GFP as affinity tag for immunoprecipitation

Size: px
Start display at page:

Download "GFP as affinity tag for immunoprecipitation"

Transcription

1 1/5 Preamble This document compares existing conventional antibodies against GFP in biochemical studies with the GFPTrap, a readytouse pulldown reagent derived from alpaca. What are the differences between the novel ChromoTek GFPTrap, which is based on a nanobody derived from alpaca, and conventional antigfp antibodies (figure 1)? Figure 1 Introduction Today, a considerable number of life science laboratories apply fluorescent proteins in cell biology to study protein localization, interaction and dynamics. Fluorescent proteins have redefined fluorescence microscopy because they are nontoxic and are less harmful when illuminated in live cells as compared to chemical fluorescent dyes. However, data generated from microscopic studies require complementary technologies to obtain a more comprehensive set of information. Additional aspects including posttranslational modifications, DNA binding, enzymatic activity, and/or complex formation respectively proteinprotein interaction are investigated. Mass spectrometry, chromatin immunoprecipitation (ChIP), coimmunoprecipitation and/or affinity purification methods are used to complement microscopic measurements. A common challenge for the above listed biochemical applications is the absence of validated antibodies against the protein of interest. Consequently, peptide and protein tags

2 2/5 like Myc, FLAG, HA, MBP and GST among others may be recombinantly fused to the protein of interest in order to utilize commercially available antibodies. Researchers now have the opportunity to apply fluorescent proteins as tags for those biochemical studies rather than recloning the genes coding for their protein of interest into vectors with traditional epitope tags. This is due to the availability of high quality immobilized GFPnanobody ChromoTek GFPTrap. GFPTrap vs. GFPantibody: workflow comparison GFPTrap : As shown in figure 2, after addition of cell lysate to the ChromoTek GFPTrap the immunoprecipitation of the GFPtagged protein takes place within a short incubation time; the entire workflow is typically completed within one hour because of high sensitivity, fast binding and extreme low dissociation constant. Conventional GFPantibody: In contrast, when adding cell lysate to traditional antibodies against GFP, the incubation may take up to 12 hours or overnight. Plus, in a second step, the GFP antibody complex needs to be coupled to protein A/G beads, which takes another 12 hours. This makes the entire workflow to last typically more than 3 hours or (much) longer. Figure 2: Workflow comparison between immunoprecipitations with alpaca Nanobody derived GFPTrap (left) and with conventional antigfp IgG antibodies (right). The high specificity and affinity allow for considerable shorter incubation times.

3 3/5 Immunoprecipitation results Input (I), nonbound (FT) and bound (B) fractions processed for IP with GFPTrap (Figure 3, left) and antigfp antibodies coupled to Protein A/G (Figure 3, right) were separated by SDSPAGE followed by Coomassie staining and Western Blotting. GFP has been purified using both approaches. The bound fraction of the GFPTrap shows only the purified GFPfusion protein of interest. In contrast, the bound fraction of the conventional GFP antibodies contains two additional strong bands besides the purified protein of interest. These bandsat approximately 50 kda and 25 kdaare contaminating heavy and light chains from the conventional antigfp antibody used for the immunoprecipitation. This may be a serious problem if you want to detect proteins of similar size. Figure 3: Immunoprecipitation of GFP from cell extracts. Protein extracts of GFPproducing HEK 293T cells were subjected to immunoprecipitation with GFPTrap or monoclonal antigfp antibody. Input (I), flowthrough (FT), and bound fractions (B) were separated by SDSPAGE and visualized by Coomassie Blue staining (top) or by immunoblot analysis (bottom). Precipitated GFP (green ellipse), denatured heavy (brown cartoon) and light chains (beige cartoon) of the IgG are marked by arrows.

4 4/5 Immunoprecipitation discussion: One challenge of the postgenomic era is the seamless integration of genetic, biochemical, and cell biological data. Here, we not only have demonstrated how the fluorescent protein GFP can be efficiently used as an affinity tag for biochemical studies of fusion proteins, but have also presented additional performance benefits: GFPTrap GFP antibody Ready to use Additional incubation step for binding of antibodies to protein A/G beads No heavy & light antibody chains in your downstream application Contaminating heavy & light antibody chains may appear in your downstream application Very high binding affinity Low binding affinity Harsh wash conditions may be applied for selective proteinprotein interactions Limited buffer/reagent compatibility of IgG Short incubation times of 530 minutes Considerable incubation times of twice minimum 1 hour; this may interfere with low affinity interaction partners if you perform CoIP High reproducibility due to recombinant expression with very low batch to batch variation Reproducibility can be high dependent on monoclonal but polyclonal can be different Not suitable as detection antibody in Western Blot Can generally be used as detection antibody in Western Blot Technology: GFPTrap Conventional antibodies are powerful tools in life science research. However, the large and complex structuretwo heavy and two light chainscan be troublesome in certain applications. Camelidae (alpacas, llamas, camels and dromedaries) possess a second type of antibody called heavy chain antibodies (hcabs). HcAbs are devoid of light chains and bind their antigen via a single variable domain (V H H), also known as a nanobody. These V H H domains have excellent binding properties and can be produced at constant high quality without batchtobatch variations. Coupled to an immobilizing matrix like agarose beads, V H Hs are superior tools for immunoprecipitations. Figure 4: GFPTrap : antigfp V HH coupled to agarose beads

5 5/5 Further reading: more than 700 publications Many researchers have successfully used the GFPTrap for a number of high impact publications that ChromoTek collects in a webbased database. We are frequently updating our database; currently there are more than 700 publications for the GFPTrap. You can filter your selection by organism, and type of experiment at our website to find relevant publications relevant for your studies. You can also find a section on frequently asked questions at ChromoTek, GFPTrap are registered trademarks of ChromoTek GmbH, Martinsried, Germany.

Perform reproducible immunoprecipitation in less than 40 minutes

Perform reproducible immunoprecipitation in less than 40 minutes Perform reproducible immunoprecipitation in less than 40 minutes Dynabeads products Immunoprecipitation made easy with low nonspecific binding, high yield, and reproducibility Magnetic beads have become

More information

Immunoprecipitation of fusion proteins from cell extracts using Selector Resins

Immunoprecipitation of fusion proteins from cell extracts using Selector Resins Immunoprecipitation of fusion proteins from cell extracts using Selector Resins Protocol Last date of revision November 2017 Version PR93-0001 For research use only Trademark information The owners of

More information

IMMUNOPRECIPITATION TROUBLESHOOTING TIPS

IMMUNOPRECIPITATION TROUBLESHOOTING TIPS IMMUNOPRECIPITATION TROUBLESHOOTING TIPS Creative Diagnostics Abstract Immunoprecipitation (IP) is the technique of precipitating a protein antigen out of solution using an antibody that specifically binds

More information

VERIFY Tagged Antigen. Validation Data

VERIFY Tagged Antigen. Validation Data VERIFY Tagged Antigen Validation Data Antibody Validation Figure 1. Over-expression cell lysate for human STAT3 (NM_139276) was used to test 3 commercial antibodies. Antibody A shows strong antigen binding.

More information

Comparison of different methods for purification analysis of a green fluorescent Strep-tag fusion protein. Application

Comparison of different methods for purification analysis of a green fluorescent Strep-tag fusion protein. Application Comparison of different methods for purification analysis of a green fluorescent Strep-tag fusion protein Application Petra Sebastian Meike Kuschel Stefan Schmidt Abstract This Application Note describes

More information

IMMUNOPRECIPITATION (IP)

IMMUNOPRECIPITATION (IP) 1 IMMUNOPRECIPITATION (IP) Overview and Technical Tips 2 CONTENTS 3 7 8 9 12 13 17 18 19 20 Introduction Factors Influencing IP General Protocol Modifications Of IP Protocols Troubleshooting Contact Us

More information

Polyclonal ARHGAP25 antibody was prepared from rabbit serum after intracutaneous

Polyclonal ARHGAP25 antibody was prepared from rabbit serum after intracutaneous Preparation and purification of polyclonal antibodies Polyclonal ARHGAP25 antibody was prepared from rabbit serum after intracutaneous injections of glutathione S-transferase-ARHGAP25-(509-619) (GST-coiled

More information

Protein Purification Products. Complete Solutions for All of Your Protein Purification Applications

Protein Purification Products. Complete Solutions for All of Your Protein Purification Applications Protein Purification Products Complete Solutions for All of Your Protein Purification Applications FLAG-Tagged Protein Products EXPRESS with the pcmv-dykddddk Vector Set Fuse your protein of interest to

More information

Post-translational modification

Post-translational modification Protein expression Western blotting, is a widely used and accepted technique to detect levels of protein expression in a cell or tissue extract. This technique measures protein levels in a biological sample

More information

Supplemental Information. Pacer Mediates the Function of Class III PI3K. and HOPS Complexes in Autophagosome. Maturation by Engaging Stx17

Supplemental Information. Pacer Mediates the Function of Class III PI3K. and HOPS Complexes in Autophagosome. Maturation by Engaging Stx17 Molecular Cell, Volume 65 Supplemental Information Pacer Mediates the Function of Class III PI3K and HOPS Complexes in Autophagosome Maturation by Engaging Stx17 Xiawei Cheng, Xiuling Ma, Xianming Ding,

More information

Lecture 8: Affinity Chromatography-III

Lecture 8: Affinity Chromatography-III Lecture 8: Affinity Chromatography-III Key words: Chromatography; Affinity chromatography; Protein Purification During this lecture, we shall be studying few more examples of affinity chromatography. The

More information

Lecture 5: 8/31. CHAPTER 5 Techniques in Protein Biochemistry

Lecture 5: 8/31. CHAPTER 5 Techniques in Protein Biochemistry Lecture 5: 8/31 CHAPTER 5 Techniques in Protein Biochemistry Chapter 5 Outline The proteome is the entire set of proteins expressed and modified by a cell under a particular set of biochemical conditions.

More information

Chromatin immunoprecipitation: five steps to great results

Chromatin immunoprecipitation: five steps to great results Chromatin immunoprecipitation: five steps to great results Introduction The discovery and use of antibodies in life science research has been critical to many advancements across applications, including

More information

Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.

Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG. Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.SCUBE2, E-cadherin.Myc, or HA.p120-catenin was transfected in a combination

More information

5.2 Protein purification

5.2 Protein purification Purification of a His 6 -tagged Green Fluorescent Protein (GFP). Protein purification.. Purification of a His 6 -tagged Green Fluorescent Protein (GFP) Principle You can add either a N- or C-terminal His

More information

Supplementary methods

Supplementary methods Supplementary methods Cell culture, infection, transfection, and RNA interference HEK293 cells and its derivatives were grown in DMEM supplemented with 10% FBS. Various constructs were introduced into

More information

Rapid and sensitive determination of recombinant protein expression

Rapid and sensitive determination of recombinant protein expression APPLIAION NOE Pro-Detect Rapid assays Rapid and sensitive determination of recombinant protein expression Introduction Recombinant protein expression and purification is a multistep process that includes:

More information

Supplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53

Supplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53 Supplementary data Supplemental Figure 1 A sienigma #2 sienigma sicontrol a-enigma - + ++ - - - - - - + ++ - - - - - - ++ B sienigma F-Enigma F-EnigmaSM a-flag HLK3 cells - - - + ++ + ++ - + - + + - -

More information

Enabling Immunoprecipitation with the Rainin PureSpeed System. Rishi Porecha Rainin Instrument LLC

Enabling Immunoprecipitation with the Rainin PureSpeed System. Rishi Porecha Rainin Instrument LLC Enabling Immunoprecipitation with the Rainin PureSpeed System Rishi Porecha Rainin Instrument LLC PureSpeed Tip Product Description Series of tips that have been modified to incorporate a specific volume

More information

Amersham * ECL * Gel horizontal electrophoresis system

Amersham * ECL * Gel horizontal electrophoresis system GE Healthcare Life Sciences Data file 28-9970-20 AB Electrophoresis products Amersham * ECL * Gel horizontal electrophoresis system Amersham ECL Gel and Amersham ECL Gel Box constitute a horizontal mini-gel

More information

Product. Ni-NTA His Bind Resin. Ni-NTA His Bind Superflow. His Bind Resin. His Bind Magnetic Agarose Beads. His Bind Column. His Bind Quick Resin

Product. Ni-NTA His Bind Resin. Ni-NTA His Bind Superflow. His Bind Resin. His Bind Magnetic Agarose Beads. His Bind Column. His Bind Quick Resin Novagen offers a large variety of affinity supports and kits for the purification of recombinant proteins containing popular peptide fusion tags, including His Tag, GST Tag, S Tag and T7 Tag sequences.

More information

supplementary information

supplementary information DOI: 10.1038/ncb2172 Figure S1 p53 regulates cellular NADPH and lipid levels via inhibition of G6PD. (a) U2OS cells stably expressing p53 shrna or a control shrna were transfected with control sirna or

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION (Supplementary Methods and Materials) GST pull-down assay GST-fusion proteins Fe65 365-533, and Fe65 538-700 were expressed in BL21 bacterial cells and purified with glutathione-agarose beads (Sigma).

More information

MagSi Beads. Magnetic Silica Beads for Life Science and Biotechnology study

MagSi Beads. Magnetic Silica Beads for Life Science and Biotechnology study MagSi Beads Magnetic Silica Beads for Life Science and Biotechnology study MagnaMedics Diagnostics B.V. / Rev. 9.2 / 2012 Wide range of products for numerous applications MagnaMedics separation solutions

More information

Supporting Information

Supporting Information Supporting Information Üstün and Börnke, 2015 Figure S1: XopJ does not display acetyltransferase activity. Autoacetylation activity in vitro. Acetylation reactions using MBP, MBP-XopJ, GST and GST-HopZ1a

More information

Cat. No. MG17PG-1ml XPRESSAFFINITY PROTEIN G- MAGNETIC NANOPARTICLES (MNP) FOR RESEARCH APPLICATIONS

Cat. No. MG17PG-1ml XPRESSAFFINITY PROTEIN G- MAGNETIC NANOPARTICLES (MNP) FOR RESEARCH APPLICATIONS Cat. No. MG17PG-1ml XPRESSAFFINITY PROTEIN G- MAGNETIC NANOPARTICLES (MNP) FOR RESEARCH APPLICATIONS Product Description: MagGenome s Protein G-MNP provides a fast and convenient method for affinity based

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11070 Supplementary Figure 1 Purification of FLAG-tagged proteins. a, Purification of FLAG-RNF12 by FLAG-affinity from nuclear extracts of wild-type (WT) and two FLAG- RNF12 transgenic

More information

Technical Note Detection of post-immunoprecipitation proteins by Western blot using the Quick Western Kit IRDye 680RD

Technical Note Detection of post-immunoprecipitation proteins by Western blot using the Quick Western Kit IRDye 680RD Technical Note Detection of post-immunoprecipitation proteins by Western blot using the Quick Western Kit IRDye 680RD Developed for: Aerius, Odyssey Classic, Odyssey CLx and Odyssey Sa Imaging Systems

More information

T H E J O U R N A L O F C E L L B I O L O G Y

T H E J O U R N A L O F C E L L B I O L O G Y T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Nakajima and Tanoue, http://www.jcb.org/cgi/content/full/jcb.201104118/dc1 Figure S1. DLD-1 cells exhibit the characteristic morphology

More information

SUPPLEMENTARY INFORMATION FILE

SUPPLEMENTARY INFORMATION FILE SUPPLEMENTARY INFORMATION FILE Existence of a microrna pathway in anucleate platelets Patricia Landry, Isabelle Plante, Dominique L. Ouellet, Marjorie P. Perron, Guy Rousseau & Patrick Provost 1. SUPPLEMENTARY

More information

Immobilized Streptavidin Resin

Immobilized Streptavidin Resin 438PR-01 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Immobilized Streptavidin Resin (Cat. # 786-390, 786-590, 786-591, 786-592) think

More information

Strep-Spin Protein Miniprep Kit Catalog No. P2004 & P2005

Strep-Spin Protein Miniprep Kit Catalog No. P2004 & P2005 INSTRUCTION MANUAL Strep-Spin Protein Miniprep Kit Catalog No. P2004 & P2005 Highlights Fast & Simple: Purify Strep-tagged proteins from cell-free extracts using a spin-column in 7 minutes High-Quality:

More information

Lecture 22 Eukaryotic Genes and Genomes III

Lecture 22 Eukaryotic Genes and Genomes III Lecture 22 Eukaryotic Genes and Genomes III In the last three lectures we have thought a lot about analyzing a regulatory system in S. cerevisiae, namely Gal regulation that involved a hand full of genes.

More information

Figure S1. Verification of ihog Mutation by Protein Immunoblotting Figure S2. Verification of ihog and boi

Figure S1. Verification of ihog Mutation by Protein Immunoblotting Figure S2. Verification of ihog and boi Figure S1. Verification of ihog Mutation by Protein Immunoblotting Extracts from S2R+ cells, embryos, and adults were analyzed by immunoprecipitation and immunoblotting with anti-ihog antibody. The Ihog

More information

7.03, 2006, Lecture 23 Eukaryotic Genes and Genomes IV

7.03, 2006, Lecture 23 Eukaryotic Genes and Genomes IV 1 Fall 2006 7.03 7.03, 2006, Lecture 23 Eukaryotic Genes and Genomes IV In the last three lectures we have thought a lot about analyzing a regulatory system in S. cerevisiae, namely Gal regulation that

More information

7.05, 2005, Lecture 23 Eukaryotic Genes and Genomes IV

7.05, 2005, Lecture 23 Eukaryotic Genes and Genomes IV 7.05, 2005, Lecture 23 Eukaryotic Genes and Genomes IV In the last three lectures we have thought a lot about analyzing a regulatory system in S. cerevisiae, namely Gal regulation that involved a hand

More information

Lecture 7: Affinity Chromatography-II

Lecture 7: Affinity Chromatography-II Lecture 7: Affinity Chromatography-II We have studied basics of affinity purification during last lecture. The current lecture is continuation of last lecture and we will cover following: 1. Few specific

More information

For Research Use Only. Not for use in diagnostic procedures.

For Research Use Only. Not for use in diagnostic procedures. Printed December 13, 2011 Version 1.0 For Research Use Only. Not for use in diagnostic procedures. DDDDK-tagged Protein PURIFICATION GEL with Elution Peptide (MoAb. clone FLA-1) CODE No. 3326 / 3327 PURIFICATION

More information

High Performance IP Semi-automated processing with PureSpeed

High Performance IP Semi-automated processing with PureSpeed PureSpeed Tips Fastest Immunoprecipitation Highest protein concentration Extraordinary data quality Both direct and indirect IP Process up to 12 samples at once High Performance IP Semi-automated processing

More information

ONE-HOUR Complete IP-Western Kit

ONE-HOUR Complete IP-Western Kit ONE-HOUR Complete IP-Western Kit Technical Manual No. 0218 Version 06192009 I Description.. 1 II Kit Contents.. 2 III Related Products 2 IV Key Features.. 2 V Storage.. 2 VI ONE-HOUR Western Protocol 3

More information

Figure S1. Sequence alignments of ATRIP and ATR TopBP1 interacting regions.

Figure S1. Sequence alignments of ATRIP and ATR TopBP1 interacting regions. A H. sapiens 204 TKLQTS--ERANKLAAPSVSH VSPRKNPSVVIKPEACS-PQFGKTSFPTKESFSANMS LP 259 B. taurus 201 TKLQSS--ERANKLAVPTVSH VSPRKSPSVVIKPEACS-PQFGKPSFPTKESFSANKS LP 257 M. musculus 204 TKSQSN--GRTNKPAAPSVSH

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION Supplementary figures Supplementary Figure 1: Suv39h1, but not Suv39h2, promotes HP1α sumoylation in vivo. In vivo HP1α sumoylation assay. Top: experimental scheme. Middle: we

More information

Supplementary Figure S1 Purification of deubiquitinases HEK293 cells were transfected with the indicated DUB-expressing plasmids.

Supplementary Figure S1 Purification of deubiquitinases HEK293 cells were transfected with the indicated DUB-expressing plasmids. Supplementary Figure S1 Purification of deubiquitinases HEK293 cells were transfected with the indicated DUB-expressing plasmids. The cells were harvested 72 h after transfection. FLAG-tagged deubiquitinases

More information

A RRM1 H2AX DAPI. RRM1 H2AX DAPI Merge. Cont. sirna RRM1

A RRM1 H2AX DAPI. RRM1 H2AX DAPI Merge. Cont. sirna RRM1 A H2AX DAPI H2AX DAPI Merge Cont sirna Figure S1: Accumulation of RRM1 at DNA damage sites (A) HeLa cells were subjected to in situ detergent extraction without IR irradiation, and immunostained with the

More information

Recruitment of Grb2 to surface IgG and IgE provides antigen receptor-intrinsic costimulation to class-switched B cells

Recruitment of Grb2 to surface IgG and IgE provides antigen receptor-intrinsic costimulation to class-switched B cells SUPPLEMENTARY FIGURES Recruitment of Grb2 to surface IgG and IgE provides antigen receptor-intrinsic costimulation to class-switched B cells Niklas Engels, Lars Morten König, Christina Heemann, Johannes

More information

Supplementary Figure 1 Collision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK2, PPK3 and PPK4 respectively.

Supplementary Figure 1 Collision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK2, PPK3 and PPK4 respectively. Supplementary Figure 1 lision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK, PPK3 and PPK respectively. % of nuclei with signal / field a 5 c ppif3:gus pppk1:gus 0 35 30 5 0 15 10

More information

5.36 Biochemistry Laboratory Spring 2009

5.36 Biochemistry Laboratory Spring 2009 MIT OpenCourseWare http://ocw.mit.edu 5.36 Biochemistry Laboratory Spring 2009 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms. Affinity Tags for Protein

More information

Supplementary Figure 1. The Hsp70 acetylation level is related to the co-chaperone binding of Hsp70 under various stress conditions.

Supplementary Figure 1. The Hsp70 acetylation level is related to the co-chaperone binding of Hsp70 under various stress conditions. Supplementary Figure 1. The Hsp70 acetylation level is related to the co-chaperone binding of Hsp70 under various stress conditions. 1 (a) Etoposide treatment gradually changes acetylation level and co-chaperone

More information

SUPPLEMENTAL MATERIAL. Supplemental Methods:

SUPPLEMENTAL MATERIAL. Supplemental Methods: SUPPLEMENTAL MATERIAL Supplemental Methods: Immunoprecipitation- As we described but with some modifications [22]. As part of another ongoing project, lysate from human umbilical vein endothelial cells

More information

Immunoaffinity Chromatography

Immunoaffinity Chromatography PR120 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Immunoaffinity Chromatography Teacher s Guidebook (Cat. # BE 507) think proteins! think

More information

ENCODE RBP Antibody Characterization Guidelines

ENCODE RBP Antibody Characterization Guidelines ENCODE RBP Antibody Characterization Guidelines Approved on November 18, 2016 Background An integral part of the ENCODE Project is to characterize the antibodies used in the experiments. This document

More information

EPIGENTEK. EpiQuik Tissue Chromatin Immunoprecipitation Kit. Base Catalog # P-2003 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE

EPIGENTEK. EpiQuik Tissue Chromatin Immunoprecipitation Kit. Base Catalog # P-2003 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE EpiQuik Tissue Chromatin Immunoprecipitation Kit Base Catalog # P-2003 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik Tissue Chromatin Immunoprecipitation Kit is suitable for combining the specificity

More information

Strep-Spin Protein Miniprep Kit Catalog No. P2004, P2005

Strep-Spin Protein Miniprep Kit Catalog No. P2004, P2005 INSTRUCTION MANUAL Strep-Spin Protein Miniprep Kit Catalog No. P2004, P2005 Highlights Fast protocol to purify Strep-tagged proteins from cell-free extracts Screen your recombinant colonies directly for

More information

42 fl organelles = 34.5 fl (1) 3.5X X 0.93 = 78,000 (2)

42 fl organelles = 34.5 fl (1) 3.5X X 0.93 = 78,000 (2) SUPPLEMENTAL DATA Supplementary Experimental Procedures Fluorescence Microscopy - A Zeiss Axiovert 200M microscope equipped with a Zeiss 100x Plan- Apochromat (1.40 NA) DIC objective and Hamamatsu Orca

More information

EPIGENTEK. EpiQuik Chromatin Immunoprecipitation Kit. Base Catalog # P-2002 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE

EPIGENTEK. EpiQuik Chromatin Immunoprecipitation Kit. Base Catalog # P-2002 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE EpiQuik Chromatin Immunoprecipitation Kit Base Catalog # P-2002 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik Chromatin Immunoprecipitation Kit is suitable for combining the specificity of

More information

Figure 1: TDP-43 is subject to lysine acetylation within the RNA-binding domain a) QBI-293 cells were transfected with TDP-43 in the presence or

Figure 1: TDP-43 is subject to lysine acetylation within the RNA-binding domain a) QBI-293 cells were transfected with TDP-43 in the presence or Figure 1: TDP-43 is subject to lysine acetylation within the RNA-binding domain a) QBI-293 cells were transfected with TDP-43 in the presence or absence of the acetyltransferase CBP and acetylated TDP-43

More information

Solutions to 7.02 Quiz II 10/27/05

Solutions to 7.02 Quiz II 10/27/05 Solutions to 7.02 Quiz II 10/27/05 Class Average = 83 Standard Deviation = 9 Range Grade % 87-100 A 43 74-86 B 39 55-73 C 17 > 54 D 1 Question 1 (56 points) While studying deep sea bacteria, you discover

More information

EPIGENTEK. EpiQuik Methylated DNA Immunoprecipitation Kit. Base Catalog # P-2019 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE

EPIGENTEK. EpiQuik Methylated DNA Immunoprecipitation Kit. Base Catalog # P-2019 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE EpiQuik Methylated DNA Immunoprecipitation Kit Base Catalog # PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik MeDIP Kit can be used for immunoprecipitating the methylated DNA from a broad range

More information

Cdc42 Activation Assay Kit

Cdc42 Activation Assay Kit A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Cdc42 Activation Assay Kit Catalog Number: 80701 20 assays 1 Table of Content Product Description 3 Assay

More information

Supplementary Fig. 1. Schematic structure of TRAIP and RAP80. The prey line below TRAIP indicates bait and the two lines above RAP80 highlight the

Supplementary Fig. 1. Schematic structure of TRAIP and RAP80. The prey line below TRAIP indicates bait and the two lines above RAP80 highlight the Supplementary Fig. 1. Schematic structure of TRAIP and RAP80. The prey line below TRAIP indicates bait and the two lines above RAP80 highlight the prey clones identified in the yeast two hybrid screen.

More information

Lecture 25 (11/15/17)

Lecture 25 (11/15/17) Lecture 25 (11/15/17) Reading: Ch9; 328-332 Ch25; 990-995, 1005-1012 Problems: Ch9 (study-guide: applying); 1,2 Ch9 (study-guide: facts); 7,8 Ch25 (text); 1-3,5-7,9,10,13-15 Ch25 (study-guide: applying);

More information

Methanol fixation allows better visualization of Kal7. To compare methods for

Methanol fixation allows better visualization of Kal7. To compare methods for Supplementary Data Methanol fixation allows better visualization of Kal7. To compare methods for visualizing Kal7 in dendrites, mature cultures of dissociated hippocampal neurons (DIV21) were fixed with

More information

His-Spin Protein Miniprep

His-Spin Protein Miniprep INSTRUCTIONS His-Spin Protein Miniprep Catalog No. P2001 (10 purifications) and P2002 (50 purifications). Highlights Fast 5 minute protocol to purify His-tagged proteins from cell-free extracts Screen

More information

2-step or indirect immunofluorescence 1. Substrate on which cells are plated: plastic vs. glass; coating vs. non

2-step or indirect immunofluorescence 1. Substrate on which cells are plated: plastic vs. glass; coating vs. non Variables in standard immunostaining protocol 2-step or indirect immunofluorescence 1. Substrate on which cells are plated: plastic vs. glass; coating vs. non 2. Plating density: sparse vs. confluent 3.

More information

Purification of GST-tagged proteins using PureCube Glutathione Agarose

Purification of GST-tagged proteins using PureCube Glutathione Agarose Purification GST-tagged proteins using PureCube Glutathione Agarose Overview This protocol describes the generation a cleared lysate from 200 ml E. coli cell culture, and the purification GST-tagged proteins

More information

5.36 Biochemistry Laboratory Spring 2009

5.36 Biochemistry Laboratory Spring 2009 MIT OpenCourseWare http://ocw.mit.edu 5.36 Biochemistry Laboratory Spring 2009 For information about citing these materials or our Terms of Use, visit: http://ocw.mit.edu/terms. 5.36 Lecture Summary #3

More information

Supplementary Fig. 1 Identification of Nedd4 as an IRS-2-associated protein in camp-treated FRTL-5 cells.

Supplementary Fig. 1 Identification of Nedd4 as an IRS-2-associated protein in camp-treated FRTL-5 cells. Supplementary Fig. 1 Supplementary Fig. 1 Identification of Nedd4 as an IRS-2-associated protein in camp-treated FRTL-5 cells. (a) FRTL-5 cells were treated with 1 mm dibutyryl camp for 24 h, and the lysates

More information

EpiQuik Methyl-CpG Binding Domain Protein 2 ChIP Kit

EpiQuik Methyl-CpG Binding Domain Protein 2 ChIP Kit EpiQuik Methyl-CpG Binding Domain Protein 2 ChIP Kit Base Catalog # PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik Methyl-CpG Binding Domain Protein 2 ChIP Kit is suitable for combining the

More information

TECHNICAL BULLETIN. EZview Red ANTI-FLAG M2 Affinity Gel. Catalog Number F2426 Storage Temperature 20 C

TECHNICAL BULLETIN. EZview Red ANTI-FLAG M2 Affinity Gel. Catalog Number F2426 Storage Temperature 20 C EZview Red ANTI-FLAG M2 Affinity Gel Catalog Number F2426 Storage Temperature 20 C TECHNICAL BULLETIN Product Description EZview Red ANTI-FLAG M2 Affinity Gel is a highly visible, red colored ANTI-FLAG

More information

ENCODE DCC Antibody Validation Document

ENCODE DCC Antibody Validation Document ENCODE DCC Antibody Validation Document Date of Submission 06/15/2012 Name: Trupti Kawli Email: trupti@stanford.edu Lab Snyder Antibody Name: CDP (sc6327) Target: CDP Company/ Source: Santa Cruz Catalog

More information

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table.

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION The Supplementary Information (SI) Methods Cell culture and transfections H1299, U2OS, 293, HeLa cells were maintained in DMEM medium supplemented with 10% fetal bovine serum. H1299 and 293 cells were

More information

Western Blot One Stop Solution. brand new experience

Western Blot One Stop Solution. brand new experience Western Blot One Stop Solution brand new experience 5 One day of WB Step 1 Step 2 Sample prep min fast electrophoresis Step 3 eblot fast wet tranfer completed Steps easily complete experiment begin a New

More information

WESTERN BLOT. BCH462- Practical

WESTERN BLOT. BCH462- Practical WESTERN BLOT BCH462- Practical What is Antigen [Ag]? What is Antibody [Ab]? Immunoassay: is a test that uses the highly specific and selective antigen-antibody reactions forming antibody and antigen complexes

More information

Purification of alpha-1 antitrypsin using an antibody based affinity chromatography medium

Purification of alpha-1 antitrypsin using an antibody based affinity chromatography medium Purification of alpha-1 antitrypsin using an antibody based affinity chromatography medium Ulrika Meyer a, Hanna Wlad a, Sven Blokland b, Frank J.M. Detmers b and Henrik Ihre a a GE Healthcare Bio-Sciences

More information

Nature Structural & Molecular Biology: doi: /nsmb.1583

Nature Structural & Molecular Biology: doi: /nsmb.1583 Acetylation by GCN5 regulates CDC6 phosphorylation in the S-phase of the cell cycle Roberta Paolinelli 1,2, Ramiro Mendoza-Maldonado 2, Anna Cereseto 1 and Mauro Giacca 2 1 Molecular Biology Laboratory,

More information

Tools and reagents for recombinant protein purification

Tools and reagents for recombinant protein purification Tools and reagents for recombinant protein purification Introduction The development of recombinant DNA technology enabled the production of proteins that were originally extracted from tissues and secretions

More information

Fab Streptamer Microbeads Manual, human

Fab Streptamer Microbeads Manual, human Fab Streptamer Microbeads Manual, human Isolation of functional target cells with reversible Fab-Streps and Strep-Tactin Magnetic Microbeads Last date of revision August 2016 Version PR32-0018 www.streptamer.com

More information

Product Data Sheet - ANTIBODY

Product Data Sheet - ANTIBODY 888.267.4436 techsupport@origene.com www.origene.com Name:Mouse Monoclonal MBP Antibody (2H9) Product Data Sheet - ANTIBODY Catalog: TA336919 Components: Mouse Monoclonal MBP Antibody (2H9) (TA336919)

More information

(Refer Slide Time: 00:16)

(Refer Slide Time: 00:16) (Refer Slide Time: 00:16) Proteins and Gel-Based Proteomics Professor Sanjeeva Srivastava Department of Biosciences and Bioengineering Indian Institute of Technology, Bombay Mod 02 Lecture Number 5 Welcome

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb3209 Supplementary Figure 1 IR induces the association of FH with chromatin. a, U2OS cells synchronized by thymidine double block (2 mm) underwent no release (G1 phase) or release for 2

More information

Supplementary Information. A novel human endogenous retroviral protein inhibits cell-cell fusion. Supplementary Figures:

Supplementary Information. A novel human endogenous retroviral protein inhibits cell-cell fusion. Supplementary Figures: Supplementary Information A novel human endogenous retroviral protein inhibits cell-cell fusion Jun Sugimoto, Makiko Sugimoto, Helene Bernstein, Yoshihiro Jinno and Danny J. Schust Supplementary Figures:

More information

T H E J O U R N A L O F C E L L B I O L O G Y

T H E J O U R N A L O F C E L L B I O L O G Y T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Rainero et al., http://www.jcb.org/cgi/content/full/jcb.201109112/dc1 Figure S1. The expression of DGK- is reduced upon transfection

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb3363 Supplementary Figure 1 Several WNTs bind to the extracellular domains of PKD1. (a) HEK293T cells were co-transfected with indicated plasmids. Flag-tagged proteins were immunoprecipiated

More information

Enhancers mutations that make the original mutant phenotype more extreme. Suppressors mutations that make the original mutant phenotype less extreme

Enhancers mutations that make the original mutant phenotype more extreme. Suppressors mutations that make the original mutant phenotype less extreme Interactomics and Proteomics 1. Interactomics The field of interactomics is concerned with interactions between genes or proteins. They can be genetic interactions, in which two genes are involved in the

More information

Immunoprecipitation (IP)

Immunoprecipitation (IP) BlueGene Biotech Co.,Ltd. Tel: 0086-21-61471242 Fax: 0086-21-61471242 ext 806 E-mail: sales@bluegene.cc tech@bluegene.cc www.elisakit.cc www.bluegene.cc Immunoprecipitation (IP) Immunoprecipitation is

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION Supplementary Figure 1 Effect of ROCK inhibition on lumen abnormality in MDCK cysts. (A) MDCK cells as indicated cultured in Matrigel were treated with and without Y27632 (10

More information

Kinetics Review. Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets)

Kinetics Review. Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets) Quiz 1 Kinetics Review Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets) I will post the problems with solutions on Toolkit for those that can t make

More information

Supporting Information

Supporting Information Supporting Information DNA Crystals as Vehicles for Biocatalysis. Chun Geng and Paul J. Paukstelis* *Email: paukstel@umd.edu Recombinant MBP-tagged RNase inhibitor expression and purification. The porcine

More information

Supplementary Figure 1. GST pull-down analysis of the interaction of GST-cIAP1 (A, B), GSTcIAP1

Supplementary Figure 1. GST pull-down analysis of the interaction of GST-cIAP1 (A, B), GSTcIAP1 Legends Supplementary Figure 1. GST pull-down analysis of the interaction of GST- (A, B), GST mutants (B) or GST- (C) with indicated proteins. A, B, Cell lysate from untransfected HeLa cells were loaded

More information

NPTEL VIDEO COURSE PROTEOMICS PROF. SANJEEVA SRIVASTAVA

NPTEL VIDEO COURSE PROTEOMICS PROF. SANJEEVA SRIVASTAVA LECTURE-06 PROTEIN PURIFICATION AND PEPTIDE ISOLATION USING CHROMATOGRAPHY TRANSCRIPT Welcome to the proteomics course. Today, we will talk about protein purification and peptide isolation using chromatography

More information

Input. Pulldown GST. GST-Ahi1

Input. Pulldown GST. GST-Ahi1 A kd 250 150 100 75 50 37 25 -GST-Ahi1 +GST-Ahi1 kd 148 98 64 50 37 22 GST GST-Ahi1 C kd 250 148 98 64 50 Control Input Hap1A Hap1 Pulldown GST GST-Ahi1 Hap1A Hap1 Hap1A Hap1 Figure S1. (A) Ahi1 western

More information

EpiQuik Tissue Methyl-CpG Binding Domain Protein 2 ChIP Kit

EpiQuik Tissue Methyl-CpG Binding Domain Protein 2 ChIP Kit EpiQuik Tissue Methyl-CpG Binding Domain Protein 2 ChIP Kit Base Catalog # PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik Tissue Methyl-CpG Binding Domain Protein 2 ChIP Kit is suitable for

More information

Protein A Agarose Immunoprecipitation Kit

Protein A Agarose Immunoprecipitation Kit Protein A Agarose Immunoprecipitation Kit Catalog Number KA0568 20 Reactions Version: 01 Intended for research use only www.abnova.com Table of Contents Introduction... 3 Background... 3 General Information...

More information

ab Immunoprecipitation kit

ab Immunoprecipitation kit ab206996 Immunoprecipitation kit Instructions for use: For efficient immunoprecipitation (IP) and coimmunoprecipitation (Co-IP). This product is for research use only and is not intended for diagnostic

More information

T H E J O U R N A L O F C E L L B I O L O G Y

T H E J O U R N A L O F C E L L B I O L O G Y T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Craft et al., http://www.jcb.org/cgi/content/full/jcb.201409036/dc1 Figure S1. GFP -tubulin interacts with endogenous -tubulin. Ciliary

More information

ONE-HOUR Western TM. ONE-HOUR Western TM Kits. 2G ONE-HOUR Western TM Kits Upgraded technology to cut your costs. GenScript USA Inc.

ONE-HOUR Western TM. ONE-HOUR Western TM Kits. 2G ONE-HOUR Western TM Kits Upgraded technology to cut your costs. GenScript USA Inc. ONE-HOUR Western TM 1 2 3 ONE-HOUR Western TM Kits 2G 2 nd Generation 2G Kits Upgraded technology to cut your costs GenScript USA Inc. All Correspondence GenScript USA Inc. 120 Centennial Ave. Piscataway,

More information

Develop Better Assays for Every Human Protein

Develop Better Assays for Every Human Protein Develop Better Assays for Every Human Protein OriGene overview Application of transfected over-expression lysates Application of purified recombinant human proteins About OriGene Started in1996 with the

More information