driven by unfolded protein response elements-upre s). E. coli BL21(DE3) lysogens
|
|
- Cora Leonard
- 5 years ago
- Views:
Transcription
1 Supporting Online Material Materials and Methods Strains and Plasmids: The ire1 yeast strain PWY260 ( ire1::trp1; his3-11,-15::his + UPRE-lacZ; leu2-3,- 112::LEU2 + UPRE-lacZ; ura3-1) used in this study is in a W303 background (R. Rothstein, Columbia Univ.) and has two integrated β-galactosidase-encoding genes driven by unfolded protein response elements-upre s). E. coli BL21(DE3) lysogens were used for expression of Ire1*, using the His 6 -tag-encoding bacterial expression vector pet-28a(+) (Novagen). All CEN-ARS low copy yeast-shuttle vectors, used to carry IRE1 variant genes, were derivatives of YCplac33 (S1), and were used to transform PWY260 using lithium acetate. The IRE1 gene used in all shuttle vectors was contained on a 5 kb XhoI/HindIII genomic fragment. A 2-step PCR was used to insert a DNA cassette encoding one HA epitope at the 3 end of all IRE1 gene ORF s. All yeast methodologies were based on standard protocols (S2). Cloning was through standard protocols (S3), and site-directed mutagenesis employed the Quikchange kit (Stratagene). Mutant genes were sequenced in their entirety on both strands. IRE1 C derived through random PCR mutagenesis of the ER lumenal domain contains nine missense mutations (R2G, I21V, E69V, S103P, E167D, Q272R, F377S, L466S, K510R); these mutations are currently being deconvoluted for their contribution to the constitutive-on phenotype. Enzyme Assays: β-galactosidase assays were carried out through modification of a published protocol (S4). Yeast cells growing logarithmically in SD minus uracil + 100µg/ml inositol media
2 were treated with 20µM 1NM-PP1 (1NM-PP1 co-factor stimulation of 1NM-PP1- sensitized Ire1-containing cells was found to increase linearly from 500nM concentrations till it peaked at 20µM) diluted from a 10mM stock in DMSO or with an equivalent volume of DMSO for 5 minutes, before DTT was added (or not) to a final concentration of 2 mm from a freshly made 1M stock solution. Cells were harvested 40 minutes later by centrifugation, lysed in 400µL of a solution of 40% v/v Y-PER (Pierce) in 1x Z buffer containing 0.8 mg/ml ONPG. After incubation at 32 o C, reactions were quenched with an equal volume of 1M Na 2 CO 3. LacZ arbitrary units (a.u.) are defined as (OD 420 x 1000)/(OD 600 x t x v), where v is the volume of the sample used for the assay, and t is the time of incubation of the reaction at 32 o C. Values for LacZ a.u. s were expressed as the mean + SEM of three independent transformants for each condition tested. Recombinant Ire1* proteins were purified from BL21(DE3) lysogenic E. coli cells harboring pet28-a(+) plasmids (see above) which encoded wild-type and mutant Ire cytosolic domains (kinase+rnase), residues L of logarithmically-growing cells in LB-kanamycin were induced with 1mM IPTG for 4 hrs and the culture incubated overnight at 4 o C before harvest (we found increased enzymatic activity with this manipulation). Cells were lysed with lysozyme and sonication using buffers described in the Qiexpressionist protocol (Qiagen). PMSF at 100µM and Complete Protease Inhibitors (Roche) were used in all buffers. Purification was through Ni-NTA agarose (Qiagen). Elution was with 250mM Imidizole containing buffer. Proteins were exchanged into kinase buffer (9) though two consecutive centrifugations using 30kD-cutoff Centricon
3 devices (Amicon). Glycerol was added to protein solutions at 10% final concentration before flash-freezing in liquid nitrogen. We found that Ire1* aliquots could be stored for several months at -80 o C without loss of activity. Kinase assays were as described (9), except that 20µM 1NM-PP1, or an equivalent volume of DMSO carrier was added for 5 minutes prior to incubation with [γ- 32 P] labeled ATP at 30 o C. The kinase reactions with [γ- 32 P]-labeled N-6 benzyl ATP utilized 100µM cold N-6 benzyl ATP, to which 5 µci of [γ- 32 P]-labeled N-6 benzyl ATP (specific activity 6,000Ci/mmol, 5mCi/mL) was added. Ire1 RNase assays using in vitro transcribed HAC1 600 RNA have been described (9). The only modification of the reported protocol for this study was the addition of either 20µM 1NM-PP1 or 2mM ADP for 5 minutes prior to incubation with the RNA substrate. DMSO concentrations were adjusted to equivalent amounts in all reactions. Velocity sedimentation analysis used 25µg Ire1*, which was centrifuged through 4 ml 25-35% glycerol density gradients in kinase buffer (9) for 20 hrs at 60,000 rpm in a SW60 rotor (Beckman). After fractionation using a Foxy Jr. fraction collector (Isco) into 250µL fractions, proteins were electrophoresed through SDS-PAGE gels, blotted to nitrocellulose, probed with an anti-yeast Ire1 polyclonal antibody, and developed by ECL. 1NM-PP1 synthesis has been described (12).
4 Northern and Western Analysis: Northern blot analysis to detect HAC1 u and HAC1 i mrna species and western analysis to detect Hac1 protein has been described (8). A 5 exon HAC1 32 P body-labelled probe was used for detection of HAC1 mrna splicing. All protein samples from yeast cells were isolated by glass bead lysis in 8M urea, 2.5% SDS, 50mM HEPES (ph 7.6). After clarification of unbroken cells and debris in a microfuge, the extracts were flash-frozen in liquid nitrogen and stored at -80 o C. The anti-hac1 i polyclonal antibody was used at 1:10,000. A donkey anti-rabbit HRP conjugate (Amersham) secondary antibody was used for detection using ECL (Pierce). Anti-HA HRP conjugate used to detect HA-tagged Ire1p s was purchased from Roche and used at 1:1500 dilution. Microarray Analysis: The yeast strain PWY260 harboring either a wild-type or kinase-dead, 1NM-PP1- sensitized IRE1 gene (L745A,D828A) on the low-copy Ycplac33 vector (or a Ycplac33 vector alone control) was grown at 30 C in SD minus uracil+100µg/ml inositol to an OD 600 of µM 1NM-PP1 in DMSO was added to all cultures and growth continued for 5 minutes, before 2mM DTT (diluted from a freshly made 1M solution) was added. Growth of cultures was continued for either 25 or 50 minutes, cells harvested by filtration, flash-frozen in liquid nitrogen, and stored at -80 C overnight. Total and poly(a) RNA were isolated as described, and poly(a) RNA was reverse-transcribed with StrataScript (Stratagene) incorporating amino-allyl dutp (Sigma) at a ratio of 3:2 with dttp (19). The resulting cdnas were labeled by using monofunctional reactive Cy3 and
5 Cy5 dyes (Amersham Pharmacia) in the presence of sodium bicarbonate. All other manipulations were through standard protocols (19). The analysis and presentation of the data were performed using the software tools GENEPIX PRO (Axon Instruments, Union City, CA), and Microsoft EXCEL. Figures S1, S2, S3. Excel spreadsheets, and corresponding x-y scatter plots (log 10 ), showing mrna levels for all yeast genes, analyzed through genomic microarray analysis (see above) for the following genotypes: S1: IRE1(wt) vs. ire1, S2: IRE1(L745A,D828A) vs. ire1, and S2: IRE1(wt) vs. IRE1(L745A,D828A). For all three experiments, pink dots are genes >2 fold expressed in the IRE1(wt) vs. ire1 experiment. These include the previously described canonical UPR targets (20) see individual spreadsheets. Blue dots represent the rest of the transcriptome. Total fluorescence in the Cy3 and Cy5 channels was equalized during the analyses for normalization. References S1. R. D. Gietz, A. Sugino, Gene 74, 527 (1988). S2. F. Sherman, G. R. Fink, J. B. Hicks, Methods in Yeast Genetics (Cold Spring Harbor Laboratory, New York, 1986). S3. F. M. Ausubel, e. al., Current Protocols in Molecular Biology (John Wiley and Sons, New York, 1989). S4. H. O. Park, E. A. Craig, Mol Cell Biol 9, 2025 (1989).
Yeast Nuclei Isolation Kit
Yeast Nuclei Isolation Kit Catalog Number KA3951 50 assays Version: 02 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Intended Use... 3 Background... 3 General Information...
More informationAnalysing protein protein interactions using a GST-fusion protein to pull down the interacting target from the cell lysate Hong Wang and Xin Zeng
Analysing protein protein interactions using a GST-fusion protein to pull down the interacting target from the cell lysate Hong Wang and Xin Zeng Department of Molecular Genetics, Biochemistry and Microbiology,
More information1. Cross-linking and cell harvesting
ChIP is a powerful tool that allows the specific matching of proteins or histone modifications to regions of the genome. Chromatin is isolated and antibodies to the antigen of interest are used to determine
More informationSupplemental Experimental Procedures
Supplemental Experimental Procedures Generation of BLM protein segments and mutants. For immunoprecipitation experiments with topoisomerase IIα, BLM N-terminal segments were generated by PCR amplification
More informationMIAME. URL: Relationships between samples, arrays and hybridizations:
MIAME 1. Experimental design 1a) authors T.G. Fazzio M.E. Gelbart T. Tsukiyama Fred Hutchinson Cancer Research Center A1-175 1100 Fairview Ave N Seattle, WA 98109, U.S.A. URL: http://www.fhcrc.org/labs/tsukiyama/supplemental-data/h4basicpatch/
More informationSupplementary Information: Materials and Methods. Immunoblot and immunoprecipitation. Cells were washed in phosphate buffered
Supplementary Information: Materials and Methods Immunoblot and immunoprecipitation. Cells were washed in phosphate buffered saline (PBS) and lysed in TNN lysis buffer (50mM Tris at ph 8.0, 120mM NaCl
More informationCombining Techniques to Answer Molecular Questions
Combining Techniques to Answer Molecular Questions UNIT FM02 How to cite this article: Curr. Protoc. Essential Lab. Tech. 9:FM02.1-FM02.5. doi: 10.1002/9780470089941.etfm02s9 INTRODUCTION This manual is
More informationSupporting Information
Supporting Information Development of a 2,4-Dinitrotoluene-Responsive Synthetic Riboswitch in E. coli cells Molly E. Davidson, Svetlana V. Harbaugh, Yaroslav G. Chushak, Morley O. Stone, Nancy Kelley-
More informationAmino-allyl Dye Coupling Protocol
Amino-allyl Dye Coupling Protocol Joseph DeRisi, June 2001 Typically, fluorescently labeled cdna is generated by incorporation of dyeconjugated nucleotide analogs during the reverse transcription process.
More informationCdc42 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Cdc42 Activation Assay Kit Catalog Number: 80701 20 assays 1 Table of Content Product Description 3 Assay
More informationTECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits
In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits Catalog Numbers APPA001 In Vitro Bacterial Split GFP "Fold 'n' Glow" Solubility Assay Kit (Green) APPA008 In Vitro Bacterial
More informationArf6 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Arf6 Activation Assay Kit Catalog Number: 82401 20 assays NewEast Biosciences 1 Table of Content Product
More informationProtocol for in vitro transcription
Protocol for in vitro transcription Assemble the reaction at room temperature in the following order: Component 10xTranscription Buffer rntp T7 RNA Polymerase Mix grna PCR DEPC H 2 O volume 2μl 2μl 2μl
More informationfibrils, however, oligomeric structures and amorphous protein aggregates were
Supplementary Figure 1: Effect of equimolar EGCG on αs and Aβ aggregate formation. A D B E αs C F Figure S1: (A-C) Analysis of EGCG treated αs (1 µm) aggregation reactions by EM. A 1:1 molar ratio of EGCG
More informationpt7ht vector and over-expressed in E. coli as inclusion bodies. Cells were lysed in 6 M
Supplementary Methods MIG6 production, purification, inhibition, and kinase assays MIG6 segment 1 (30mer, residues 334 364) peptide was synthesized using standard solid-phase peptide synthesis as described
More informationSupporting Online Material
Supporting Online Material 1. Materials and Methods 2. Supporting online figures 3. Supporting online references 1. Material and Methods Plasmid constructs All AvrPphB and protease inactive AvrPphB() constructs
More informationHuman Viperin Causes Radical SAM Dependent Elongation of E. coli Hinting at its Physiological Role
Supporting Information Human Viperin Causes Radical SAM Dependent Elongation of E. coli Hinting at its Physiological Role Micah T. Nelp, Anthony P. Young, Branden M. Stepanski, Vahe Bandarian* Department
More informationMATERIALS AND METHODS
MATERIALS AND METHODS Strains Strains used in this study are shown in Table 1. The yap1 deletion strain was constructed by homologous recombination using G418 resistance as a selectable marker. The KanMX4
More informationCAPZ PREPARATION BY BACTERIAL EXPRESSION (LYSIS BY DETERGENT, NOT SONICATION.) Soeno, Y. et al., J Mus. Res. Cell Motility 19:
CAPZ PREPARATION BY BACTERIAL EXPRESSION (LYSIS BY DETERGENT, NOT SONICATION.) Soeno, Y. et al., J Mus. Res. Cell Motility 19:639-646 Notes before starting: *Bacterial strain BL21(DE) plys S transformed
More informationStabilization of a virus-like particle and its application as a nanoreactor at physiological conditions
Supporting Information Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Lise Schoonen, b Sjors Maassen, b Roeland J. M. Nolte b and Jan C. M. van
More informationRheB Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based RheB Activation Assay Kit Catalog Number: 81201 20 assays NewEast Biosciences 1 FAX: 610-945-2008 Table
More informationGENETIC ENGINEERING worksheet
Section A: Genetic Engineering Overview 1. What is genetic engineering? 2. Put the steps of genetic engineering in order. Recombinant product is isolated, purified and analyzed before marketing. The DNA
More informationPROCEDURE FOR USE NICKEL NTA Magnetic Agarose Beads (5%)
1 AFFINITY HIS-TAG PURIFICATION PROCEDURE FOR USE NICKEL NTA Magnetic Agarose Beads (5%) DESCRIPTION Nickel NTA Magnetic Agarose Beads are products that allow rapid and easy small-scale purification of
More informationRab5 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Rab5 Activation Assay Kit Catalog Number: 83701 20 assays 24 Whitewoods Lane 1 Table of Content Product
More informationHOOK 6X His Protein Purification (Bacteria)
182PR-02 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name HOOK 6X His Protein Purification (Bacteria) For The Purification Of His-Tagged Proteins
More informationTHE INSTITUTE FOR GENOMIC RESEARCH Standard Operating Procedure SOP #: M004 REVISION LEVEL:.3 EFFECTIVE DATE: 9/16/03
Standard Operating Procedure PAGE: 1 of 8 SOP #: M004 REVISION LEVEL:.3 EFFECTIVE DATE: 9/16/03 AUTHOR: Jeremy Hasseman PRIMARY REVIEWERS: Renee Gaspard, Bryan Frank 1. PURPOSE This protocol describes
More informationMolecular Genetics Techniques. BIT 220 Chapter 20
Molecular Genetics Techniques BIT 220 Chapter 20 What is Cloning? Recombinant DNA technologies 1. Producing Recombinant DNA molecule Incorporate gene of interest into plasmid (cloning vector) 2. Recombinant
More informationFor Research Use Only. Not for use in diagnostic procedures.
Printed December 13, 2011 Version 1.0 For Research Use Only. Not for use in diagnostic procedures. DDDDK-tagged Protein PURIFICATION GEL with Elution Peptide (MoAb. clone FLA-1) CODE No. 3326 / 3327 PURIFICATION
More informationSupplemental Information
Supplemental Information ATP-dependent unwinding of U4/U6 snrnas by the Brr2 helicase requires the C-terminus of Prp8 Corina Maeder 1,3, Alan K. Kutach 1,2,3, and Christine Guthrie 1 1 Department of Biochemistry
More informationSupplementary information
Supplementary information The E3 ligase RNF8 regulates KU80 removal and NHEJ repair Lin Feng 1, Junjie Chen 1 1 Department of Experimental Radiation Oncology, The University of Texas M. D. Anderson Cancer
More information2014 Pearson Education, Inc. CH 8: Recombinant DNA Technology
CH 8: Recombinant DNA Technology Biotechnology the use of microorganisms to make practical products Recombinant DNA = DNA from 2 different sources What is Recombinant DNA Technology? modifying genomes
More informationPRODUCT INFORMATION. Composition of SOC medium supplied :
Product Name : Competent Cell BL21(DE3)pLysS Code No. : DS260 Size : 100 μl 10 Competency : > 5 10 7 cfu/μg (puc19) Supplied product : SOC medium, 1 ml 10 This product is for research use only Description
More informationGene Expression Technology
Gene Expression Technology Bing Zhang Department of Biomedical Informatics Vanderbilt University bing.zhang@vanderbilt.edu Gene expression Gene expression is the process by which information from a gene
More informationAt E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in
Supplementary Materials and Methods Barrier function assays At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in acidic X-gal mix (100 mm phosphate buffer at ph4.3, 3 mm
More informationSUPPLEMENTAL INFORMATION
SUPPLEMENTAL INFORMATION SUPPLEMENTAL DATA Table S1: Related to Figure 4. DnaA screen for divalent cations and nucleotides. Concentration of reagents, T m and F fold30 75. Reagent Conc T m (±SEM) mm C
More informationBL21(DE3) expression competent cell pack DS265. Component Code No. Contents Competent cell BL21(DE3) DS250 5 tubes (100 μl/tube)
Product Name : Code No. : Kit Component : BL21(DE3) expression competent cell pack DS265 Component Code No. Contents Competent cell BL21(DE3) DS250 5 tubes (100 μl/tube) transfromation efficiency: 5 10
More informationCH 8: Recombinant DNA Technology
CH 8: Recombinant DNA Technology Biotechnology the use of microorganisms to make practical products Recombinant DNA = DNA from 2 different sources What is Recombinant DNA Technology? modifying genomes
More informationHOOK 6X His Protein Spin Purification (Bacteria)
222PR 03 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name HOOK 6X His Protein Spin Purification (Bacteria) For the Purification of His Tagged
More informationGenlantis A division of Gene Therapy Systems, Inc Telesis Court San Diego, CA USA Telephone: or (US toll free)
TurboCells BL21(DE3) TurboCells BL21(DE3)pLysS Chemically Competent E. coli Instruction Manual Catalog Numbers C302020 C303020 A division of Gene Therapy Systems, Inc. 10190 Telesis Court San Diego, CA
More informationRen Lab ENCODE in situ HiC Protocol for Tissue
Ren Lab ENCODE in situ HiC Protocol for Tissue Pulverization, Crosslinking of Tissue Note: Ensure the samples are kept frozen on dry ice throughout pulverization. 1. Pour liquid nitrogen into a mortar
More informationSupplementary information
Supplementary information Table of Content: Supplementary Results... 2 Supplementary Figure S1: Experimental validation of AP-MS results by coimmunprecipitation Western blot analysis.... 3 Supplementary
More informationFisher (Fairlawn, NJ) and Sigma-Aldrich (St. Louis, MO) and were used without further. (Promega) and DpnI (New England Biolabs, Beverly, MA).
175 Appendix III Chapter 4 Methods General. Unless otherwise noted, reagents were purchased from the commercial suppliers Fisher (Fairlawn, NJ) and Sigma-Aldrich (St. Louis, MO) and were used without further
More informationHOOK 6X His Protein Purification (Yeast)
G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name HOOK 6X His Protein Purification (Yeast) For The Purification of His Tagged Proteins from
More informationBiol/Chem 475 Spring 2007
Biol/Chem 475 Spring 2007 Goal of lab: For most of the quarter, we will be exploring a gene family that was first discovered in fruitlfies and then found to be present in humans and worms and fish and
More informationNi-NTA Agarose. User Manual. 320 Harbor Way South San Francisco, CA Phone: 1 (888) MCLAB-88 Fax: 1 (650)
Ni-NTA Agarose User Manual 320 Harbor Way South San Francisco, CA 94080 Phone: 1 (888) MCLAB-88 Fax: 1 (650) 871-8796 www. Contents Introduction -----------------------------------------------------------------------
More informationnature methods Enabling IMAC purification of low abundance recombinant proteins from E. coli lysates
nature methods Enabling IMAC purification of low abundance recombinant proteins from E. coli lysates Audur Magnusdottir, Ida Johansson, Lars-Göran Dahlgren, Pär Nordlund & Helena Berglund Supplementary
More informationTHE RAY- MANUAL. Instructions for the construction of complex targeting vectors using RAY (rapid assembly in yeast) Thorsten Storck December '96
Thorsten Storck December '96 THE RAY- MANUAL Instructions for the construction of complex targeting vectors using RAY (rapid assembly in yeast) Principle of the method Genetic elements (selection markers,
More informationPersonal Exam Code: 1. 16p
Exam, Methods in Molecular Biology, BIOR47, 2012-04-26 Please hand in answers to each question on its paper. Use additional papers if needed. Mark all papers with your code. Your answers should be logical
More informationSupplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/-
#1074683s 1 Supplemental Online Material Materials and Methods Cell lines and tissue culture The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- knock-out animals
More informationCONSTRUCTION OF GENOMIC LIBRARY
MODULE 4-LECTURE 4 CONSTRUCTION OF GENOMIC LIBRARY 4-4.1. Introduction A genomic library is an organism specific collection of DNA covering the entire genome of an organism. It contains all DNA sequences
More information(Supplementary Methods online)
(Supplementary Methods online) Production and purification of either LC-antisense or control molecules Recombinant phagemids and the phagemid vector were transformed into XL-1 Blue competent bacterial
More informationBACTERIAL PRODUCTION EXPRESSION METHOD OVERVIEW: PEF # GENE NAME EXPRESSION VECTOR MOLECULAR WEIGHT kda (full-length) 34.
BACTERIAL PRODUCTION PEF # GENE NAME EXPRESSION VECTOR MOLECULAR WEIGHT 2015-XXXX XXXX pet-32a 50.9 kda (full-length) 34.0 kda (cleaved) EXPRESSION METHOD OVERVIEW: Plasmid DNA was transformed into BL21
More informationLigation Independent Cloning (LIC) Procedure
Ligation Independent Cloning (LIC) Procedure Ligation Independent Cloning (LIC) LIC cloning allows insertion of DNA fragments without using restriction enzymes into specific vectors containing engineered
More informationSERVA Ni-NTA Magnetic Beads
INSTRUCTION MANUAL SERVA Ni-NTA Magnetic Beads Magnetic beads for Affinity Purification of His-Tag Fusion Proteins (Cat. No. 42179) SERVA Electrophoresis GmbH - Carl-Benz-Str. 7-69115 Heidelberg Phone
More informationSupplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons
Neuron, Volume 61 Supplemental Data LMO4 Controls the Balance between Excitatory and Inhibitory Spinal V2 Interneurons Kaumudi Joshi, Seunghee Lee, Bora Lee, Jae W. Lee, and Soo-Kyung Lee Supplemental
More information5.36 Biochemistry Laboratory Spring 2009
MIT OpenCourseWare http://ocw.mit.edu 5.36 Biochemistry Laboratory Spring 2009 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms. Laboratory Manual for URIECA
More informationA sensitive direct human telomerase activity assay Scott B Cohen & Roger R Reddel
A sensitive direct human telomerase activity assay Scott B Cohen & Roger R Reddel Supplementary figure and text: Supplementary Figure 1 Titration of the sheep polyclonal htert antibody. Supplementary Methods
More informationGel/PCR Extraction Kit
Gel/PCR Extraction Kit Item No: EX-GP200 (200rxns) Content Content Binding Buffer BD Wash Buffer PE Elution Buffer (10 mm Tris-HCl, ph 8.5) Spin Columns EX-GP200 80 ml 20 mlx3 10 ml 200 each Description
More informationChapter 9 Genetic Engineering
Chapter 9 Genetic Engineering Biotechnology: use of microbes to make a protein product Recombinant DNA Technology: Insertion or modification of genes to produce desired proteins Genetic engineering: manipulation
More informationMicroarray protocol Emmanuela Marchi PhD Dept. Pharmacology UFIR - Comparative nutritional systems biology Focus Team Post-doc emanuela.marchi@unifi.it 16 April 2009 When citing this SOP you should acknowledge
More informationBlotting Techniques (Southern blot, Northern blot, Western blot, and Eastern blot)
Blotting Techniques (Southern blot, Northern blot, Western blot, and Eastern blot) Masheal Aljumaah SEP 2018 Learning Objectives: What is blotting? Blotting Techniques Types. Applications for each technique.
More informationIntracellular receptors specify complex patterns of gene expression that are cell and gene
SUPPLEMENTAL RESULTS AND DISCUSSION Some HPr-1AR ARE-containing Genes Are Unresponsive to Androgen Intracellular receptors specify complex patterns of gene expression that are cell and gene specific. For
More informationSupplemental Materials and Methods:
Supplemental Materials and Methods: Cloning: Oligonucleotides used in the subcloning steps are listed in Supplemental Table 1. Human FANCI (isoform 1, KIAA1794) was subcloned from pcmv6-xl4 [FANCI] in
More informationSupporting Information
Supporting Information Deng et al. 10.1073/pnas.1515692112 SI Materials and Methods FPLC. All fusion proteins were expressed and purified through a three-step FPLC purification protocol, as described (20),
More informationNEBNext RNase III RNA Fragmentation Module
SAMPLE PREPARATION NEBNext RNase III RNA Fragmentation Module Instruction Manual NEB #E6146S 100 reactions NEBNext RNase III RNA Fragmentation Module Table of Contents: Description....2 Applications....2
More informationLinköpings Universitet. Site-directed mutagenesis of proteins
IFM/Kemi August2011/LGM Linköpings Universitet Site-directed mutagenesis of proteins Competent E. coli cells Site-specific mutagenesis Analysis on agarose gel Transformation of plasmids in E. coli Preparation
More informationHurricane Miniprep Kit PROTOCOL
Hurricane Miniprep Kit PROTOCOL Description: The Hurricane Miniprep Kit is designed for purification of up to 25 ug of high purity plasmid DNA from a starting volume of 2-5 ml of bacterial culture. The
More informationRecombinant DNA Technology. The Role of Recombinant DNA Technology in Biotechnology. yeast. Biotechnology. Recombinant DNA technology.
PowerPoint Lecture Presentations prepared by Mindy Miller-Kittrell, North Carolina State University C H A P T E R 8 Recombinant DNA Technology The Role of Recombinant DNA Technology in Biotechnology Biotechnology?
More informationRapid and sensitive determination of recombinant protein expression
APPLIAION NOE Pro-Detect Rapid assays Rapid and sensitive determination of recombinant protein expression Introduction Recombinant protein expression and purification is a multistep process that includes:
More informationGα 13 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Gα 13 Activation Assay Kit Catalog Number: 80401 20 assays NewEast Biosciences 1 Table of Content Product
More informationRNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by. 5 AGACACAAACACCAUUGUCACACUCCACAGC; Rand-2 OMe,
Materials and methods Oligonucleotides and DNA constructs RNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by Dharmacon Inc. (Lafayette, CO). The sequences were: 122-2 OMe, 5
More informationMagExtactor -His-tag-
Instruction manual MagExtractor-His-tag-0905 F0987K MagExtactor -His-tag- Contents NPK-701 100 preparations Store at Store at 4 C [1] Introduction [2] Components [3] Materials required [4] Protocol3 1.
More informationYeast gene expression lab using β-galactosidase vectors that can be completed in one 2 hour laboratory session.
Yeast gene expression lab using β-galactosidase vectors that can be completed in one 2 hour laboratory session. Stephanie C Schroeder PhD Stephanie C Schroeder, PhD Assistant Professor, Dept. of Biological
More informationSupplementary Figure S1 Purification of deubiquitinases HEK293 cells were transfected with the indicated DUB-expressing plasmids.
Supplementary Figure S1 Purification of deubiquitinases HEK293 cells were transfected with the indicated DUB-expressing plasmids. The cells were harvested 72 h after transfection. FLAG-tagged deubiquitinases
More informationRNA-related Products
RNA-related Products TRANSCRIPTME RNA kit: Ideal choice for obtaining high yields of full-length cdna for RT-qPCR assays Suitable for as low RNA amount as 10 pg p p Convenient, reliable and cost-effective
More informationSupplementary Information: Materials and Methods. GST and GST-p53 were purified according to standard protocol after
Supplementary Information: Materials and Methods Recombinant protein expression and in vitro kinase assay. GST and GST-p53 were purified according to standard protocol after induction with.5mm IPTG for
More informationSupporting Information
Supporting Information Wiley-VCH 2007 69451 Weinheim, Germany A Biosynthetic Route to Dehydroalanine Containing Proteins Jiangyun Wang, Stefan M. Schiller and Peter G. Schultz* Department of Chemistry
More informationChromatin Immunoprecipitation (ChIP)
de Lange Lab Chromatin Immunoprecipitation (ChIP) Required Solutions IP Wash A 0.1% SDS 1% Triton X-100 2 mm EDTA ph 8.0 20 mm Tris-HCl ph 8.0 150 mm NaCl 1 mm PMSF 1 µg/ml Leupeptin 1 µg/ml Aprotinin
More informationSupporting Information
Supporting Information DNA Crystals as Vehicles for Biocatalysis. Chun Geng and Paul J. Paukstelis* *Email: paukstel@umd.edu Recombinant MBP-tagged RNase inhibitor expression and purification. The porcine
More informationSupplemental Experimental Procedures
Supplemental Experimental Procedures Cloning, expression and purification of untagged P C, Q D -N 0123, Q D- N 012 and Q D -N 01 - The DNA sequence encoding non tagged P C (starting at the Arginine 57
More informationUbiquitin (76 aa) UB genes encode linear fusions of UB either to itself (poly-ub genes) or to other proteins these fusions are cleaved by
Ubiquitin (76 aa) UB genes encode linear fusions of UB either to itself (poly-ub genes) or to other proteins these fusions are cleaved by deubiquitylases (DUBs) yielding mature Ub deubiquitylase FLAG 3
More informationIgG TrueBlot Protocol for Mouse, Rabbit or Goatderived Antibodies - For Research Use Only
IgG TrueBlot Protocol for Mouse, Rabbit or Goatderived Antibodies - For Research Use Only Introduction The IgG TrueBlot for mouse, rabbit, or goat-derived antibodies represents unique series of respective
More informationGlutathione Resin. (Cat. # , , , ) think proteins! think G-Biosciences
191PR 05 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Glutathione Resin (Cat. # 786 280, 786 310, 786 311, 786 312) think proteins! think
More informationHigh-Purity Bacterial RNA Isolated with the Agilent Total RNA Isolation Mini Kit Application
High-Purity Bacterial RNA Isolated with the Total RNA Isolation Mini Kit Application Gene Expression Author Christopher Rizzo Claudia A. Robbins Rhonda R. Taylor Technologies, Inc. 285 Centerville Road
More informationSupplemental Information. OprG Harnesses the Dynamics of its Extracellular. Loops to Transport Small Amino Acids across
Structure, Volume 23 Supplemental Information OprG Harnesses the Dynamics of its Extracellular Loops to Transport Small Amino Acids across the Outer Membrane of Pseudomonas aeruginosa Iga Kucharska, Patrick
More informationCHAPTER 9 DNA Technologies
CHAPTER 9 DNA Technologies Recombinant DNA Artificially created DNA that combines sequences that do not occur together in the nature Basis of much of the modern molecular biology Molecular cloning of genes
More informationCHAPTER 4 Cloning, expression, purification and preparation of site-directed mutants of NDUFS3 and NDUFS7
CHAPTER 4 Cloning, expression, purification and preparation of site-directed mutants of NDUFS3 and NDUFS7 subunits of human mitochondrial Complex-I Q module N DUFS2, 3, 7 and 8 form the core subunits of
More informationBrian Williams, Richele Gwirtz Version 1.0, December 29, 2003
Direct labeling of mouse genomic DNA for microarray hybridization using the Klenow fragment of E. coli DNA polymerase I and Cy3 dctp. This is a detailed version of the protocol published in Genomic DNA
More informationGST Fusion Protein Purification Kit
Glutathione Resin GST Fusion Protein Purification Kit Cat. No. L00206 Cat. No. L00207 Technical Manual No. TM0185 Version 01042012 Index 1. Product Description 2. Related Products 3. Purification Procedure
More informationSUPPLEMENTAL MATERIALS
SUPPLEMENTAL MATERIALS SUPPLEMENTAL FIGURES Supplemental Figure S1. Analyses of the CRY1-SPA1 interaction (A) An auxotrophy growth assay (left) and a filter-based -galactosidase colorimetric assay (right)
More informationFigure 1. Schematic of Ats1p expression plasmid.
Abstract: Anita Corbett page 2 The goal of my rotation project was to express, purify, and examine the exchange activity of a putative guanine nucleotide exchange factor, Ats1p. The S. cerevisiae ATS1
More informationRNP-IP (Modified Method)-Getting Majority RNA from RNA Binding Protein in the Cytoplasm Fengzhi Liu *
RNP-IP (Modified Method)-Getting Majority RNA from RNA Binding Protein in the Cytoplasm Fengzhi Liu * School of Biomedical Sciences, Thomas Jefferson University, Philadelphia, USA *For correspondence:
More informationJan 25, 05 His Bind Kit (Novagen)
Jan 25, 05 His Bind Kit (Novagen) (1) Prepare 5ml of 1X Charge buffer (stock is 8X= 400mM NiSO4): 0.625ml of the stock + 4.375ml DH2O. (2) Prepare 13ml of 1X Binding buffer (stock is 8X = 40mM imidazole,
More informationDNA PURIFICATION KITS PLASMID DNA ISOLATION
LIST -NEW v.01-02- DNA PURIFICATION KITS PLASMID DNA ISOLATION Plasmid Mini ultrapure, high and medium copy number plasmid DNA isolation from 1.5-3 ml of bacteria culture PURIFICATION TECHNOLOGY SM 020-50
More informationDesign. Construction. Characterization
Design Construction Characterization DNA mrna (messenger) A C C transcription translation C A C protein His A T G C T A C G Plasmids replicon copy number incompatibility selection marker origin of replication
More informationProductInformation TECHNICAL BULLETIN MULTIPLE TISSUE NORTHERN BLOT, MOUSE. Product No. BLOT-2 Technical Bulletin No. MB-865 February 2000
MULTIPLE TISSUE NORTHERN BLOT, MOUSE Product No. BLOT-2 Technical Bulletin No. MB-865 February 2000 ProductInformation TECHNICAL BULLETIN Product Description Sigma s Mouse Multiple Tissue Northern Blot
More informationSUPPLEMENTARY METHODS. Screen for mutants that require the RIT1 gene for growth: The genetic screen
SUPPLEMENTARY METHODS Screen for mutants that require the RIT1 gene for growth: The genetic screen utilized to identify mutants requiring RIT1 for growth was based on a colony sectoring assay as described
More informationSUMOylated protein capture kit
SUMOylated protein capture kit Cat no. A010-100 Capture and detect SUMOylated proteins High capacity, high specificity SUMO binding matrix Fast, convenient protein isolation using purification system provided
More informationSupporting Information
Supporting Information Üstün and Börnke, 2015 Figure S1: XopJ does not display acetyltransferase activity. Autoacetylation activity in vitro. Acetylation reactions using MBP, MBP-XopJ, GST and GST-HopZ1a
More informationFigure S1. Sequence alignments of ATRIP and ATR TopBP1 interacting regions.
A H. sapiens 204 TKLQTS--ERANKLAAPSVSH VSPRKNPSVVIKPEACS-PQFGKTSFPTKESFSANMS LP 259 B. taurus 201 TKLQSS--ERANKLAVPTVSH VSPRKSPSVVIKPEACS-PQFGKPSFPTKESFSANKS LP 257 M. musculus 204 TKSQSN--GRTNKPAAPSVSH
More information