II transcription factors (GTF).
More informationCONFIRMING LOCATION OF NITROGEN FIXING GENES ON PLASMIDS IN RHIZOBIUM ISOLATED FROM PISUM SATIVUM
CONFIRMING LOCATION OF NITROGEN FIXING GENES ON PLASMIDS IN RHIZOBIUM ISOLATED FROM PISUM SATIVUM Balaji Hajare and Avinash Ade 1 Department of Botany, Dr. B. A. M. University, Aurangabad, 431004 (MS)
More information2054, Chap. 14, page 1
2054, Chap. 14, page 1 I. Recombinant DNA technology (Chapter 14) A. recombinant DNA technology = collection of methods used to perform genetic engineering 1. genetic engineering = deliberate modification
More informationEnterococcus faecium. genesig Standard Kit. groes heat shock protein. 150 tests. Primerdesign Ltd. For general laboratory and research use only
TM Primerdesign Ltd Enterococcus faecium groes heat shock protein genesig Standard Kit 150 tests For general laboratory and research use only 1 Introduction to Enterococcus faecium E. faecium is a Gram-positive,
More informationSplit-Operon Control of a Prophage Gene*
Proceeding8 of the National Academy of Sciences Vol. 65, No. 2, pp. 331-336, February 1970 Split-Operon Control of a Prophage Gene* L. Elizabeth Bertani DEPARTMENT OF MICROBIAL GENETICS, KAROLINSKA INSTITUTET,
More informationSolutions to Quiz II
MIT Department of Biology 7.014 Introductory Biology, Spring 2005 Solutions to 7.014 Quiz II Class Average = 79 Median = 82 Grade Range % A 90-100 27 B 75-89 37 C 59 74 25 D 41 58 7 F 0 40 2 Question 1
More informationTranscription in Prokaryotes. Jörg Bungert, PhD Phone:
Transcription in Prokaryotes Jörg Bungert, PhD Phone: 352-273-8098 Email: jbungert@ufl.edu Objectives Understand the basic mechanism of transcription. Know the function of promoter elements and associating
More informationGenetic Engineering for Biofuels Production
Genetic Engineering for Biofuels Production WSE 573 Spring 2013 Greeley Beck INTRODUCTION Alternative transportation fuels are needed in the United States because of oil supply insecurity, oil price increases,
More informationBiosolar Conversion of N2 and H2O to Ammonia by Engineered N2-fixing Cyanobacteria
The Journal of Undergraduate Research Volume 9 Journal of Undergraduate Research, Volume 9: 2011 Article 16 2011 Biosolar Conversion of N2 and H2O to Ammonia by Engineered N2-fixing Cyanobacteria Seth
More informationUNIVERSITY OF YORK BA, BSc, and MSc Degree Examinations
Examination Candidate Number: Desk Number: UNIVERSITY OF YORK BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Bacterial pathogenesis Time Allowed: 2 hours Marking Scheme:
More informationLearning Objectives :
Learning Objectives : Understand the basic differences between genomic and cdna libraries Understand how genomic libraries are constructed Understand the purpose for having overlapping DNA fragments in
More informationBi 8 Lecture 7. Ellen Rothenberg 26 January Reading: Ch. 3, pp ; panel 3-1
Bi 8 Lecture 7 PROTEIN STRUCTURE, Functional analysis, and evolution Ellen Rothenberg 26 January 2016 Reading: Ch. 3, pp. 109-134; panel 3-1 (end with free amine) aromatic, hydrophobic small, hydrophilic
More informationEinführung in die Genetik
Einführung in die Genetik Prof. Dr. Kay Schneitz (EBio Pflanzen) http://plantdev.bio.wzw.tum.de schneitz@wzw.tum.de Prof. Dr. Claus Schwechheimer (PlaSysBiol) http://wzw.tum.de/sysbiol claus.schwechheimer@wzw.tum.de
More informationIntroducing new DNA into the genome requires cloning the donor sequence, delivery of the cloned DNA into the cell, and integration into the genome.
Key Terms Chapter 32: Genetic Engineering Cloning describes propagation of a DNA sequence by incorporating it into a hybrid construct that can be replicated in a host cell. A cloning vector is a plasmid
More informationMultiple choice questions (numbers in brackets indicate the number of correct answers)
1 Multiple choice questions (numbers in brackets indicate the number of correct answers) February 1, 2013 1. Ribose is found in Nucleic acids Proteins Lipids RNA DNA (2) 2. Most RNA in cells is transfer
More informationGenetics - Problem Drill 19: Dissection of Gene Function: Mutational Analysis of Model Organisms
Genetics - Problem Drill 19: Dissection of Gene Function: Mutational Analysis of Model Organisms No. 1 of 10 1. The mouse gene knockout is based on. (A) Homologous recombination (B) Site-specific recombination
More informationCloning Multiple Gateway Reaction
Cloning Multiple Gateway Reaction by A. Untergasser (contact address and download at www.untergasser.de/lab) Version: 1.0 - Print Version (.PDF) ATTENTION: This is not something what is done with low quality
More informationSome types of Mutagenesis
Mutagenesis What Is a Mutation? Genetic information is encoded by the sequence of the nucleotide bases in DNA of the gene. The four nucleotides are: adenine (A), thymine (T), guanine (G), and cytosine
More information1a. What is the ratio of feathered to unfeathered shanks in the offspring of the above cross?
Problem Set 5 answers 1. Whether or not the shanks of chickens contains feathers is due to two independently assorting genes. Individuals have unfeathered shanks when they are homozygous for recessive
More information7.02/ Genetics Exam Study Questions Spring The exam will be: Thursday, April 27 th, :05-11:55 AM Walker Gym, 3 rd floor (50-340)
7.02/10.702 Genetics Exam Study Questions Spring 2006 Annoucements: The exam will be: Thursday, April 27 th, 2006 11:05-11:55 AM Walker Gym, 3 rd floor (50-340) Please note that these practice questions
More information