Supplemental Material for: Nutritional control of antibiotic resistance via an interface between the phosphotransferase system and

Size: px
Start display at page:

Download "Supplemental Material for: Nutritional control of antibiotic resistance via an interface between the phosphotransferase system and"

Transcription

1 Supplemental Material for: Nutritional control of antibiotic resistance via an interface between the phosphotransferase system and a two-component signaling system Holly Snyder, Stephanie L Kellogg, Laura M Skarda, Jaime L Little, and Christopher J Kristich* 1

2 Table S1. Median minimal inhibitory concentrations a for antibiotics (μg/ml) in MHB. Strain b ceftazidime (cephalosphorin) chloramphenicol (ribosomal inhibitor) Wild-type ΔptsH a MICs were determined after 24 h at 37 C in MHB from a minimum of 3 independent experiments. b Strains used were: Wild-type, OG1; ΔptsH2, JL395. 2

3 Table S2. E. faecalis HPr mutants exhibiting impaired in vivo association with CroR but not HPr Mutation E2G Secondary structure element in HPr β strand A F29L loop 2 S31T loop 2 V55D loop 5 G67V loop 6 E70G M74T M74R M74K Q82H helix C helix C helix C helix C helix C 3

4 Table S3. Strains and plasmids used in this study Strain or plasmid Relevant genotype or description Source or reference Strains E. coli TOP10 routine cloning host Invitrogen Mach1-T1 R cloning host during Gateway constructions Invitrogen DH5α cloning host for pcjk218-based plasmids lab stock E. faecalis OG1 Wild-type reference strain (MLST 1) (1) JL395 OG1 ΔptsH2 This work JL422 OG1 ptsh E2G This work JL425 OG1 ptsh E70G This work SB23 OG1 ΔcroR2 This work SB27 JL425 ΔcroR2 This work SB31 JL422 ΔcroR2 This work SB39 JL395 ΔcroR2 This work OG1RF Spontaneous rifampicin and fusidic acid-resistant derivative of (2) OG1 T1 (SS498) Wild-type (MLST 21), CDC reference strain (3) E. faecium Com12 Fecal isolate (4) 1,141,733 Clinical isolate (4) Plasmids pcjk106 Plasmid carrying cror -lacz fusion (Em R ) C. Kristich, pcjk218 E. faecalis allelic exchange vector (Cm R ) (5) pjll80 ΔptsH2 (ΔH15-L81) in pcjk218 This work pjll85 ptsh E2G in pcjk218 This work pjll88 ptsh E70G in pcjk218 This work pslb38 ΔcroR2 (ΔI46-Q217) in pcjk218 This work pjrg8 E. faecalis expression vector w/ constitutive P23s promoter (6) (Em R ) pjll92 P ptsh -ptsh in pjrg8 (contains 275 nt upstream of ptsh) This work pjll100 P ptsh -ptsh H15A in pjrg8 This work pjll101 P ptsh -ptsh S46A in pjrg8 This work pjll102 P ptsh -ptsh H15A S46A in pjrg8 This work plms154 ptsh-f [1,2] in pjrg8 This work plms1749f12 hprk-f [1,2] in pjrg8 This work plms3289f12 cror-f [1,2] in pjrg8 This work pci3340 E. coli/e. faecalis shuttle vector (Cm R ) (7) pjrg9 constitutive P23s promoter in pci3340 (Cm R ) This work plms148 cror-f [3] in pjrg9 This work plms152 ptsh-f [3] in pjrg9 This work plms ptsh E2G-F [3] in pjrg9 This work plms ptsh E70G-F [3] in pjrg9 This work 4

5 plms168 ptsh H15A-F [3] in pjrg9 This work plms170 ptsh S46A-F [3] in pjrg9 This work pat18 E. coli/e. faecalis shuttle vector (Em R ) (8) pbk200 E. faecalis expression vector, constitutive P23 promoter (Em R ) This work phs11 cror-strep in pbk200 This work pdonr221 Gateway entry clone vector Invitrogen pdonr221- EF1039 pdonr221- EF1714 Gateway entry clone containing EF1039 ORF H. He and C. Kristich, Gateway entry clone containing EF1714 ORF H. He and C. Kristich, phh3 Gateway destination vector based on pjrg8 for fusion to F [1,2] H. He and C. Kristich, phh6 Gateway destination vector based on pbk200 for fusion to Strep H. He and C. Kristich, phh8 Gateway destination vector based on pjrg9 for fusion to F [3] H. He and C. Kristich, phs12 EF1714-Strep in phh6 This work phs13 EF1714-F [1,2] in phh3 This work phs14 EF1039-F [3] in phh8 This work phs22 ptsh H15A S46A-F [3] in pjrg9 This work puab100 source of mdhfr F [1,2] fragment (9) puab200 source of mdhfr F [3] fragment (9) Supplemental References 1. Gold, O. G., H. V. Jordan, and J. van Houte The prevalence of enterococci in the human mouth and their pathogenicity in animal models. Arch. Oral Biol. 20: Dunny, G. M., B. L. Brown, and D. B. Clewell Induced cell aggregation and mating in Streptococcus faecalis: evidence for a bacterial sex pheromone. Proc. Natl. Acad. Sci. U.S.A. 75: Maekawa, S., M. Yoshioka, and Y. Kumamoto Proposal of a new scheme for the serological typing of Enterococcus faecalis strains. Microbiol Immunol 36: Palmer, K. L., P. Godfrey, A. Griggs, V. N. Kos, J. Zucker, C. Desjardins, G. Cerqueira, D. Gevers, S. Walker, J. Wortman, M. Feldgarden, B. Haas, B. Birren, and M. S. Gilmore Comparative genomics of enterococci: variation in Enterococcus faecalis, clade structure in E. faecium, and defining characteristics of E. gallinarum and E. casseliflavus. MBio 3:e Vesic, D., and C. J. Kristich A Rex family transcriptional repressor influences H 2 O 2 accumulation by Enterococcus faecalis. J. Bacteriol. 195: Kristich, C. J., J. L. Little, C. L. Hall, and J. S. Hoff Reciprocal regulation of cephalosporin resistance in Enterococcus faecalis. MBio 2:e Hayes, F., C. Daly, and G. F. Fitzgerald Identification of the Minimal Replicon of Lactococcus lactis subsp. lactis UC317 Plasmid pci305. Appl. Environ. Microbiol. 56:

6 8. Trieu-Cuot, P., C. Carlier, C. Poyart-Salmeron, and P. Courvalin Shuttle vectors containing a multiple cloning site and a lacz alpha gene for conjugal transfer of DNA from Escherichia coli to gram-positive bacteria. Gene 102: Singh, A., D. Mai, A. Kumar, and A. J. Steyn Dissecting virulence pathways of Mycobacterium tuberculosis through protein-protein association. Proc. Natl. Acad. Sci. U.S.A. 103:

7 Fig S1. Fig S1. Simplified overview of the PTS in Gram-positive bacteria. Enzyme I (Enz I) and HPr are general PTS proteins that function in transport of all PTS substrates. During uptake of carbohydrates that are substrates of the PTS, Enz I uses phosphoenol pyruvate (PEP)) to autophosphorylate. This phosphoryl group is transferred to HPr on His15 in an intermediate step. HPr-His15-P subsequently transfers this phosphoryl group to a carbohydrate-specific transporter known as an Enzyme II ( Enz II). Enz IIs are comprised of several domains, minimally including the Enz IIa, Enz IIb, and integral membrane Enz IIc domains. The phosphoryl group is passed from HPr-His15-P (glucose in this example) that passes through the Enz IIc component. HPr can also be reversibly phosphorylated on Ser46 by the bifunctional kinase/phos phorylase HprK, whose activities are modulatedd by metabolites (not shown). HPr-Ser46-PP interacts as a co-repressor with the DNA-binding transcription factor CcpA, enabling the complex to bind DNA and modulate transcriptionn of target genes (catabolite repression or activation). Our results indicate that HPr can also associate with CroR, the response regulator component of the CroR/S two-component signaling system that is required forr cephalosporin resistance in E. faecalis, to modulate CroR-dependent gene expression and cephalosporin resistance. We have not yet established with isoform of HPr is important for association with CroR and thereforee have depicted potential associations with HPr-His15-P or HPr-Ser46-P. Association of CroR with unphosphorylated HPr is also a formal possibility, although our results suggest this is the least likely to Enz IIa and subsequently to Enz IIb before transfer to the incoming carbohydrate alternative. 7

8 Fig S2. Fig S2. HPr mutants with substitutions at the sites of phosphorylation are impaired at association with CroR. Mutants of E. faecalis HPr with substitutions at the sites of phosphorylation exhibit impaired association with CroR in vivo. (A) E. faecalis strains co-expressing the indicated fusions weree subjected to 10-fold serial dilutions and inoculated on MH agar supplemented with Cm and Em (for plasmid selection) in the presence or absence of trimethoprim. The HPr mutants exhibit a moderately reduced ability to promote growth in the presence of trimethoprim compared to wild-type HPr (colony formation reduced by 10-fold compared to wild-type), OG1RF; plasmid combinations were: plms3289f12 + plms152 (top); plms3289f12 + plms168 (upper middle); plms3289f12 + plms170 (lower middle); and plms3289f12 + phs22 (bottom) (B) Co-immunoprecipitation from E. faecalis lysates using anti-f [3] antisera. Lysates and immunoprecipitates were subjected to immunoblot analysis with antiseraa specific for the strep or F [3] fusions, revealing that CroR no longer co-precipitates with non-phosphorylatable HPr. Host strain was E. faecalis OG1RF; plasmid combinations were: phs11 + plms152 (left lane) and phs11 + phs22 (right lane). Lysates corresponds to the whole-cell lysates used as input for co-immunoprecipitation; IP corresponds to the immune complexes recovered after co-immunoprecipitation. indicative of reduced in vivo association of the fusions. Host strain was E. faecalis 8

9 Fig S3. Fig S3. mdhfr analysis of HPr mutants with impaired CroR association. Mutants of E. faecalis HPr that exhibit impaired association with CroR in vivo weree identified using mdhfr PCA, as described in Materials and Methods. E. faecalis strains co-expressing the indicated fusions were subjected to 10-fold serial dilutions and inoculated on MH agar supplemented with Cm and Em (for plasmid selection) and trimethoprim at 1 μg/ml. Whereas thee wild-type HPr-F [3] fusion enables growth when co-expressed with F [1,2] fusionss of both CroR (left) andd HPr (right),, indicative of in vivo association, the HPr mutants only enable growth when co-expressed with HPr. Host strain was E. faecalis OG1RF. 9

10 Fig S4 Fig S4. HPr point mutants that do not interact with CroR, as determined by mdhfr PCA, also do not co-immunoprecipitate with CroR. Association of CroR and HPr in whole-cell lysates of E. faecalis was assessed by co-immunoprecipitation with anti-f [3] antisera. CroR-Strep was co-expressed with wild-type HPr, HPr E2G, or HPr E70G fused to mdhfr F [3] as indicated. Lysates and immunoprecipitates weree subjected to immunoblot analysis with antisera specific for the Strep or F [3] fusions, revealing that CroR specifically co-precipitates with wild-type HPr but not the HPr mutants. Host strain was E. faecalis OG1RF. Lysates corresponds to the whole-cell lysatess used as input for co-immunoprecipitation; IP corresponds to the immune complexes recovered after coimmunoprecipitation. 10

Supporting Information-Tables

Supporting Information-Tables Supporting Information-Tables Table S1. Bacterial strains and plasmids used in this work Bacterial strains Description Source of reference Streptococcus pneumoniae 1 Cp1015 non-capsulated and βl susceptible

More information

Confirming the Phenotypes of E. coli Strains

Confirming the Phenotypes of E. coli Strains Confirming the Phenotypes of E. coli Strains INTRODUCTION Before undertaking any experiments, we need to confirm that the phenotypes of the E. coli strains we intend to use in the planned experiments correspond

More information

Table S5. Bacterial strains, phages, plasmids and primers.

Table S5. Bacterial strains, phages, plasmids and primers. Table S5. Bacterial strains, phages, plasmids and primers. Strains, phages, plasmids and primers Characteristics and/or description Reference/source Enterococcus faecalis V583 Human blood isolate; Vm R,

More information

BCH 462 Competent Cells Formation and Transformation of Competent Cells with plasmid DNA.

BCH 462 Competent Cells Formation and Transformation of Competent Cells with plasmid DNA. Lab#2 BCH 462 Competent Cells Formation and Transformation of Competent Cells with plasmid DNA. Outlines: 1-Insertion of foreign gene to the plasmid. 2-Competent cell. 3-Transformation of bacterial cell.

More information

The GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity

The GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity Promega Notes Magazine Number 62, 1997, p. 02 The GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity By Christine Andrews and Scott Lesley Promega

More information

The Regulation of Bacterial Gene Expression

The Regulation of Bacterial Gene Expression The Regulation of Bacterial Gene Expression Constitutive genes are expressed at a fixed rate Other genes are expressed only as needed Inducible genes Repressible genes Catabolite repression Pre-transcriptional

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature10163 Supplementary Table 1 Efficiency of vector construction. Process wells recovered efficiency (%) Recombineering* 480 461 96 Intermediate plasmids 461 381 83 Recombineering efficiency

More information

BACTERIAL CONJUGATION. To demonstrate the technical procedure to monitor the conjugational transfer of genetic material from one cell to another.

BACTERIAL CONJUGATION. To demonstrate the technical procedure to monitor the conjugational transfer of genetic material from one cell to another. BACTERIAL CONJUGATION I. OBJECTIVES To demonstrate the technical procedure to monitor the conjugational transfer of genetic material from one cell to another. To learn about the various genetic elements

More information

Yeast Two Hybrid Assay: A Fishing Tale

Yeast Two Hybrid Assay: A Fishing Tale KEYWORDS: yeast two hybrid, molecular interactions, galactose metabolism Special section on techniques: Yeast Two Hybrid Assay: A Fishing Tale Solmaz Sobhanifar Pathology, University of British Columbia

More information

Supplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/-

Supplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- #1074683s 1 Supplemental Online Material Materials and Methods Cell lines and tissue culture The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- knock-out animals

More information

Cloning and Sequencing of the Gene Encoding Curvaticin FS47, an Anti- Listerial Bacteriocin Produced by Lactobacillus curvatus FS47

Cloning and Sequencing of the Gene Encoding Curvaticin FS47, an Anti- Listerial Bacteriocin Produced by Lactobacillus curvatus FS47 Cloning and Sequencing of the Gene Encoding Curvaticin FS47, an Anti- Listerial Bacteriocin Produced by Lactobacillus curvatus FS47 S. Macwana, L. Ma, M.A. Cousin, and P.M. Muriana Story in Brief Curvaticin

More information

All MGC premier clones are 100% guaranteed to match their published sequence.

All MGC premier clones are 100% guaranteed to match their published sequence. MGC premier full length cdna and ORF clones TCH1003, TCM1004, TCR1005, TCB1006, TCL1007, TCT1008, TCZ1009, TOH6003, TOM6004, TOZ6009, TCHS1003, TCMS1004, TCRS1005, TCBS1006, TCLS1007, TCTS1008 MGC premier

More information

REGULATION OF GENE EXPRESSION

REGULATION OF GENE EXPRESSION REGULATION OF GENE EXPRESSION Each cell of a living organism contains thousands of genes. But all genes do not function at a time. Genes function according to requirements of the cell. Genes control the

More information

GENE REGULATION IN PROKARYOTES

GENE REGULATION IN PROKARYOTES GENE REGULATION IN PROKARYOTES Prepared by Brenda Leady, University of Toledo Copyright (c) The McGraw-Hill Companies, Inc. Permission required for reproduction or display. 1 Gene regulation refers to

More information

STRUCTURAL BIOLOGY. α/β structures Closed barrels Open twisted sheets Horseshoe folds

STRUCTURAL BIOLOGY. α/β structures Closed barrels Open twisted sheets Horseshoe folds STRUCTURAL BIOLOGY α/β structures Closed barrels Open twisted sheets Horseshoe folds The α/β domains Most frequent domain structures are α/β domains: A central parallel or mixed β sheet Surrounded by α

More information

Gene Transfer 11/4/13. Fredrick Griffith in the 1920s did an experiment. Not until 1944 was DNA shown to be the moveable element

Gene Transfer 11/4/13. Fredrick Griffith in the 1920s did an experiment. Not until 1944 was DNA shown to be the moveable element Gene Transfer Fredrick Griffith in the 1920s did an experiment. Not until 19 was DN shown to be the moveable element Dead pathogen cells able to make a capsule were able to pass this ability to the live

More information

Answers to Module 1. An obligate aerobe is an organism that has an absolute requirement of oxygen for growth.

Answers to Module 1. An obligate aerobe is an organism that has an absolute requirement of oxygen for growth. Answers to Module 1 Short Answers 1) What is an obligate aerobe? An obligate aerobe is an organism that has an absolute requirement of oxygen for growth. What about facultative anaerobe? 2) Distinguish

More information

ONTARIO SCIENCE CENTRE. Teacher Guide. Way to Glow Program

ONTARIO SCIENCE CENTRE. Teacher Guide. Way to Glow Program ONTARIO SCIENCE CENTRE Teacher Guide Way to Glow Program Table of Contents Bacterial transformation background information 3 Experimental procedure 5 Expected results 7 Post-program activity sheet 8 Post-program

More information

7 Gene Isolation and Analysis of Multiple

7 Gene Isolation and Analysis of Multiple Genetic Techniques for Biological Research Corinne A. Michels Copyright q 2002 John Wiley & Sons, Ltd ISBNs: 0-471-89921-6 (Hardback); 0-470-84662-3 (Electronic) 7 Gene Isolation and Analysis of Multiple

More information

Cassette denotes the ORFs expressed by the expression cassette targeted by the PCR primers used to

Cassette denotes the ORFs expressed by the expression cassette targeted by the PCR primers used to Stanyon, C.A., Limjindaporn, T., and Finley, Jr., R.L. Simultaneous transfer of open reading frames into several different expression vectors. Biotechniques, 35, 520-536, 2003. http://www.biotechniques.com

More information

Self-test Quiz for Chapter 12 (From DNA to Protein: Genotype to Phenotype)

Self-test Quiz for Chapter 12 (From DNA to Protein: Genotype to Phenotype) Self-test Quiz for Chapter 12 (From DNA to Protein: Genotype to Phenotype) Question#1: One-Gene, One-Polypeptide The figure below shows the results of feeding trials with one auxotroph strain of Neurospora

More information

The Two-Hybrid System

The Two-Hybrid System Encyclopedic Reference of Genomics and Proteomics in Molecular Medicine The Two-Hybrid System Carolina Vollert & Peter Uetz Institut für Genetik Forschungszentrum Karlsruhe PO Box 3640 D-76021 Karlsruhe

More information

AP Biology Gene Expression/Biotechnology REVIEW

AP Biology Gene Expression/Biotechnology REVIEW AP Biology Gene Expression/Biotechnology REVIEW Multiple Choice Identify the choice that best completes the statement or answers the question. 1. Gene expression can be a. regulated before transcription.

More information

Supplemental Materials. DNA preparation. Dehalogenimonas lykanthroporepellens strain BL-DC-9 T (=ATCC

Supplemental Materials. DNA preparation. Dehalogenimonas lykanthroporepellens strain BL-DC-9 T (=ATCC Supplemental Materials DNA preparation. Dehalogenimonas lykanthroporepellens strain BL-DC-9 T (=ATCC BAA-1523 = JCM 15061) was grown in defined basal medium amended with 0.5 mm 1,1,2- trichloroethane (1,1,2-TCA)

More information

The Mosaic Nature of Genomes

The Mosaic Nature of Genomes The Mosaic Nature of Genomes n DNA sequence is not static Mutations of single bases Large deletions Large insertions of sequence n Transferred from other species n New functions useful in particular situations

More information

CHAPTER 9 DNA Technologies

CHAPTER 9 DNA Technologies CHAPTER 9 DNA Technologies Recombinant DNA Artificially created DNA that combines sequences that do not occur together in the nature Basis of much of the modern molecular biology Molecular cloning of genes

More information

KOD -Plus- Mutagenesis Kit

KOD -Plus- Mutagenesis Kit Instruction manual KOD -Plus- Mutagenesis Kit 0811 F0936K KOD -Plus- Mutagenesis Kit SMK-101 20 reactions Store at -20 C Contents [1] Introduction [2] Flow chart [3] Components [4] Notes [5] Protocol 1.

More information

Lecture 25 (11/15/17)

Lecture 25 (11/15/17) Lecture 25 (11/15/17) Reading: Ch9; 328-332 Ch25; 990-995, 1005-1012 Problems: Ch9 (study-guide: applying); 1,2 Ch9 (study-guide: facts); 7,8 Ch25 (text); 1-3,5-7,9,10,13-15 Ch25 (study-guide: applying);

More information

Recombinant DNA Technology. The Role of Recombinant DNA Technology in Biotechnology. yeast. Biotechnology. Recombinant DNA technology.

Recombinant DNA Technology. The Role of Recombinant DNA Technology in Biotechnology. yeast. Biotechnology. Recombinant DNA technology. PowerPoint Lecture Presentations prepared by Mindy Miller-Kittrell, North Carolina State University C H A P T E R 8 Recombinant DNA Technology The Role of Recombinant DNA Technology in Biotechnology Biotechnology?

More information

Microbial Biotechnology agustin krisna wardani

Microbial Biotechnology agustin krisna wardani Microbial Biotechnology agustin krisna wardani 1. The Structure of Microbes Microbes (microorganisms) are tiny organisms that are too small to be seen individually by the naked eye and must be viewed with

More information

Antisense RNA Insert Design for Plasmid Construction to Knockdown Target Gene Expression

Antisense RNA Insert Design for Plasmid Construction to Knockdown Target Gene Expression Vol. 1:7-15 Antisense RNA Insert Design for Plasmid Construction to Knockdown Target Gene Expression Ji, Tom, Lu, Aneka, Wu, Kaylee Department of Microbiology and Immunology, University of British Columbia

More information

Bacterial defense mechanisms against bacteriophages. B.G.E.T Jayashantha B.Sc (ug) Microbiology (Special), University of Kelaniya, Sri Lanka

Bacterial defense mechanisms against bacteriophages. B.G.E.T Jayashantha B.Sc (ug) Microbiology (Special), University of Kelaniya, Sri Lanka Bacterial defense mechanisms against bacteriophages B.G.E.T Jayashantha B.Sc (ug) Microbiology (Special), University of Kelaniya, Sri Lanka Objective To study the defense mechanisms associated with bacteria

More information

2054, Chap. 13, page 1

2054, Chap. 13, page 1 2054, Chap. 13, page 1 I. Microbial Recombination and Plasmids (Chapter 13) A. recombination = process of combining genetic material from 2 organisms to produce a genotype different from either parent

More information

Requirement for a Functional int Product in Temperature Inductions of

Requirement for a Functional int Product in Temperature Inductions of JOURNAL OF VIROLOGY, SePt. 1970, p. 320-325 Vol. 6, No. 3 Copyright 1970 American Society for Microbiology Prinited in U.S.A. Requirement for a Functional int Product in Temperature Inductions of Prophage

More information

Lectures of Dr.Mohammad Alfaham. The Bacterial Genetics

Lectures of Dr.Mohammad Alfaham. The Bacterial Genetics Lectures of Dr.Mohammad Alfaham The Bacterial Genetics is the total collection of genes carried by a bacterium both on its chromosome and on its extrachromosomal genetic elements (plasmids) A Gene A gene

More information

Optimizing Synthetic DNA for Metabolic Engineering Applications. Howard Salis Penn State University

Optimizing Synthetic DNA for Metabolic Engineering Applications. Howard Salis Penn State University Optimizing Synthetic DNA for Metabolic Engineering Applications Howard Salis Penn State University Synthetic Biology Specify a function Build a genetic system (a DNA molecule) Genetic Pseudocode call producequorumsignal(luxi

More information

TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter

TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter L M Guzman et al. (1995) Journal of Bacteriology 177: 4121-4130 Outline 1. Introduction 2. Objective 3.

More information

7.06 Cell Biology EXAM #2 March 20, 2003

7.06 Cell Biology EXAM #2 March 20, 2003 7.06 Cell Biology EXAM #2 March 20, 2003 This is an open book exam, and you are allowed access to books, a calculator, and notes but not computers or any other types of electronic devices. Please write

More information

Spostiamo ora la nostra attenzione sui batteri, e batteriofagi

Spostiamo ora la nostra attenzione sui batteri, e batteriofagi Spostiamo ora la nostra attenzione sui batteri, e batteriofagi Bacteria Mutate Spontaneously and Grow at an Exponential Rate. Useful for genetics studies, development of genetic engineering Teoria dell'adattamento

More information

Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling

Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Glendining KA 1, Markie D 2, Gardner RJM 4, Franz EA 3, Robertson SP 4, Jasoni CL 1 Supplementary

More information

How Do You Clone a Gene?

How Do You Clone a Gene? S-20 Edvo-Kit #S-20 How Do You Clone a Gene? Experiment Objective: The objective of this experiment is to gain an understanding of the structure of DNA, a genetically engineered clone, and how genes are

More information

Efficient Multi-site-directed Mutagenesis directly from Genomic Template.

Efficient Multi-site-directed Mutagenesis directly from Genomic Template. Efficient Multi-site-directed Mutagenesis directly from Genomic Template. Fengtao Luo 1, Xiaolan Du 1, Tujun Weng 1, Xuan Wen 1, Junlan Huang 1, Lin Chen 1 Running title: Multi-site-directed Mutagenesis

More information

7.1 The lac Operon 7-1

7.1 The lac Operon 7-1 7.1 The lac Operon The lac operon was the first operon discovered It contains 3 genes coding for E. coli proteins that permit the bacteria to use the sugar lactose Galactoside permease (lacy) which transports

More information

Einführung in die Genetik

Einführung in die Genetik Einführung in die Genetik Prof. Dr. Kay Schneitz (EBio Pflanzen) http://plantdev.bio.wzw.tum.de schneitz@wzw.tum.de Prof. Dr. Claus Schwechheimer (PlaSysBiol) http://wzw.tum.de/sysbiol claus.schwechheimer@wzw.tum.de

More information

The dialkylglycine decarboxylase repressor DgdR. Functional aspects and relation to other LysR proteins

The dialkylglycine decarboxylase repressor DgdR. Functional aspects and relation to other LysR proteins 11/29/2011 1 The dialkylglycine decarboxylase repressor DgdR. Functional aspects and relation to other LysR proteins 1. Dialkylglycine amino acids 2. In vivo and in vitro studies on the DgdR repressor

More information

Genetics Lecture Notes Lectures 17 19

Genetics Lecture Notes Lectures 17 19 Genetics Lecture Notes 7.03 2005 Lectures 17 19 Lecture 17 Gene Regulation We are now going to look at ways that genetics can be used to study gene regulation. The issue is how cells adjust the expression

More information

GeNei TM Transformation Teaching Kit Manual

GeNei TM Transformation Teaching Kit Manual Teaching Kit Manual Cat No. New Cat No. KT07 107385 KT07A 106220 Revision No.: 00060505 CONTENTS Page No. Objective 3 Principle 3 Kit Description 6 Materials Provided 7 Procedure 9 Observation & Interpretation

More information

TECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits

TECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits Catalog Numbers APPA001 In Vitro Bacterial Split GFP "Fold 'n' Glow" Solubility Assay Kit (Green) APPA008 In Vitro Bacterial

More information

How antimicrobial agents work

How antimicrobial agents work Physical and Chemical Control of Microbes Physical Agents heat or radiation Chemical Agents disinfectants or antiseptics Important Terms 1. Sterilization process of killing all viable microbes 2. Bactericide

More information

320 MBIO Microbial Diagnosis. Aljawharah F. Alabbad Noorah A. Alkubaisi 2017

320 MBIO Microbial Diagnosis. Aljawharah F. Alabbad Noorah A. Alkubaisi 2017 320 MBIO Microbial Diagnosis Aljawharah F. Alabbad Noorah A. Alkubaisi 2017 Primary Media for Isolation of Microorganisms As we know, many clinical specimens contain a mixed flora of microorganisms. Thus

More information

Molecular Cell Biology - Problem Drill 11: Recombinant DNA

Molecular Cell Biology - Problem Drill 11: Recombinant DNA Molecular Cell Biology - Problem Drill 11: Recombinant DNA Question No. 1 of 10 1. Which of the following statements about the sources of DNA used for molecular cloning is correct? Question #1 (A) cdna

More information

Patentability/Literature Research

Patentability/Literature Research Patentability/Literature Research The probiotic-based solution to combat cholera as presented here comprises of two major innovative components: (1) the metabolite-dependent pathogen inhibition by a probiotic

More information

pvivo1-gfp/lacz An innovative multigenic plasmid for high levels of expression of the GFP and LacZ reporter genes in tumors Catalog # pvivo1-gfp-lacz

pvivo1-gfp/lacz An innovative multigenic plasmid for high levels of expression of the GFP and LacZ reporter genes in tumors Catalog # pvivo1-gfp-lacz pvivo1-gfp/lacz An innovative multigenic plasmid for high levels of expression of the GFP and LacZ reporter genes in tumors Catalog # pvivo1-gfp-lacz For research use only Version # 12H31-MM PROduCT information

More information

Supplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons

Supplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons Neuron, Volume 61 Supplemental Data LMO4 Controls the Balance between Excitatory and Inhibitory Spinal V2 Interneurons Kaumudi Joshi, Seunghee Lee, Bora Lee, Jae W. Lee, and Soo-Kyung Lee Supplemental

More information

HI-Control BL21(DE3) & HI-Control 10G Chemically Competent Cells

HI-Control BL21(DE3) & HI-Control 10G Chemically Competent Cells HI-Control BL21(DE3) & HI-Control 10G Chemically Competent Cells FOR RESEARCH USE ONLY. NOT FOR HUMAN OR DIAGNOSTIC USE MA156 Rev.31OCT2016 Table of Contents Components & Storage Conditions... 3 HI-Control

More information

Diversity of the fsr-gele Region of the Enterococcus faecalis Genome but Conservation in Strains with Partial Deletions of the fsr Operon

Diversity of the fsr-gele Region of the Enterococcus faecalis Genome but Conservation in Strains with Partial Deletions of the fsr Operon APPLIED AND ENVIRONMENTAL MICROBIOLOGY, Jan. 2011, p. 442 451 Vol. 77, No. 2 0099-2240/11/$12.00 doi:10.1128/aem.00756-10 Copyright 2011, American Society for Microbiology. All Rights Reserved. Diversity

More information

Cloning and Expression of a Haloacid Dehalogenase Enzyme. By: Skyler Van Senior Research Advisor: Dr. Anne Roberts

Cloning and Expression of a Haloacid Dehalogenase Enzyme. By: Skyler Van Senior Research Advisor: Dr. Anne Roberts Cloning and Expression of a Haloacid Dehalogenase Enzyme By: Skyler Van Senior Research Advisor: Dr. Anne Roberts utline The gene being cloned is JHP1130 from Helicobacter pylori (H. pylori) JHP1130 is

More information

Received 31 October 1996/Accepted 18 March 1997

Received 31 October 1996/Accepted 18 March 1997 JOURNAL OF BACTERIOLOGY, May 1997, p. 3250 3259 Vol. 179, No. 10 0021-9193/97/$04.00 0 Copyright 1997, American Society for Microbiology Regulation of Transfer of the Enterococcus faecalis Pheromone- Responding

More information

Section A: Prokaryotes Types and Structure 1. What is microbiology?

Section A: Prokaryotes Types and Structure 1. What is microbiology? Section A: Prokaryotes Types and Structure 1. What is microbiology? 2. Compare and contrast characteristics of each bacterial type: Eubacteria and Archaebacteria. Eubacteria Both Archaebacteria 3. Label

More information

MIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr.

MIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. MIT Department of Biology 7.01: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. Claudette Gardel iv) Would Xba I be useful for cloning? Why or why not?

More information

BETA STRAND Prof. Alejandro Hochkoeppler Department of Pharmaceutical Sciences and Biotechnology University of Bologna

BETA STRAND Prof. Alejandro Hochkoeppler Department of Pharmaceutical Sciences and Biotechnology University of Bologna Prof. Alejandro Hochkoeppler Department of Pharmaceutical Sciences and Biotechnology University of Bologna E-mail: a.hochkoeppler@unibo.it C-ter NH and CO groups: right, left, right (plane of the slide)

More information

Cell Growth and DNA Extraction- Technion igem HS

Cell Growth and DNA Extraction- Technion igem HS Growing Cells and DNA Extraction Goals 1. Become familiar with the process of growing bacteria 2. Get to know the DNA extraction process 3. Perform miniprep in the lab Keywords 1. Growth stages 6. Techniques

More information

Supplemental Information. Natural RNA Polymerase Aptamers. Regulate Transcription in E. coli

Supplemental Information. Natural RNA Polymerase Aptamers. Regulate Transcription in E. coli Molecular Cell, Volume 67 Supplemental Information Natural RNA Polymerase Aptamers Regulate Transcription in E. coli Nadezda Sedlyarova, Philipp Rescheneder, Andrés Magán, Niko Popitsch, Natascha Rziha,

More information

CHAPTER 20 DNA TECHNOLOGY AND GENOMICS. Section A: DNA Cloning

CHAPTER 20 DNA TECHNOLOGY AND GENOMICS. Section A: DNA Cloning Section A: DNA Cloning 1. DNA technology makes it possible to clone genes for basic research and commercial applications: an overview 2. Restriction enzymes are used to make recombinant DNA 3. Genes can

More information

Genome Sequence Assembly

Genome Sequence Assembly Genome Sequence Assembly Learning Goals: Introduce the field of bioinformatics Familiarize the student with performing sequence alignments Understand the assembly process in genome sequencing Introduction:

More information

Lecture 9 Controlling gene expression

Lecture 9 Controlling gene expression Lecture 9 Controlling gene expression BIOLOGY Campbell, Reece and Mitchell Chapter 18 334- (352-356) Every cell in your body contains the same number of genes approximately 35, 000 DNA is wound around

More information

Einführung in die Genetik

Einführung in die Genetik Einführung in die Genetik Prof. Dr. Kay Schneitz (EBio Pflanzen) http://plantdev.bio.wzw.tum.de schneitz@wzw.tum.de Twitter: @PlantDevTUM, #genetiktum FB: Plant Development TUM Prof. Dr. Claus Schwechheimer

More information

Supporting Information

Supporting Information Supporting Information Beauregard et al. 10.1073/pnas.1218984110 Fig. S1. Model depicting the regulatory pathway leading to expression of matrix genes. The master regulator Spo0A can be directly or indirectly

More information

SuperScript IV Reverse Transcriptase as a better alternative to AMV-based enzymes

SuperScript IV Reverse Transcriptase as a better alternative to AMV-based enzymes WHITE PAPER SuperScript IV Reverse Transcriptase SuperScript IV Reverse Transcriptase as a better alternative to AMV-based enzymes Abstract Reverse transcriptases (RTs) from avian myeloblastosis virus

More information

6/28/2016. Control of Microbial Growth. Method. Terminology. Disinfectants and Antiseptics

6/28/2016. Control of Microbial Growth. Method. Terminology. Disinfectants and Antiseptics Control of Microbial Growth Disinfectants and Antiseptics 1 Method Three approaches for the control of microbial growth Chemical Disinfectants and antiseptics Physical Heat Ultraviolet Irradiations Mechanical

More information

Bio 311 Learning Objectives

Bio 311 Learning Objectives Bio 311 Learning Objectives This document outlines the learning objectives for Biol 311 (Principles of Genetics). Biol 311 is part of the BioCore within the Department of Biological Sciences; therefore,

More information

DNA Structure and Properties Basic Properties Predicting Melting Temperature. Dinesh Yadav

DNA Structure and Properties Basic Properties Predicting Melting Temperature. Dinesh Yadav DNA Structure and Properties Basic Properties Predicting Melting Temperature Dinesh Yadav Nucleic Acid Structure Question: Is this RNA or DNA? Molecules of Life, pp. 15 2 Nucleic Acid Bases Molecules of

More information

The Fertility Factor, or F

The Fertility Factor, or F The Fertility Factor, or F Pili Contains pili genes, tra genes, replication genes, but no genes essential for cell survival or growth. Chromosome F factor 100,000 bp Closely related R factor contains multiply

More information

GENE REGULATION slide shows by Kim Foglia modified Slides with blue edges are Kim s

GENE REGULATION slide shows by Kim Foglia modified Slides with blue edges are Kim s GENE REGULATION slide shows by Kim Foglia modified Slides with blue edges are Kim s 2007-2008 Bacterial metabolism Bacteria need to respond quickly to changes in their environment STOP GO if they have

More information

SI Results Peculiarities in the consumption of ammonium and glucose by AmtB- strains SI Materials and Methods Strain Construction

SI Results Peculiarities in the consumption of ammonium and glucose by AmtB- strains SI Materials and Methods Strain Construction SI Results Peculiarities in the consumption of ammonium and glucose by AmtB - strains. The AmtB - strain failed to consume all the ammonium in the medium under NH 3 -limiting conditions (.5 mm total ammonium

More information

Heterologous protein expression systems

Heterologous protein expression systems IMBB-FORTH Heterologous protein expression systems What are they? Protein expression systems producing desired polypeptides from recombinant genes. Plasmids carry and express the desired recombinant genes

More information

Viruses and Bacteria Notes

Viruses and Bacteria Notes Viruses and Bacteria Notes A. Virus Structure: Viruses are in contrast to bacteria. Viruses are (DNA or RNA) enclosed in a coat called a. Also some viruses have a that helps them infect their host. These

More information

Cloning and Characterization of E. meningoseptica Beta Lactamase

Cloning and Characterization of E. meningoseptica Beta Lactamase Cloning and Characterization of E. meningoseptica Beta Lactamase Authors: Lindsey Purcell, Jessica Matts, Patricia Canaan* Department of Biochemistry and Molecular Biology Abstract Elizabethkingia meningoseptica

More information

Supplemental Fig. S1. Key to underlines: Key to amino acids:

Supplemental Fig. S1. Key to underlines: Key to amino acids: AspA-F1 AspA 1 MKQMETKGYGYFRKTKAYGLVCGIT--------------LAGALTLGTTSVSADDVTTLNPATNLTTLQTPPTADQTQLAHQAGQQSGELVSEVSNTEWD 86 SspB 1 MQKREV--FG-FRKSKVAKTLCGAV-LGAALIAIADQQVLADEVTETNSTANVAVTTTGNPATNLPEAQGEATEAASQSQAQAGSKDGALPVEVSADDLN

More information

3 Designing Primers for Site-Directed Mutagenesis

3 Designing Primers for Site-Directed Mutagenesis 3 Designing Primers for Site-Directed Mutagenesis 3.1 Learning Objectives During the next two labs you will learn the basics of site-directed mutagenesis: you will design primers for the mutants you designed

More information

Eukaryotic Transcription

Eukaryotic Transcription Eukaryotic Transcription I. Differences between eukaryotic versus prokaryotic transcription. II. (core vs holoenzyme): RNA polymerase II - Promotor elements. - General Pol II transcription factors (GTF).

More information

CONFIRMING LOCATION OF NITROGEN FIXING GENES ON PLASMIDS IN RHIZOBIUM ISOLATED FROM PISUM SATIVUM

CONFIRMING LOCATION OF NITROGEN FIXING GENES ON PLASMIDS IN RHIZOBIUM ISOLATED FROM PISUM SATIVUM CONFIRMING LOCATION OF NITROGEN FIXING GENES ON PLASMIDS IN RHIZOBIUM ISOLATED FROM PISUM SATIVUM Balaji Hajare and Avinash Ade 1 Department of Botany, Dr. B. A. M. University, Aurangabad, 431004 (MS)

More information

2054, Chap. 14, page 1

2054, Chap. 14, page 1 2054, Chap. 14, page 1 I. Recombinant DNA technology (Chapter 14) A. recombinant DNA technology = collection of methods used to perform genetic engineering 1. genetic engineering = deliberate modification

More information

Enterococcus faecium. genesig Standard Kit. groes heat shock protein. 150 tests. Primerdesign Ltd. For general laboratory and research use only

Enterococcus faecium. genesig Standard Kit. groes heat shock protein. 150 tests. Primerdesign Ltd. For general laboratory and research use only TM Primerdesign Ltd Enterococcus faecium groes heat shock protein genesig Standard Kit 150 tests For general laboratory and research use only 1 Introduction to Enterococcus faecium E. faecium is a Gram-positive,

More information

Split-Operon Control of a Prophage Gene*

Split-Operon Control of a Prophage Gene* Proceeding8 of the National Academy of Sciences Vol. 65, No. 2, pp. 331-336, February 1970 Split-Operon Control of a Prophage Gene* L. Elizabeth Bertani DEPARTMENT OF MICROBIAL GENETICS, KAROLINSKA INSTITUTET,

More information

Solutions to Quiz II

Solutions to Quiz II MIT Department of Biology 7.014 Introductory Biology, Spring 2005 Solutions to 7.014 Quiz II Class Average = 79 Median = 82 Grade Range % A 90-100 27 B 75-89 37 C 59 74 25 D 41 58 7 F 0 40 2 Question 1

More information

Transcription in Prokaryotes. Jörg Bungert, PhD Phone:

Transcription in Prokaryotes. Jörg Bungert, PhD Phone: Transcription in Prokaryotes Jörg Bungert, PhD Phone: 352-273-8098 Email: jbungert@ufl.edu Objectives Understand the basic mechanism of transcription. Know the function of promoter elements and associating

More information

Genetic Engineering for Biofuels Production

Genetic Engineering for Biofuels Production Genetic Engineering for Biofuels Production WSE 573 Spring 2013 Greeley Beck INTRODUCTION Alternative transportation fuels are needed in the United States because of oil supply insecurity, oil price increases,

More information

Biosolar Conversion of N2 and H2O to Ammonia by Engineered N2-fixing Cyanobacteria

Biosolar Conversion of N2 and H2O to Ammonia by Engineered N2-fixing Cyanobacteria The Journal of Undergraduate Research Volume 9 Journal of Undergraduate Research, Volume 9: 2011 Article 16 2011 Biosolar Conversion of N2 and H2O to Ammonia by Engineered N2-fixing Cyanobacteria Seth

More information

UNIVERSITY OF YORK BA, BSc, and MSc Degree Examinations

UNIVERSITY OF YORK BA, BSc, and MSc Degree Examinations Examination Candidate Number: Desk Number: UNIVERSITY OF YORK BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Bacterial pathogenesis Time Allowed: 2 hours Marking Scheme:

More information

Learning Objectives :

Learning Objectives : Learning Objectives : Understand the basic differences between genomic and cdna libraries Understand how genomic libraries are constructed Understand the purpose for having overlapping DNA fragments in

More information

Bi 8 Lecture 7. Ellen Rothenberg 26 January Reading: Ch. 3, pp ; panel 3-1

Bi 8 Lecture 7. Ellen Rothenberg 26 January Reading: Ch. 3, pp ; panel 3-1 Bi 8 Lecture 7 PROTEIN STRUCTURE, Functional analysis, and evolution Ellen Rothenberg 26 January 2016 Reading: Ch. 3, pp. 109-134; panel 3-1 (end with free amine) aromatic, hydrophobic small, hydrophilic

More information

Einführung in die Genetik

Einführung in die Genetik Einführung in die Genetik Prof. Dr. Kay Schneitz (EBio Pflanzen) http://plantdev.bio.wzw.tum.de schneitz@wzw.tum.de Prof. Dr. Claus Schwechheimer (PlaSysBiol) http://wzw.tum.de/sysbiol claus.schwechheimer@wzw.tum.de

More information

Introducing new DNA into the genome requires cloning the donor sequence, delivery of the cloned DNA into the cell, and integration into the genome.

Introducing new DNA into the genome requires cloning the donor sequence, delivery of the cloned DNA into the cell, and integration into the genome. Key Terms Chapter 32: Genetic Engineering Cloning describes propagation of a DNA sequence by incorporating it into a hybrid construct that can be replicated in a host cell. A cloning vector is a plasmid

More information

Multiple choice questions (numbers in brackets indicate the number of correct answers)

Multiple choice questions (numbers in brackets indicate the number of correct answers) 1 Multiple choice questions (numbers in brackets indicate the number of correct answers) February 1, 2013 1. Ribose is found in Nucleic acids Proteins Lipids RNA DNA (2) 2. Most RNA in cells is transfer

More information

Genetics - Problem Drill 19: Dissection of Gene Function: Mutational Analysis of Model Organisms

Genetics - Problem Drill 19: Dissection of Gene Function: Mutational Analysis of Model Organisms Genetics - Problem Drill 19: Dissection of Gene Function: Mutational Analysis of Model Organisms No. 1 of 10 1. The mouse gene knockout is based on. (A) Homologous recombination (B) Site-specific recombination

More information

Cloning Multiple Gateway Reaction

Cloning Multiple Gateway Reaction Cloning Multiple Gateway Reaction by A. Untergasser (contact address and download at www.untergasser.de/lab) Version: 1.0 - Print Version (.PDF) ATTENTION: This is not something what is done with low quality

More information

Some types of Mutagenesis

Some types of Mutagenesis Mutagenesis What Is a Mutation? Genetic information is encoded by the sequence of the nucleotide bases in DNA of the gene. The four nucleotides are: adenine (A), thymine (T), guanine (G), and cytosine

More information

1a. What is the ratio of feathered to unfeathered shanks in the offspring of the above cross?

1a. What is the ratio of feathered to unfeathered shanks in the offspring of the above cross? Problem Set 5 answers 1. Whether or not the shanks of chickens contains feathers is due to two independently assorting genes. Individuals have unfeathered shanks when they are homozygous for recessive

More information

7.02/ Genetics Exam Study Questions Spring The exam will be: Thursday, April 27 th, :05-11:55 AM Walker Gym, 3 rd floor (50-340)

7.02/ Genetics Exam Study Questions Spring The exam will be: Thursday, April 27 th, :05-11:55 AM Walker Gym, 3 rd floor (50-340) 7.02/10.702 Genetics Exam Study Questions Spring 2006 Annoucements: The exam will be: Thursday, April 27 th, 2006 11:05-11:55 AM Walker Gym, 3 rd floor (50-340) Please note that these practice questions

More information