Sip1A: TIC901a novel secreted protein from Bacillus thuringiensis. David Bowen Agronomic Traits - Discovery Monsanto Company
|
|
- Willis Kennedy
- 6 years ago
- Views:
Transcription
1 Sip1A: TIC901a novel secreted protein from Bacillus thuringiensis David Bowen Agronomic Traits - Discovery Monsanto Company 1
2 Insect protection Insecticidal proteins from Bacillus thuringiensis 2
3 Multiple protein families with diverse activities Cyt2Aa1 Cry37Aa1 Cry23Aa1 Cry22Aa1 Li et al. (1996) J. Mol. Biol. 257:129. Cry1Aa1 1 2 Vip2Aa Vip2A 3 Han et al., (1999) Nat. Struct. Biol. 6(10):932. Grochulski et al. (1995) J. Mol. Biol. 254:447 3
4 Insect protected crops: the early years Barton, K. A., H. R. Whiteley, and N. Yang Bacillus thuringiensis - endotoxin expressed in transgenic Nicotiana tabacum provides resistance to lepidopteran insects: Plant. Physiol. 85: Vaeck, M., A. Reynaerts, H. Hofte, S. Jansens, M. DeBeuckeleer, C. Dean, M. Zabeau, M. Van Montagu, and J. Leemans Transgenic plants protected from insect attack. Nature 328:33-37 Corn Bt event 176 Cry1Ab Lepidopterans 1996 Bt11 Cry1Ab Lepidopterans 1997 (NKBT11) YieldGard Cry1Ab Lepidopterans 1997 (MON810) Starlink Cry9Ca Lepidopterans 1998 Cotton Bollgard Cry1Ac Lepidopterans
5 Second-generation insect-protected crops General features Contain multiple or novel insecticidal protein genes Encode engineered or natural proteins Provide expanded control of insect pest species Some offer improved insect resistance management by providing a different mode-of-action Insect protection traits are stacked with herbicide tolerance traits Glyphosate tolerance (cp4 gene from Agrobacterium) Glufosinate tolerance (phosphinothricin-n-acetyltransferase PAT gene from Streptomyces) 5
6 Insect Control Products of Today are Driven by Bacillus thuringiensis Derived Proteins Company Product Name Event Gene (s) Pest Commercial Year Monsanto Corn YieldGard CB MON810 cry1ab Lepidopterans (2) 1997 YieldGard RW MON863 cry3bb Coleopterans (3) 2004 YieldGard VT RW MON88017 cry3bb Coleopterans (3) 2007 YieldGard VT PRO MON89034 cry1a.105 and cry2ab2 Lepidopterans (6) 2009 Cotton Bollgard MON531 cry1ac Lepidopterans (4) 1996 Bollgard II MON15985 cryiac and cry2ab Lepidopterans (5) 2003 DOW/DuPont Corn Herculex I 1507 cry1fa2 Lepidopteran (1) 2003 Herculex RW cry34ab1 and cry35ab1 Coleopterans (3) 2006 DOW Corn N/A DAS cry1f Lepidopterans (5) (?) Cotton Widestrike cry1ac Lepidopterans (5) 2005 Widestrike cry1f Lepidopterans (4) 2005 Syngenta Corn NaturGard KnockOut 176 cry1ab Lepidopterans (1) 1996 AgriSure CB BT11 cry1ab Lepidopterans (1) 1997 TBA MIR162 VIP3A Lepidopterans 2010 AgriSure RW MIR604 mcry3a Coleopterans (3) 2007 Cotton TBA COT67B Cry1Ab Lepidopterans? VipCot COT102 VIP3A Lepidopterans (8)? Bayer (Aventis CropScience) Corn StarLink CBH-351 cry9c Lepidopterans (1) 1998 Cotton BTX Stacked TBA Cry proteins Lepidopterans
7 Corn Rootworm Species in the U.S. Diabrotica virgifera virgifera D. undecimpunctata D. barberi D. virgifera zea 7
8 An example of rootworm feeding damage NIS 1 NIS 2 NIS 3 Iowa State 0 3 node injury scale (Root Damage Rating) One entire node of roots (or equivalent) pruned % of a 2nd node of roots (or equivalent) pruned 8
9 YieldGard RW: the first corn variety offering protection from corn rootworm feeding damage (2004) Specific regions targeted for oligonucleotide-directed mutagenesis Proteins screened by insect bioassay Cry3Bb1 variants identified with ~10X improvement in the LC50. LC50 ug/well (95% CI) Cry3Bb variant Cry3Bb variant Wild-type Cry3Bb1 Fold increase over WT Cry3Bb ( ) 63.5 (46-91) 10.1 X Cry3Bb ( ) 24.2 (13-40) 5.4 X Cry3Bb ( ) 32.2 (14-67) 12.9 X Cry3Bb C Mlu I 149 Hind III nptii 35S nptii npt II Mlu I 4840 Hind III 4834 ori-puc tahsp17 3' PV-ZMIR bp NOS 3' 4-AS1 wt CAB leader ract1 intron EcoR V 1773 Hind III 1794 Root-enhanced promoter cry3bb 317 cry3bb English et al. U. S. Patent
10 YieldGard Plus/YieldGard RW root protection Increasing Root Damage YieldGard Plus/ YieldGard Rootworm Lorsban Aztec Force Check Source: 2001 and 2002 academic trials: 35 trials conducted with universities and private consultants with RDR > Each mean = a minimum of 650 individual roots. YieldGard Plus/YieldGard Rootworm and Check treated with 0.16 mg/seed of Gaucho. e.25 Economic Threshold 10
11 94% of YieldGard Plus/YieldGard Rootworm Root Damage Scores were Below the Economic Threshold Compared to 69% for the Best Insecticide 100% % of Roots per Category 80% 60% 40% 20% 0% 94 YieldGard YieldGard Plus/ Plus YieldGard Rootworm Aztec Force Lorsban Check <0.25 Source: 2001 and 2002 academic trials: 35 trials conducted with universities and private consultants with RDR > Each mean = a minimum of 650 individual roots. YieldGard Plus/YieldGard Rootworm and Check treated with 0.16 mg/seed of Gaucho. 11
12 Larger Root System Provides Higher Yield Potential LSD.05 = 3.2 Bushels/Acre Untreated Insecticide Treated YieldGard Rootworm Source: Monsanto Company Field Trials. Seventy Three Monsanto comparisons of YieldGard Rootworm Hybrids to genetically similar hybrids at sixty-six locations. All locations >0.25 Iowa State Node-Injury Scale in the check. Insecticides: Aztec 23, Capture 6, Counter 5, Force 27, Fortress 1, Lorsban 9, Regent - 1. Data as of November
13 A new class of insecticidal proteins B. thuringiensis strains grown under conditions that delay sporulation Culture supernatants from stationary-phase cultures showed activity against a coleopteran insect pest (Colorado potato beetle) DEAE column chromatography Bt strain Bioassay-guided fractionation N-terminal sequence used to design a degenerate oligonucleotide probe for gene cloning TIC
14 Five distinct subclasses Pairwise alignments of the mature proteins A B C TIC 407 TIC 417 TIC 431 TIC 901 TIC 1201 TIC407 75% 75% 80% 82% TIC417 95% 79% 81% TIC431 79% 80% TIC901 91% RFLP variants identified among known coleopteranactive Bt strains Five distinct subclasses identified among ~7500 strains of B. thuringiensis TIC1201 Proteins recovered from culture supernatants are clipped at their N-termini 14
15 What are they related to? Psi Blast search with TIC901 against the non-redundant protein database Search results from two iterations of Psi Blast: (nr.aa.58) Hit ID Hit Description Score (bits) E Value Mtx3 mosquitocidal toxin [Bacillus sphaericus] E Cry14-4 [Bacillus thuringiensis] E Mtx2 mosquitocidal toxin [Bacillus sphaericus] E epsilon toxin [Clostridium perfringens] E alpha-toxin [Clostridium septicum] E parasporal crystal protein C53 [Bacillus thuringiensis] E natterin 4 precursor [Thalassophryne nattereri] Cry15Aa crystal protein [Bacillus thuringiensis]
16 Signal peptides for secretion SignalP 3.0 prediction for signal peptide cleavage sites in gram-positive bacteria Predicted Determined TIC417sig MKYKSSKVAMCTLSALMLS--TIATPSISVFAAETTSSHAV-TNQQTITQRAESYIDIVHN-RM- TIC431sig MKYKSSKVAMCTLSALMLS--TIATPSISVFAAETTASHKV-TNQQTIAQRAESYIDIVHN-RM- TIC407sig MKYKSSKVAICTLSALMLS--TIGTSSMSTFAAETTLPGQT-LKEQSITPRAESYIDIVQD-RM- TIC901sig MKNRFSKVALCTVPILMVS--TFASSSMSAFAAEAKSPDLN-VSQQVIGPYAESYIDIVQD-RM- TIC1201sig MKYKFSKVVKCTLPALMIT--TFVTPSMAVFAAETKSPNLN-ASQQAITPYAESYIDTVQD-RM- Mtx3 MMKNKAKVILMG-ATIGLS--LLSSP- IAMAANGDSNVKENQSIANFSPIKNSFPDAANGSRFL Consensus Mk...sKV..ct...lm.s..t...s...fAAe...q.i...aeSyiD.v...Rm. 16
17 Phylogram of Cry23Aa/Mtx2 family proteins 595 Cry23Aa1 ET75 B. thuringiensis 899 CRY15AA CRY33AA1 BTC35 Crystal proteins Cry23Aa NT32KD AAA Mtx2 Mtx3 B. sphaericus TIC417 TIC431 TIC407 Secreted proteins TIC901 TIC
18 Overproduction of TIC901-type proteins in B. thuringiensis EG2158 Bt ori44 OR-Bt.ori44-0:1:1 BglII 8284 BamHI 1 XhoI 7 CR-Bt.TNPase-0:1:8 TIC901 CR-Bt.TIC901-0:1:1 HindIII 1972 EcoRI 1978 Toxin-host TIC901 TIC1201 pic17048 JABAUM pic bp CR-Ec.lacZ-1:1:1 P-Ec.lac-1:1:1 CR-Ec.lacI-1:1:2 StuI 5784 NcoI 5587 cat CAT:1:3 CR-Ec.lacZ-1:1:2 OR-f1.f1-0:1:1 CR-Ec.bla-1:1:3 OR-Ec.ori-ColE1-1:1:2 18
19 Toxicity towards corn rootworm larvae Percent mortality TIC1201 TIC Percent mortality Cry3Bb TIC Log concentration (ppm) Log concentration (ppm) 19
20 Characterization of the TIC901 protein family < Large MW oligomers? Crystal for structure determination Monomer Formation of high molecular weight oligomers upon storage Large conductances in planar lipid bilayers >>>>> TIC901 Conductance up to 22.5 ns Time, min 36 20
21 Recent Publications: 21
22 Acknowledgements: Monsanto Biotechnology Agronomics Traits - Insect Control: -Molecular -Entomology Jim Baum Ty Vaughn Bill Donovan Tom Clark Karina Krasomil-Osterfeld 22
23 Thanks! 23
PLNT2530 (2018) Unit 10b. Applications of Plant Biotechnology in Agriculture. Insect Resistance
PLNT2530 (2018) Unit 10b Applications of Plant Biotechnology in Agriculture Insect Resistance Plant Biotechnology Adrian Slater, Nigel Scott and Mark Fowler Chapters 5-10 Unless otherwise cited or referenced,
More informationProduct Safety Assessment Herculex RW Rootworm Protection
Product Safety Assessment Herculex RW Rootworm Protection Select a Topic: Names Product Overview Manufacture of Product: Plant Transformation Process Product Description Product Uses Exposure Potential
More informationTraits for Insect Control with Transgenic Bt Corn: What, Why, and How... Now and in the Future Kevin Steffey, Mike Gray, and Ron Estes Department of
Traits for Insect Control with Transgenic Bt Corn: What, Why, and How... Now and in the Future Kevin Steffey, Mike Gray, and Ron Estes Department of Crop Sciences University of Illinois Authors note: Portions
More informationInstitute of Ag Professionals
Institute of Ag Professionals Proceedings of the 2008 Crop Pest Management Shortcourse & Minnesota Crop Production Retailers Association Trade Show www.extension.umn.edu/agprofessionals Do not reproduce
More informationPocket K No. 42. Stacked Traits in Biotech Crops
Pocket K No. 42 Stacked Traits in Biotech Crops The biotech method of gene stacking has brought us many notable products such as Golden Rice, Blue Rose, and SmartStax. What is gene stacking and why is
More informationManaging Corn Pests with Bt Corn: Some Questions and Answers March 2003
Managing Corn Pests with Bt Corn: Some Questions and Answers March 2003 Frank B. Peairs Department of Bioagricultural Sciences and Pest Management Colorado State University Introduction New technology
More information3. DEVELOPING A ROBUST IRM PLAN
Practical Approaches to Insect Resistance Management for Biotech-Derived Crops Practical Approaches to Insect Resistance Management for Biotech-Derived Crops Table of Contents ACKNOWLEDGEMENTS.............................................................2
More informationSeedcorn. 12 For use only by commercial seed -treaters. Enhance AW imidacloprid captan vitavax. Danger 5 oz per 100 lbs seed --
SEED-BASED CONTROL of INSECTS The following tables show seed treatments and transgenic options available for insect control. Many commercial seed treatment contain combinations of ingredients (particularly
More informationGenetically Modified Organisms II. How are transgenic plants generated? The components of T DNA transfer. Plants
Genetically Modified Organisms II Plants How are transgenic plants generated? The bacterium Agrobacterium tumefaciens is a pathogen of plants that causes crown gall tumors. Crown gall tumor Agrobacterium
More informationGenetically modified sugarcane and Eldana. Sandy Snyman Agronomist s Association Annual Symposium 27 October 2015
Genetically modified sugarcane and Eldana Sandy Snyman Agronomist s Association Annual Symposium 27 October 2015 GM=Genetically modified What is GM? DNA/gene from one source is transferred to another organism
More informationBt d-endotoxins are globular protein molecules, which accumulate as protoxins in crystalline form during late stage of the sporulation.
Bt Corn Bt d-endotoxins are globular protein molecules, which accumulate as protoxins in crystalline form during late stage of the sporulation. Protoxins are liberated in the midgut after solubilization
More informationDELIVERING A SYSTEM FOR HIGHER YIELD IN CANOLA
DELIVERING A SYSTEM FOR HIGHER YIELD IN CANOLA System of Solutions Come Together in Our Pipeline Development Process Monsanto s R&D Pipeline Designed to Address Farmers Challenges Increase Yield Impact
More informationChallenges t to IPM iin in the Farm Lan ndscape B R . e eonard
Challenges to IPM in the Farm Lan ndscape B. R. Le eonard Integrated Pest Management For Co otton INTEG GRATE Nearly Every Production Decision is Capable of Influencing Another Decision Made La ater in
More informationRisk Assessment and Management in Transgenic Crops
Risk Assessment and Management in Transgenic Crops P. Balasubramanian Director Centre for Plant Molecular Biology Tamil Nadu Agricultural University Coimbatore 641 003 Status of Development of Bt Brinjal
More informationGM (Genetically Modified) Plants. Background
1 GM (Genetically Modified) Plants Background Genetically modified crops (GM) have been used since 1996 in the U.S. GM crops contain foreign genetic material The DNA may be from another plant or from a
More informationAcceleron Seed Treatment Products
Acceleron Seed Treatment Products Acceleron Soybean Seed Treatment Products 2011 Soybean Seed Treatment Options Acceleron Seed Treatment Products: Two Offers Disease Protection & Plant Health Insect &
More informationBIO1PS 2012 Plant Science Topic 4 Lectures 2 and 3 Introduction to Plant Biotechnology
BIO1PS 2012 Plant Science Topic 4 Lectures 2 and 3 Introduction to Plant Biotechnology Dr. Michael Emmerling Department of Botany Room 410 m.emmerling@latrobe.edu.au Some Key Words Agrobacterium Ti plasmid
More information2016TUG MONSANTO CANADA TECHNOLOGY USE GUIDE
2016TUG MONSANTO CANADA TECHNOLOGY USE GUIDE Dear Valued Customer, We would like to express our sincere appreciation for your business. As a company 100% focused on agriculture, we understand that our
More informationPCR Methods and Analytical Strategies for GMO Testing. E. Pearce Smith Eurofins GeneScan
PCR Methods and Analytical Strategies for GMO Testing E. Pearce Smith Eurofins GeneScan 1 Genetically Modified Organisms Viruses Bacteria Fungi Plants Animals 2 Examples of Tests for Biotech Corn and Soy
More informationGlobal Review of Commercialized Transgenic Crops: 2002 Feature: Bt Maize
I S A A A INTERNATIONAL SERVICE FOR THE ACQUISITION OF AGRI-BIOTECH APPLICATIONS EXECUTIVE SUMMARY Global Review of Commercialized Transgenic Crops: 2002 Feature: Bt Maize by Clive James Chair, ISAAA Board
More informationIntegrated Pest Management. Tracey Baute and Gilles Quesnel OMAFRA
Integrated Pest Management Tracey Baute and Gilles Quesnel OMAFRA What is IPM? Integrated Pest Management A systems approach to pest control method that uses all available technologies to efficiently and
More informationBRAZILIAN SEED MARKET NEWS. By MNAGRO
BRAZILIAN SEED MARKET NEWS By MNAGRO AGRIBUSINESS IN BRAZIL KEEPS GROWING CONAB, the Brazilian Agriculture Supply government entity recently estimate what should be the last figure for Brazilian grain
More informationGMO Crops, Trade Wars, and a New Site Specific Mutagensis System. A. Lawrence Christy, Ph.D.
GMO Crops, Trade Wars, and a New Site Specific Mutagensis System A. Lawrence Christy, Ph.D. Background PhD in Plant Physiology from Ohio State University 12 years with Monsanto R&D in PGR s and herbicides
More informationSCIENTIFIC OPINION. EFSA Panel on Genetically Modified Organisms (GMO) 2,3. European Food Safety Authority (EFSA), Parma, Italy
SCIENTIFIC OPINION Scientific Opinion on application (EFSA-GMO-CZ-2008-54) for placing on the market of genetically modified insect resistant and herbicide tolerant maize MON 88017 under Regulation (EC)
More informationLearn the Truth. About Big Quality Differences Between Bts
Learn the Truth About Big Quality Differences Between Bts Bt: Sustainability and Value Biorationals Bring Unique Value The need for highly effective and sustainable farming solutions has growers around
More informationDevelopment of Crop Protection Products: An Industry Perspective. Keith S. Rucker Technical Service Specialist
Development of Crop Protection Products: An Industry Perspective Keith S. Rucker Technical Service Specialist Need for Continued Crop Protection Product Development Wild oats White Mold on Peanuts Treated
More informationCOTTON PRODUCT USE GUIDE
COTTON PRODUCT USE GUIDE U.S. Edition WideStrike Insect Protection WideStrike 3 Insect Protection This Product Use Guide sets forth the requirements for growing cotton containing WideStrike Insect Protection
More informationANNEXE. Monsanto Agriculture France SAS Novembre
ANNEXE Notification conforme à la Directive 2001/18/CE, Partie B, demande d autorisation pour expérimentation au champ pour le maïs génétiquement modifié MON 89034 France Monsanto Agriculture France SAS
More informationnot to be republished NCERT BIOTECHNOLOGY AND ITS APPLICATIONS CHAPTER BIOLOGY, EXEMPLAR PROBLEMS MULTIPLE-CHOICE QUESTIONS
82 BIOLOGY, EXEMPLAR PROBLEMS CHAPTER 12 BIOTECHNOLOGY AND ITS APPLICATIONS 1. Bt cotton is not: a. A GM plant b. Insect resistant MULTIPLE-CHOICE QUESTIONS c. A bacterial gene expressing system d. Resistant
More informationJerome Peribere President and CEO Dow AgroSciences
Jerome Peribere President and CEO Dow AgroSciences Goldman Sachs Agricultural Conference February 12, 2008 Dow AgroSciences Delivers Outstanding Year $Billion Sales $Billion EBIT* 3.8 0.6 3.6 0.4 3.4 0.2
More informationBiological Control of Myllocerus subasciatus Guerin Infesting Brinjal (Solanum melongena L.) Using Bacillus thuringiensis ssp.
Biological Control of Myllocerus subasciatus Guerin Infesting Brinjal (Solanum melongena L.) Using Bacillus thuringiensis ssp. tenebrionis Sukhada Mohandas Y. Saravanan and K. Manjunath Department of Biotechnology
More informationGenetic engineering and the food we eat*
Genetic engineering and the food we eat* Prof. Daniel Chamovitz Tel Aviv University *and the clothes we wear, and the medicines we take, and gasoline we burn Problem #1: World Population is exploding 2011
More informationStatus of Biosafety of GMOs in South East Asia
Status of Biosafety of GMOs in South East Asia Ginna G. Geal Consultant, FAO project on Updating Status of Biotechnology in Developing Countries(FAOBioDec) and adjunct professor, Development Communication
More informationSOUTHERN STATES HYBRID SEED CORN
Southern States has corn hybrids with the built-in convenience of trait combinations to fit your needs. A key part of producing a profitable corn program is to select the right hybrids for your growing
More informationEnhancement of Bacillus thuringiensis Cry3Aa and Cry3Bb Toxicities to Coleopteran Larvae by a Toxin-Binding Fragment of an Insect Cadherin
APPLIED AND ENVIRONMENTAL MICROBIOLOGY, May 2009, p. 3086 3092 Vol. 75, No. 10 0099-2240/09/$08.00 0 doi:10.1128/aem.00268-09 Copyright 2009, American Society for Microbiology. All Rights Reserved. Enhancement
More informationBiotechnological approaches in Pest Management
Biotechnological approaches in Pest Management Biotechnology in Agriculture? Any technique that uses living organisms or substances from these organisms, to make or modify a product, to improve plants
More informationTrait stacking in transgenic crops: Challenges and opportunities
GM Crops ISSN: 1938-1999 (Print) 1938-2006 (Online) Journal homepage: http://www.tandfonline.com/loi/kgmc19 Trait stacking in transgenic crops: Challenges and opportunities Qiudeng Que, Mary-Dell M. Chilton,
More informationINTRODUCTION. Department of Crop Sciences, N-305 Turner Hall, University of Illinois, 1102 South Goodwin Avenue, Urbana, Illinois 61801
pubs.acs.org/jafc Relevance of Traditional Integrated Pest Management (IPM) Strategies for Commercial Corn Producers in a Transgenic Agroecosystem: A Bygone Era? Michael E. Gray* Department of Crop Sciences,
More informationAuthorisation on European level and role of EFSA GMO Panel in food risk assessment
Authorisation on European level and role of EFSA GMO Panel in food risk assessment Detlef Bartsch BVL (Berlin) on behalf of EFSA GMO Unit ROUND TABLE: GMO IN FOOD PRODUCTION Opatija, Croatia 23 rd of October
More informationAdvances of transgenic Bt-crops in insect pest management: An overview
2016; 4(3): 48-52 E-ISSN: 2320-7078 P-ISSN: 2349-6800 JEZS 2016; 4(3): 48-52 2016 JEZS Received: 07-03-2016 Accepted: 08-04-2016 Juma Ibrahim Mabubu Muhammad Nawaz Hongxia Hua Correspondence Juma Ibrahim
More informationUnapproved Genetically Modified Wheat Discovered in Oregon: Status and Implications
Unapproved Genetically Modified Wheat Discovered in Oregon: Status and Implications Tadlock Cowan Analyst in Natural Resources and Rural Development June 7, 2013 CRS Report for Congress Prepared for Members
More informationEngineering Bacillus thuringiensis Bioinsecticides with an Indigenous Site-Specific Recombination System
APPLIED AND ENVIRONMENTAL MICROBIOLOGY, Dec. 1996, p. 4367 4373 Vol. 62, No. 12 0099-2240/96/$04.00 0 Copyright 1996, American Society for Microbiology Engineering Bacillus thuringiensis Bioinsecticides
More informationINSECTICIDE RECOMMENDATIONS FOR FIELD CORN 2018 ENT 16 Raul T. Villanueva, Extension Entomologist
INSECTICIDE RECOMMENDATIONS FOR FIELD CORN 2018 ENT 16 Raul T. Villanueva, Extension Entomologist This publication was prepared as a guide for use in the selection of agricultural insecticides. It is not
More informationGMOs: Distinguishing Fact from Fiction
GMOs: Distinguishing Fact from Fiction Margaret Smith Plant Breeding & Genetics Cornell University Topics Why the controversy? What is genetic engineering? Context previous crop genetic change What GE
More informationThe GMO pipeline evolving biotechnologies but same old GM crops. In Memory of Dr Mae-wan Ho
The GMO pipeline evolving biotechnologies but same old GM crops In Memory of Dr Mae-wan Ho Overview of presentation Status of first generation GMOs after 20 years of commercialisation failure to live up
More informationEcological Impacts of Genetically Modified Crops: Ten Years of Field Research and Commercial Cultivation
Adv Biochem Engin/Biotechnol (2007) 107: 235 278 DOI 10.1007/10_2007_048 Springer-Verlag Berlin Heidelberg Published online: 31 March 2007 Ecological Impacts of Genetically Modified Crops: Ten Years of
More informationNon GMO Crop Production. Joe Lawrence
Non GMO Crop Production Joe Lawrence 1 Crops of Potential Interest: DAIRY Field Crops where certain varieties/hybrids contain GE Traits Corn Cotton Alfalfa Canola Soybean Sugar Beets Conventional term
More informationQuest for 300 Bushel Corn
Quest for 300 Bushel Corn 9 billion people by 2050 requires a doubling of grain production including corn 300 bu corn produced each year in the U.S. National Corn Growers Contest Quest for 300 Bushel Corn
More informationTechnology Application Portfolio
Generon was born in 2003 as a spin-off of Neotron Group, one of the biggest player, in analytical and consultancy services for food production and distribution companies. Generon develops, manufactures,
More information10/22/2008. AGRN 1003/1004 Dr. Weaver
AGRN 1003/1004 Dr. Weaver Weeds Disease pathogens (fungi, bacteria, viruses, nematodes) Insects and related organisms Birds Mammals (deer, rabbits, rodents) Discussion of specific pest problems will occur
More informationGrower Guide. Insect Resistance Management for u.s. corn- and cotton-growing Areas
Grower Guide Insect Resistance Management for u.s. corn- and cotton-growing Areas Page Table of Contents 1 Why Plant a Refuge? 3 Corn Refuge Requirements 6 7 9 10 10 11 13 14 Cotton Refuge Requirements
More information(Question No EFSA-Q ) Opinion adopted on 13 October 2005
Opinion of the Scientific Panel on Genetically Modified Organisms on an application (Reference EFSA-GMO-UK-2004-01) for the placing on the market of glyphosate-tolerant and insectresistant genetically
More informationBiosafety Issues and Bt cotton A case study. O. P. GOVILA Retd. Professor Genetics IARI
Biosafety Issues and Bt cotton A case study O. P. GOVILA Retd. Professor Genetics IARI Introduction Classical plant breeding is limited to the introduction of required characters into plant by genetic
More informationOrganisation de Coopération et de Développement Economiques Organisation for Economic Co-operation and Development
Unclassified ENV/JM/MONO(2007)14 ENV/JM/MONO(2007)14 Unclassified Organisation de Coopération et de Développement Economiques Organisation for Economic Co-operation and Development 26-Jul-2007 English
More informationNewLeaf Potatoes: Friend or Foe A study of the GMO potato. By Rick Swenson English 320 Final Paper Dr. Sullivan 5/6/04
NewLeaf Potatoes: Friend or Foe A study of the GMO potato By Rick Swenson English 320 Final Paper Dr. Sullivan 5/6/04 Introduction: In 1995 a new potato variety was introduced to the market, this new potato
More informationCORN PRODUCT USE GUIDE
CORN PRODUCT USE GUIDE U.S. Edition SmartStax POWERCORE Herculex Advanced This Corn Product Use Guide (Guide) sets forth the requirements for growing corn hybrids with Bacillus thuringiensis (Bt) traits,
More informationGLOBAL AGRICULTURE & CHEMICALS CONFERENCE
B A N K O F A M E R I C A M E R R I L L LY N C H GLOBAL AGRICULTURE & CHEMICALS CONFERENCE J I M C O L L I N S Chief Operating Officer, Agriculture Division of DowDuPont M a r c h 1, 2 0 1 8 FORWARD-LOOKING
More informationU.S. TECHNOLOGY USE GUIDE. and INSECT RESISTANCE MANAGEMENT OVERVIEW 2017 TUG
U.S. TECHNOLOGY USE GUIDE and INSECT RESISTANCE MANAGEMENT OVERVIEW 2017 TUG The Quickest, Easiest way to Sign Your Monsanto Technology/Stewardship Agreement (MTSA). Monsanto uses the AgCelerate Stewardship
More information[ 2 ] [ 3 ] WHAT IS BIOTECHNOLOGY? HOW IS BIOTECHNOLOGY DIFFERENT FROM THE TRADITIONAL WAY OF IMPROVING CROPS?
WHAT IS BIOTECHNOLOGY? Biotechnology is a modern technology that makes use of organisms (or parts thereof) to make or modify products; improve and develop microorganisms, plants or animals; or develop
More informationThe name of corporation obtaining approval, the name of its representative, and the address of its main office
The name of corporation obtaining approval, the name of its representative, and the address of its main office Name: Applicant: Address: DuPont Kabushiki Kaisha Yoshiyuki Tanaka, President 11-1 Nagata-cho
More informationGenetically Modified Foods: Are They Safe?
Genetically Modified Foods: Are They Safe? W.F. Kee Industry Analyst Technical Insights Group AGRI-FOOD SAFETY AND STANDARDS SEMINAR 2010 Berjaya Times Square Hotel & Convention Centre, Kuala Lumpur January
More informationHeritability and stability of resistance to Bacillus thuringiensis in Ostrinia nubilalis (Lepidoptera: Pyralidae)
Bulletin of Entomological Research (1999) 89, 449 454 449 Heritability and stability of resistance to Bacillus thuringiensis in Ostrinia nubilalis (Lepidoptera: Pyralidae) F. Huang 1, R.A. Higgins 1 *,
More informationUSDA Foreign Agricultural Service GAIN Report. Global Agriculture Information Network. Required Report - public distribution
GAIN Report Global Agriculture Information Network Template Version 2.09 Required Report - public distribution AS6039 Australia Biotechnology Agricultural Biotechnology Annual Report 2006 Date: 6/27/2006
More informationBruce Potter, Jeff Irlbeck and Jodie Getting, University of Minnesota Department of Entomology and Southwest Research and Outreach Center
Trial: 2006-Headline Corn The effect of Headline fungicide on the yield of four corn hybrids. Bruce Potter, Jeff Irlbeck and Jodie Getting, University of Minnesota Department of Entomology and Southwest
More informationGenetic Engineering & Recombinant DNA
Genetic Engineering & Recombinant DNA Chapter 10 Copyright The McGraw-Hill Companies, Inc) Permission required for reproduction or display. Applications of Genetic Engineering Basic science vs. Applied
More informationGenetic Engineering in Cotton
JUNE 1999 7 Genetic Engineering in Cotton Genetic engineering of cotton is less than two decades old and is talked about in every cotton-producing country of the world. The need to induce non-cotton genes
More informationIntellectual Property Rights Why, What, and How?
Intellectual Property Rights Why, What, and How? Susana Goggi Class Dec 5 th 2017 ISU 1 2 The resource outlook to 2050 By how much do land, water use and crop yields need to increase by 2050? by Jelle
More informationGMO-Plants: Basics-Technology-Legislation-Analysis. Dr. F. Waldherr CONGEN Biotechnologie GmbH
-Plants: Basics-Technology-Legislation-Analysis Dr. F. Waldherr CONGEN Biotechnologie GmbH In September 2009 unauthorized linseed FP967/CDC Triffid from Canada was detected in europoean raw materials and
More informationDeveloping Herbicide BioAssays. Barb Bolan, RGT
Developing Herbicide BioAssays Barb Bolan, RGT HERBICIDE BIOASSAY Used to determine presence or absence of specific herbicide trait With statistics & a good sample, gives estimate of lot purity Typically
More informationPocket K No. 2. Plant Products of Biotechnology
Pocket K No. 2 Plant Products of Biotechnology Plant products of biotechnology have been available in the market for 21 years in 2016. These modified crops look like their traditional counterparts, but
More informationInsect Updates In-service. Scott Stewart WTREC, Jackson, TN University of Tennessee Extension
Insect Updates In-service Scott Stewart WTREC, Jackson, TN University of Tennessee Extension New Pests Invasives In-service, March 19-21 Kudzu Bug www.kudzubug.org Spreading quickly Brown Marmorated Stink
More information! Modern technology allows for the insertion of desirable genes into target organism genomes (recombinant DNA)
1! Farmers have been genetically modifying plants for 1000s of years Artificial selection propagates bad traits with the good Most recently, trying to eliminate bad traits! Modern technology allows for
More informationEcological Aspects of Genetically Modified Crops
Ecological Aspects of Genetically Modified Crops THOMAS E. NICKSON, Co-Director MICHAEL J. MCKEE, Co-Director Ecological Technology Center, Monsanto Company St. Louis, MO ABSTRACT It is evident from many
More informationThe Impact of Bt Crops on the Developing World. Plant Incorporated Protectants Bt Crops. Joseph Huesing Monsanto Company
The Impact of Bt Crops on the Developing World AgBioForum, 7(1&2): 84-95. 2004 AgBioForum. Joseph Huesing Monsanto Company Leigh English Monsanto Company Genetically modified (GM) plants are grown on more
More informationOECD and Substantial Equivalence Peter Kearns, OECD
OECD and Substantial Equivalence Peter Kearns, OECD 28 March 2011 Transgenic plants: milestones 1973: First successful recombinant DNA experiment using bacterial genes 1985: First transgenic plant resistant
More informationPest-Resistance Management Insecticidal Bt-Potatoes
UC Vegetable Research and Information Center Pest Resistance Management Pest-Resistance Management Insecticidal Bt-Potatoes Can you imagine a plant that produces its own insect-killing protein that is
More informationWIPO-UPOV SYMPOSIUM ON INTELLECTUAL PROPERTY RIGHTS IN PLANT BIOTECHNOLOGY
ORIGINAL: English DATE: October 3, 2003 E WORLD INTELLECTUAL PROPERTY ORGANIZATION INTERNATIONAL UNION FOR THE PROTECTION OF NEW VARIETIES OF PLANTS WIPO-UPOV SYMPOSIUM ON INTELLECTUAL PROPERTY RIGHTS
More informationBt Corn & European Corn Borer
BU-7055-GO 1997 To Order Bt Corn & European Corn Borer Long-Term Success Through Resistance Management Copyright 1997 Regents of the University of Minnesota. All rights reserved. Contents Authors Dedication
More informationTuesday, December 20, 1:00 pm
Iowa Farm Bureau s Margin Management Webinar Series presents: Iowa Pest Resistance Management Plan Webinar Tuesday, December 20, 1:00 pm Please Enter as a Guest shortly before the webinar time. Speaker:
More information2011 SSF and Acceleron Webinar
FOLLOW ON-SCREEN PROMPTS TO CALL IN Both Phone and CPU Speaker Options Available 2011 SSF and Acceleron Webinar Including: Maximizing Seed Service Fees 2011 Monsanto Trait Bag and Tag Labeling Acceleron
More informationTransgenic Bt Corn Hybrids and Pest Management in the USA
Transgenic Bt Corn Hybrids and Pest Management in the USA Siddharth Tiwari and Roger R. Youngman Abstract Corn, Zea mays L., grown in many areas of the United States suffers from a variety of insect species
More informationWhat is Biotechnology?
What is Biotechnology? Biotechnology is a modern technology that makes use of organisms (or parts thereof) to: make or modify products; improve and develop microorganisms, plants or animals; or develop
More informationTransgenic Plants Model Answers
Transgenic Plants Model Answers Compiled by Mr. Nitin Swamy Asst. Prof. Department of Biotechnology Page 1 of 7 Transgenic plants are the ones, whose DNA is modified using genetic engineering techniques.
More informationHerculex I Product Overview
Herculex I Product Overview Herculex I insect protection for corn, co-developed by Dow AgroSciences and Pioneer Hi-Bred is a superior example of the use of a natural Bt protein. The Bt protein (Cry1F)
More informationIt s still winter in Indiana. Developments in Agronomy & Maize Management. Outline. Herbicide resistant weeds. Examples of HR weeds
FAR FAR New New Zealand Zealand Maize Maize Conference Conference 12-13 12-13 Feb Feb 2003, 2003, Hamilton, Hamilton, New New Zealand Zealand Developments in Agronomy & Maize It s still winter in Indiana
More informationA Meta-Analysis of Effects of Bt Crops on Honey Bees (Hymenoptera: Apidae)
A Meta-Analysis of Effects of Bt Crops on Honey Bees (Hymenoptera: Apidae) Jian J. Duan 1, Michelle Marvier 2 *, Joseph Huesing 1, Galen Dively 3, Zachary Y. Huang 4 1 Ecological Technology Center, Monsanto
More informationFate and Effects in Soil of Cry Proteins from Bacillus thuringiensis: Influence of Physicochemical and Biological Characteristics of Soil
The Open Toxinology Journal, 2010, 3, 133-153 133 Open Access Fate and Effects in Soil of Cry Proteins from Bacillus thuringiensis: Influence of Physicochemical and Biological Characteristics of Soil Deepak
More informationResistance of fall armyworm, Spodoptera frugiperda ( J.E. Smith) to Bacillus thuringiensis
Louisiana State University LSU Digital Commons LSU Master's Theses Graduate School 2014 Resistance of fall armyworm, Spodoptera frugiperda ( J.E. Smith) to Bacillus thuringiensis Ying Niu Louisiana State
More informationEXPERIENCE ADVANTAGE. the B- H Product Guide
EXPERIENCE the B- H ADVANTAGE 2017 Product Guide table of contents 2 Explaining the Numbers 3 Corn Characteristics Chart 5 Corn Products 12 Silage Characteristics Chart 13 Sorghum Products 16 Sorghum Characteristics
More informationThe Challenges of [high-throughput] Phenotyping
The Challenges of [high-throughput] Phenotyping Mount Hood - sept 2008 Topics Introducing BASF Plant Science Phenotyping, for what purposes? What are the challenges? High-throughput phenotyping The TraitMill
More informationPLANTS AND BIOTECHNOLOGY
INTRODUCTION Biotechnology can be defined as the combination of technology and biology. Biotechnological processes take different types of organisms (biology) and modifies them to produce something useful
More informationHerbicide Tolerance & Insect Resistance
Herbicide Tolerance & Insect Resistance Jay G.Varshney Director DIRECTORATE OF WEED SCIENCE RESEARCH JABALPUR (M.P) INDIAN AGRICULTURE - SOME BASIC FACTS In India, the population has already exceeded 1.1
More informationMolecular assessment of GMOs Ilona Kryspin Sørensen PhD DTU Food Division for Risk Assessment and Nutrition
Molecular assessment of GMOs Ilona Kryspin Sørensen PhD DTU Food Division for Risk Assessment and Nutrition Objective : to assess the level of documentation necessary for the evaluation of the insertion
More informationNiu et al.: Fall Armyworm Susceptibility to Bt Genes in Corn 701
Susceptibility of Field Populations of the Fall Armyworm (Lepidoptera: Noctuidae) from Florida and Puerto Rico to Purified Cry1f Protein and Corn Leaf Tissue Containing Single and Pyramided Bt Genes Author(s):
More informationBacillus thuringiensis: applications in agriculture and insect resistance management. A review
Bacillus thuringiensis: applications in agriculture and insect resistance management. A review Vincent Sanchis, Denis Bourguet To cite this version: Vincent Sanchis, Denis Bourguet. Bacillus thuringiensis:
More informationMCDB 1041 Class 27. Making recombinant DNA and using it
MCDB 1041 Class 27 Making recombinant DNA and using it Learning Goals Explain why and how bacteria can be easily used to make copies of human DNA. Compare the two methods for making lots of copies of DNA:
More informationRegulation of Agricultural Biotechnology in the United States: Overview
Regulation of Agricultural Biotechnology in the United States: Overview Webinar for: National Agricultural Law Center July 15, 2015 Michael J. Firko, Ph.D. APHIS Deputy Administrator (BRS) History of Plant
More informationNCR553 Insect Resistant Crops Through Genetic Engineering University...
1 of 9 6/10/2010 9:43 AM University of Missouri Extension NCR553, New January 1995 Insect-Resistant Crops Through Genetic Engineering Glenda D. Webber Office of Biotechnology Iowa State University North
More informationFood Biotechnology: Agustin K Wardani
Food Biotechnology: Agustin K Wardani Biotechnology helps to meet our basic needs. Food, clothing, shelter, health and safety What is Food Biotechnology? Food biotechnology is the evolution of traditional
More informationHow plants survive glyphosate
IOWA STATE UNIVERSITY University Extension http://www.weeds.iastate.edu/mgmt/2007/glysurvival.pdf Weed Science Department of Agronomy How plants survive glyphosate Glyphosate is the most widely used herbicide
More information