Nature Structural & Molecular Biology: doi: /nsmb.1583
|
|
- Leslie Cunningham
- 5 years ago
- Views:
Transcription
1 Acetylation by GCN5 regulates CDC6 phosphorylation in the S-phase of the cell cycle Roberta Paolinelli 1,2, Ramiro Mendoza-Maldonado 2, Anna Cereseto 1 and Mauro Giacca 2 1 Molecular Biology Laboratory, Scuola Normale Superiore, AREA della Ricerca del CNR, Via Moruzzi 1, Pisa, Italy and 2 Molecular Medicine Laboratory, International Centre for Genetic Engineering and Biotechnology (ICGEB), Padriciano 99, Trieste, Italy
2 Supplementary Figure 1. CDC6 is acetylated by and binds GCN5 both in vitro and in vivo Mapping of the interacting regions. (a) Flag-tagged CDC6 is acetylated in transfected 293T cells treated with TSA. Upper blot: immunoprecipitation with anti-flag antibody and detection with anti-ac-lys antibody. Lower blot: detection with anti-flag antibody. (b) GST-CDC6 is acetylated by GCN5 acetyltransferase in vitro. HAT assay was performed incubating recombinant GCN5 and GST-CDC6 or GST proteins, as indicated. In addition to CDC6, GCN5 and its major degradation product were also positive for acetylation, due to the autocatalytic activity of the enzyme. (c) Schematic representation of the GST-CDC6 fragments used for the pull down assay shown in (d). (d) GCN5 binds the N-terminal domain of CDC6 in vitro. GST-CDC6 fragments or GST alone as a control were incubated with [ 35 S]-GCN5, extensively washed and then resolved by SDS-PAGE. The panel shows the gel exposed to a phosphoimager. The graphs show the amounts of bound proteins expressed as percentages of radiolabelled input. (e) Schematic representation of the [ 35 S]-CDC6 deletion mutants used for the pull down assay shown in (f).
3 (f) CDC6 binds the C-terminus of GCN5. GST-GCN5 fragments or GST were incubated with [ 35 S]- CDC6, extensively washed and then analyzed by SDS-PAGE. The panel shows the gel exposed to a phosphoimager. The graphs show the amounts of bound proteins as percentages of radiolabelled input. (g) CDC6 binds GCN5 in vivo. Whole cell lysate (WCL) was subjected to immunoprecipitation with an anti-gcn5 antibody and then analyzed by western blotting using a specific anti-cdc6 antibody. CDC6 was detected together with GCN5 in the bound fraction. (h) Endogenous CDC6 binds overexpressed HA-GCN5 in vivo. Extracts prepared from cells cotransfected with wt HA-GCN5 or HA-GCN5mut were immunoprecipitated with anti-cdc6 or anti-ha antibodies and immunoblotted with anti-ha or anti-cdc6 antibodies, respectively. CDC6 binds both wt GCN5 and its catalytically inactive mutant GCN5mut, which bears two amino acid substitutions (Y260A and F261A) at critical residues within the enzyme's catalytic site, further supporting the notion that the interaction between the two proteins does not involve the HAT domain of GCN5.
4 Supplementary Figure 2. Quantification of the levels of endogenous acetylated CDC6. To determine what is the fraction of acetylated CDC6 inside the cells, we first determined the sensitivity of the anti-lysine antibody used in this study relative to an antibody detecting both acetylated and nonacetylated (i.e. total) CDC6. Two peptides were synthesized, corresponding to the CDC6 acetylated region, one carrying unmodified lysines and the other acetylated lysines; the former peptide was used to raise a polyclonal antiserum recognizing the corresponding region of CDC6. The two peptides were diluted serially and tested in parallel with the newly developed antibody recognizing total CDC6 or the commercial antibodies against anti-acetylated lysines, by exposing the blots for exactly the same time. The intensity of each dot (measured by a densitometer) was plotted against the amount of input peptide and the statistical correlation between the two value sets was determined (correlation coefficients R 2 : and for the anti-total CDC6 and anti-acetylated lysine antibody, respectively). On the basis of the mathematical equations fitting the experimental points, it was concluded that the anti-acetylated lysine antibody was 1.43 times more efficient than the anti-total CDC6 antibody at detecting the peptide. Of note, the anti-acetylated lysine antibody did not react at all with the non-acetylated peptide. (Next, a whole cell lysate (WCE) of T98G cells was obtained, CDC6 was immunoprecipitated with an anti-total CDC6 antibody, and the immunoprecipitate was divided into two equal fractions, which were then used for western blotting experiments using the anti-total CDC6 antibody or the anti-acetylated lysine antibody. The ratio between the intensity of the two bands, determined densitometrically, after correction for the relative sensitivity of the antibodies, provides a quantitative estimate of the amount of acetylated CDC6 inside the cells (160.5/42.4*1.43=5.43). Thus, it can be concluded that ~18% of CDC6 is found acetylated in the cells. In evaluating this result, one should however take into account that the actual levels of acetylated CDC6 are expected to be strictly correlated with the phase of the cell cycle. (a) Peptides corresponding to the CDC6 acetylated region. ac: acetylated residues in peptide Ac-Pep. (b) Dot immunoblot on serially diluted Pep and ac-pep peptides using a polyclonal antiserum raised against peptide Pep (upper part) or an anti-acetylated lysine (Ac-Lys) antibody. (c) Quantification of the dot immunoblot experiment shown in (b). The equation of the lines fitting the experimental points are shown, along with the correlation coefficients. (d) Western blot experiment on whole cell lysates (WCE) of T98G cells after immunoprecipitation (IP) with the anti-cdc6 antibody and immunodetection with the same antibody (gel on the left side) or with the anti-ac-lys antibody (gel on the right side). IgH: immunoglobulin heavy chain; Ac-BSA: acetylated bovine serum albumin, used as control acetylated protein. Below the anti-cdc6 lanes, the quantification of the CDC6 band is reported (a.u.: arbitrary units).
5 (e) Expression of wt GCN5, but not of its catalytically inactive point mutant, promotes acetylation of endogenous CDC6. Immunoblots in the upper panel show the acetylation of endogenous CDC6 after immunoprecipitation of lysates from TSA-treated or GCN5/GCN5mut-transfected HeLa cells with an anti-cdc6 antibody and subsequent detection with anti-ac-lys or anti-cdc6 antibodies. Immunoblots in the lower panel show both HA-tagged GCN5 and α Tubulin levels in cell lysates (WCL).
6 Supplementary Figure 3. Anti-phospho-S106 antibody recognizes its phosphorylated epitope also in the context of the K3R mutation. Four GST-fusion proteins were obtained (GST alone, GST-CDC6, GST-CDC6(K3R) and GST- CDC6( ), the last carrying a deletion removing the N-terminal region up to aa 111. The four proteins were incubated with the immunoprecipitate obtained by incubating extracts from S-phase T98G cells (synchronization by serum starvation, 20 h after serum addition) with an antibody against Cyclin A. In this way, we wanted to force the in vitro phosphorylation of CDC6 and its mutants by the CDKs associating with Cyclin A. The proteins were then resolved by SDS-PAGE and immunoblotted with antibodies recognizing total CDC6 or specific for CDC6 phospho-s54 or CDC6 phospho-s106, as indicated. The results of this experiment show that both anti-phospho antibodies recognize the wt CDC6 and the K3R mutant, but not the mutant deleted in aa Thus, the anti-phospho-s106 antibody is indeed able to recognize its phosphorylated epitope also in the context of the K3R mutation. The fact that S106 phosphorylation is lower in the K3R mutant compared to the wt protein might are most likely related to the fact that these recombinant proteins are not acetylated: while we force phosphorylation by this in vitro assay, we assume that this modification occurs less efficiently if CDC6 is not acetylated. In contrast, the K3R mutant is phosphorylated equally well on S54 and on the wt protein. In evaluating this experiment, it should be noted that the anti-cdc6 phospho-s106 antibody is less active than the anti-cdc6 phospho-s54 antibody when used in straight immunoblotting experiments.
7 Supplementary Figure 4. Levels of phosphorylation of CDC6 and other Cyclin A-CDK2 substrates upon downregulation of GCN5 or overexpression of Cyclin E or Cyclin A. (a) Western blot analysis of the levels of the indicated proteins in cells treated with anti-gcn5 (si- GCN5) or anti-luciferase (si-luc) sirnas. Down-regulation of GCN5 caused an accumulation of total CDC6 and S54-phophorylated-CDC6 together with a decrease of S106-phoshorylated-CDC6, while it left the levels of Rb phosphorylated on S807 and S811 (which are targets of CDK4/Cyclin D1) and on T821 (target of CDK2/Cyclin A) unaffected. (b) Overexpression of Cyclin A, but not that of Cyclin E, specifically increased phosphorylation of CDC6 on serine 106. The immunoblots show the levels of the indicated proteins in lysates from cells transfected with Cyclin A or Cyclin E.
8 Supplementary Figure 5. Interaction between GCN5 and Cyclin A-CDK2 (a) Cyclin A-CDK2 co-immunoprecipitates with CDC6 and GCN5 in early S phase. Immunoblots for the investigated proteins after immunoprecipitation with the specific anti-cyclin A antibody are shown at the indicated time points after serum addition. M: marker lane (b) Anti-GCN5 antibody immunoprecipitates CDK2 from lysates of T98G cells collected at 20 hours after serum addition.
9 Supplementary Figure 6. Ser106 CDC6 phosphorylation preferentially occurs on acetylated CDC6. (a) Phosphorylation of CDC6 on Ser106 preferentially occurs on acetylated CDC6. The immunoblots on the left side show the levels of endogenous acetylated CDC6 or total endogenous CDC6 after immunoprecipitation with antibodies against either total CDC6, or ps106-cdc6. The graphs on the right side shows the ratio acetylated CDC6/total CDC6 for the two immunoprecipitates. The levels of acetylated CDC6 were remarkably enriched in the phospho-s106 immunoprecipitate (ratio acetylated CDC6:total immunoprecipitated CDC6=0.45 using the anti-cdc6 antibody; =1.90 using the antiphospho-s106 antibody). IP Control: immunoprecipitation with an irrelevant antibody. Ac-BSA: acetylated BSA as a blotting control. (b) Selective enrichment of acetylated CDC6 after immunoprecipitation with anti-ps106-cdc6 antibody. The immunoblots on the left side show the levels of acetylated (upper) and total (lower) CDC6 after immunoprecipitation with phospho-specific antibodies in lysates from cells treated or not treated with TSA. The lower panel shows the total CDC6 protein level detected on the same lysates. Immunoprecipitation with an unrelated antibody was used as a control. The graph on the right side shows the ratio acetylated CDC6/total CDC6 after immunoprecipitation with the two phospho-specific antibodies. The anti-phospho-s106 antibody immunoprecipitated a remarkably higher amount of acetylated CDC6, compared to the anti-phospho-s54 antibody, even though the levels of total CDC6 immunoprecipitated by the anti-phospho-s106antibody were lower. Upon quantification, the ratio between acetylated CDC6 and total immunoprecipitated CDC6 was 2.10 for the anti-phospho-s106 antibody (similar to the experiments shown in panel a) and 0.35 for the anti-phospho-s54 antibody. The only detectable effect of TSA was to slightly increase the levels of total CDC6 in the cells.
10 Supplementary Figure 7. GCN5 overexpression drives cells into the S phase. (a) Overexpression of GCN5 increases the levels of endogenous Cyclin A. Extracts from HeLa cells transfected with HA-GCN5 and Cyclin A, as indicated, were immunoblotted with anti-cyclin A, anti- HA or anti-α-tubulin antibodies. (b) Flow cytometry profiles after transfection. The histogram on the right side shows the distribution of the cells in the different phases of the cell cycle; the increase and in the number of S-phase cells after GCN5 or Cyclin A overexpression is indicated by an arrow.
11 Supplementary Figure 8. Nuclear localization of CDC6(K3R) and CDC6(S106A) mutants is not modified by GCN5 overexpression. The picture shows HeLa cells transfected with HA-GCN5 together with Flag-tagged wt CDC6 or the two CDC6 mutants, followed by staining with anti-flag (green) and anti-ha (red) antibodies. The graphs show the percentage of nuclear (N) and cytoplasmic (C) subcellular distribution of HA-positive cells in wt CDC6, CDC6(K3R) and CDC6(S106A) transfected cells (mean±sem of at least three independent experiments).
12 Supplementary Figure 9. Phospho-Ser106 CDC6 is highly enriched in the cytoplasmic compartment. The picture shows immunoblots of cytoplasmic (Cyt), nucleoplasmic (Sol) and insoluble (Ins) fractions prepared from asynchronous HeLa cells. Endogenous proteins were revealed with specific antibodies, as indicated on the left side.
Figure 1: TDP-43 is subject to lysine acetylation within the RNA-binding domain a) QBI-293 cells were transfected with TDP-43 in the presence or
Figure 1: TDP-43 is subject to lysine acetylation within the RNA-binding domain a) QBI-293 cells were transfected with TDP-43 in the presence or absence of the acetyltransferase CBP and acetylated TDP-43
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Dynamic Phosphorylation of HP1 Regulates Mitotic Progression in Human Cells Supplementary Figures Supplementary Figure 1. NDR1 interacts with HP1. (a) Immunoprecipitation using
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Supplementary figures Supplementary Figure 1: Suv39h1, but not Suv39h2, promotes HP1α sumoylation in vivo. In vivo HP1α sumoylation assay. Top: experimental scheme. Middle: we
More informationSupplementary Figure 1. GST pull-down analysis of the interaction of GST-cIAP1 (A, B), GSTcIAP1
Legends Supplementary Figure 1. GST pull-down analysis of the interaction of GST- (A, B), GST mutants (B) or GST- (C) with indicated proteins. A, B, Cell lysate from untransfected HeLa cells were loaded
More informationT H E J O U R N A L O F C E L L B I O L O G Y
Supplemental material Thompson et al., http://www.jcb.org/cgi/content/full/jcb.200909067/dc1 T H E J O U R N A L O F C E L L B I O L O G Y Figure S1. Modification-specific antibodies do not detect unmodified
More informationColeman et al., Supplementary Figure 1
Coleman et al., Supplementary Figure 1 BrdU Merge G1 Early S Mid S Supplementary Figure 1. Sequential destruction of CRL4 Cdt2 targets during the G1/S transition. HCT116 cells were synchronized by sequential
More informationFigure S1. USP-46 is expressed in several tissues including the nervous system
Supplemental Figure legends Figure S1. USP-46 is expressed in several tissues including the nervous system Transgenic animals expressing a transcriptional reporter (P::GFP) were imaged using epifluorescence
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2271 Supplementary Figure a! WM266.4 mock WM266.4 #7 sirna WM266.4 #10 sirna SKMEL28 mock SKMEL28 #7 sirna SKMEL28 #10 sirna WM1361 mock WM1361 #7 sirna WM1361 #10 sirna 9 WM266. WM136
More informationtranscription and the promoter occupancy of Smad proteins. (A) HepG2 cells were co-transfected with the wwp-luc reporter, and FLAG-tagged FHL1,
Supplementary Data Supplementary Figure Legends Supplementary Figure 1 FHL-mediated TGFβ-responsive reporter transcription and the promoter occupancy of Smad proteins. (A) HepG2 cells were co-transfected
More informationPost-translational modification
Protein expression Western blotting, is a widely used and accepted technique to detect levels of protein expression in a cell or tissue extract. This technique measures protein levels in a biological sample
More informationSupplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53
Supplementary data Supplemental Figure 1 A sienigma #2 sienigma sicontrol a-enigma - + ++ - - - - - - + ++ - - - - - - ++ B sienigma F-Enigma F-EnigmaSM a-flag HLK3 cells - - - + ++ + ++ - + - + + - -
More informationSupplementary Figure 1 Collision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK2, PPK3 and PPK4 respectively.
Supplementary Figure 1 lision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK, PPK3 and PPK respectively. % of nuclei with signal / field a 5 c ppif3:gus pppk1:gus 0 35 30 5 0 15 10
More informationThe microtubule-associated tau protein has intrinsic acetyltransferase activity. Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and
SUPPLEMENTARY INFORMATION: The microtubule-associated tau protein has intrinsic acetyltransferase activity Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and Virginia M.Y. Lee Cohen
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/8/404/ra120/dc1 Supplementary Materials for The subcellular localization and activity of cortactin is regulated by acetylation and interaction with Keap1 Akihiro
More informationSupplementary Fig. 1 Identification of Nedd4 as an IRS-2-associated protein in camp-treated FRTL-5 cells.
Supplementary Fig. 1 Supplementary Fig. 1 Identification of Nedd4 as an IRS-2-associated protein in camp-treated FRTL-5 cells. (a) FRTL-5 cells were treated with 1 mm dibutyryl camp for 24 h, and the lysates
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Nakajima and Tanoue, http://www.jcb.org/cgi/content/full/jcb.201104118/dc1 Figure S1. DLD-1 cells exhibit the characteristic morphology
More informationSupplementary Figure 1. The Hsp70 acetylation level is related to the co-chaperone binding of Hsp70 under various stress conditions.
Supplementary Figure 1. The Hsp70 acetylation level is related to the co-chaperone binding of Hsp70 under various stress conditions. 1 (a) Etoposide treatment gradually changes acetylation level and co-chaperone
More informationThis is the author's accepted version of the manuscript.
This is the author's accepted version of the manuscript. The definitive version is published in Nature Communications Online Edition: 2015/4/16 (Japan time), doi:10.1038/ncomms7780. The final version published
More informationsupplementary information
DOI: 10.1038/ncb2116 Figure S1 CDK phosphorylation of EZH2 in cells. (a) Comparison of candidate CDK phosphorylation sites on EZH2 with known CDK substrates by multiple sequence alignments. (b) CDK1 and
More informationFig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.
Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.SCUBE2, E-cadherin.Myc, or HA.p120-catenin was transfected in a combination
More informationSupplementary Figure 1. Drawing of spinal cord open-book preparations and DiI tracing. Nature Neuroscience: doi: /nn.3893
Supplementary Figure 1 Drawing of spinal cord open-book preparations and DiI tracing. Supplementary Figure 2 In ovo electroporation of dominant-negative PlexinA1 in commissural neurons induces midline
More informationSupplementary Information Supplementary Figure 1
Bararia, Kwok et al, Supplementary Page 1 Supplementary Information Supplementary Figure 1 S1 Bararia, Kwok et al, Supplementary Page 2 Supplementary Figure 1 (cont.) S2 Bararia, Kwok et al, Supplementary
More informationHPV E6 oncoprotein targets histone methyltransferases for modulating specific. Chih-Hung Hsu, Kai-Lin Peng, Hua-Ci Jhang, Chia-Hui Lin, Shwu-Yuan Wu,
1 HPV E oncoprotein targets histone methyltransferases for modulating specific gene transcription 3 5 Chih-Hung Hsu, Kai-Lin Peng, Hua-Ci Jhang, Chia-Hui Lin, Shwu-Yuan Wu, Cheng-Ming Chiang, Sheng-Chung
More informationSUPPLEMENTARY INFORMATION
The Supplementary Information (SI) Methods Cell culture and transfections H1299, U2OS, 293, HeLa cells were maintained in DMEM medium supplemented with 10% fetal bovine serum. H1299 and 293 cells were
More informationSupplementary Materials
Supplementary Materials Supplementary Figure 1. PKM2 interacts with MLC2 in cytokinesis. a, U87, U87/EGFRvIII, and HeLa cells in cytokinesis were immunostained with DAPI and an anti-pkm2 antibody. Thirty
More informationJCB. Supplemental material THE JOURNAL OF CELL BIOLOGY. Hong et al.,
Supplemental material JCB Hong et al., http://www.jcb.org/cgi/content/full/jcb.201412127/dc1 THE JOURNAL OF CELL BIOLOGY Figure S1. Analysis of purified proteins by SDS-PAGE and pull-down assays. (A) Coomassie-stained
More informationSupplementary Fig. 1 Kinetics of appearence of the faster migrating form of Bcl-10.
α-cd3 + α-cd28: Time (min): + + + + + + + + + 0 5 15 30 60 120 180 240 300 360 360 n.s. Supplementary Fig. 1 Kinetics of appearence of the faster migrating form of. Immunoblot of lysates from Jurkat cells
More informationSupplementary Figure 1. α-synuclein is truncated in PD and LBD brains. Nature Structural & Molecular Biology: doi: /nsmb.
Supplementary Figure 1 α-synuclein is truncated in PD and LBD brains. (a) Specificity of anti-n103 antibody. Anti-N103 antibody was coated on an ELISA plate and different concentrations of full-length
More informationFigure S1. Sequence alignments of ATRIP and ATR TopBP1 interacting regions.
A H. sapiens 204 TKLQTS--ERANKLAAPSVSH VSPRKNPSVVIKPEACS-PQFGKTSFPTKESFSANMS LP 259 B. taurus 201 TKLQSS--ERANKLAVPTVSH VSPRKSPSVVIKPEACS-PQFGKPSFPTKESFSANKS LP 257 M. musculus 204 TKSQSN--GRTNKPAAPSVSH
More informationSUPPLEMENTARY INFORMATION
(Supplementary Methods and Materials) GST pull-down assay GST-fusion proteins Fe65 365-533, and Fe65 538-700 were expressed in BL21 bacterial cells and purified with glutathione-agarose beads (Sigma).
More informationFlag-Rac Vector V12 V12 N17 C40. Vector C40 pakt (T308) Akt1. Myc-DN-PAK1 (N-SP)
a b FlagRac FlagRac V2 V2 N7 C4 V2 V2 N7 C4 p (T38) p (S99, S24) p Flag (Rac) NIH 3T3 COS c +Serum p (T38) MycDN (NSP) Mycp27 3 6 2 3 6 2 3 6 2 min p Myc ( or p27) Figure S (a) Effects of Rac mutants on
More informationStargazin regulates AMPA receptor trafficking through adaptor protein. complexes during long term depression
Supplementary Information Stargazin regulates AMPA receptor trafficking through adaptor protein complexes during long term depression Shinji Matsuda, Wataru Kakegawa, Timotheus Budisantoso, Toshihiro Nomura,
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Han et al., http://www.jcb.org/cgi/content/full/jcb.201311007/dc1 Figure S1. SIVA1 interacts with PCNA. (A) HEK293T cells were transiently
More informationSupplemental Information. Pacer Mediates the Function of Class III PI3K. and HOPS Complexes in Autophagosome. Maturation by Engaging Stx17
Molecular Cell, Volume 65 Supplemental Information Pacer Mediates the Function of Class III PI3K and HOPS Complexes in Autophagosome Maturation by Engaging Stx17 Xiawei Cheng, Xiuling Ma, Xianming Ding,
More informationA RRM1 H2AX DAPI. RRM1 H2AX DAPI Merge. Cont. sirna RRM1
A H2AX DAPI H2AX DAPI Merge Cont sirna Figure S1: Accumulation of RRM1 at DNA damage sites (A) HeLa cells were subjected to in situ detergent extraction without IR irradiation, and immunostained with the
More informationSUPPLEMENTAL FIGURES AND TABLES
SUPPLEMENTAL FIGURES AND TABLES A B Flag-ALDH1A1 IP: α-ac HEK293T WT 91R 128R 252Q 367R 41/ 419R 435R 495R 412R C Flag-ALDH1A1 NAM IP: HEK293T + + - + D NAM - + + E Relative ALDH1A1 activity 1..8.6.4.2
More informationHossain_Supplemental Figure 1
Hossain_Supplemental Figure 1 GFP-PACT GFP-PACT Motif I GFP-PACT Motif II A. MG132 (1µM) GFP Tubulin GFP-PACT Pericentrin GFP-PACT GFP-PACT Pericentrin Fig. S1. Expression and localization of Orc1 PACT
More informationb alternative classical none
Supplementary Figure. 1: Related to Figure.1 a d e b alternative classical none NIK P-IkBa Total IkBa Tubulin P52 (Lighter) P52 (Darker) RelB (Lighter) RelB (Darker) HDAC1 Control-Sh RelB-Sh NF-kB2-Sh
More informationSupplementary Figure S1. N-terminal fragments of LRRK1 bind to Grb2.
Myc- HA-Grb2 Mr(K) 105 IP HA 75 25 105 1-1163 1-595 - + - + - + 1164-1989 Blot Myc HA total lysate 75 25 Myc HA Supplementary Figure S1. N-terminal fragments of bind to Grb2. COS7 cells were cotransfected
More informationSupplementary Table 1. The Q-PCR primer sequence is summarized in the following table.
Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of
More informationRecruitment of Grb2 to surface IgG and IgE provides antigen receptor-intrinsic costimulation to class-switched B cells
SUPPLEMENTARY FIGURES Recruitment of Grb2 to surface IgG and IgE provides antigen receptor-intrinsic costimulation to class-switched B cells Niklas Engels, Lars Morten König, Christina Heemann, Johannes
More information- NaCr. + NaCr. α H3K4me2 α H3K4me3 α H3K9me3 α H3K27me3 α H3K36me3 H3 H2A-2B H4 H3 H2A-2B H4 H3 H2A-2B H4. α Kcr. (rabbit) α Kac.
+ NaCr NaCr + NaCr NaCr Peptides 10ng 50ng 250ng K α Pan (mouse) Pan (mouse) 10ng 50ng 250ng α Pan (rabbit) C 10ng 50ng 250ng α Pan (mouse) 0 1.25 2.5 5 10 20 40 (mm) NaCr 24h α Pan (rabbit) α K4me2 α
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3209 Supplementary Figure 1 IR induces the association of FH with chromatin. a, U2OS cells synchronized by thymidine double block (2 mm) underwent no release (G1 phase) or release for 2
More informationSarker et al. Supplementary Material. Subcellular Fractionation
Supplementary Material Subcellular Fractionation Transfected 293T cells were harvested with phosphate buffered saline (PBS) and centrifuged at 2000 rpm (500g) for 3 min. The pellet was washed, re-centrifuged
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Detection of MCM-subunit SUMOylation under normal growth conditions. a. Sumoylated forms of MCM subunits show differential shifts when SUMO is attached to differently sized tags.
More informationSupplemental Figure 1 Human REEP family of proteins can be divided into two distinct subfamilies. Residues (single letter amino acid code) identical
Supplemental Figure Human REEP family of proteins can be divided into two distinct subfamilies. Residues (single letter amino acid code) identical in all six REEPs are highlighted in green. Additional
More informationSupplementary Information
Supplementary Information Supplementary Figure 1: Over-expression of CD300f in NIH3T3 cells enhances their capacity to phagocytize AC. (a) NIH3T3 cells were stably transduced by EV, CD300f WT or CD300f
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature09732 Supplementary Figure 1: Depletion of Fbw7 results in elevated Mcl-1 abundance. a, Total thymocytes from 8-wk-old Lck-Cre/Fbw7 +/fl (Control) or Lck-Cre/Fbw7 fl/fl (Fbw7 KO) mice
More informationSupplementary Figure 1. APP cleavage assay. HEK293 cells were transfected with various
Supplementary Figure 1. APP cleavage assay. HEK293 cells were transfected with various GST-tagged N-terminal truncated APP fragments including GST-APP full-length (FL), APP (123-695), APP (189-695), or
More informationSupplementary Figure 1. TSA (10 nmol/l), non-class-selective HDAC inhibitor, potentiates
Supplementary Figure 1. TSA (10 nmol/l), non-class-selective HDAC inhibitor, potentiates vascular calcification (VC). (a) Von Kossa staining shows that TSA potentiated the Pi-induced VC. Scale bar, 100
More informationWestern-GUARANTEED Antibody Service FAQ
Western-GUARANTEED Antibody Service FAQ Content Q 1: When do I need a Western GUARANTEED Peptide Antibody Package?...2 Q 2: Can GenScript provide a Western blot guaranteed antibody?...2 Q 3: Does GenScript
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/6/304/ra104/dc1 Supplementary Materials for Lysine Methylation Promotes VEGFR-2 Activation and Angiogenesis Edward J. Hartsough, Rosana D. Meyer, Vipul Chitalia,
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3240 Supplementary Figure 1 GBM cell lines display similar levels of p100 to p52 processing but respond differentially to TWEAK-induced TERT expression according to TERT promoter mutation
More informationsupplementary information
DOI: 10.1038/ncb2172 Figure S1 p53 regulates cellular NADPH and lipid levels via inhibition of G6PD. (a) U2OS cells stably expressing p53 shrna or a control shrna were transfected with control sirna or
More informationRegulation of autophagic activity by ζ proteins associated with class III. phosphatidylinositol-3 kinase. Mercedes Pozuelo Rubio
ONLINE SUPPORTING INFORMATION Regulation of autophagic activity by 14-3-3ζ proteins associated with class III phosphatidylinositol-3 kinase Mercedes Pozuelo Rubio entro Andaluz de Biología Molecular y
More informationSupplementary Material
Supplementary Material Supplementary Methods Cell synchronization. For synchronized cell growth, thymidine was added to 30% confluent U2OS cells to a final concentration of 2.5mM. Cells were incubated
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11070 Supplementary Figure 1 Purification of FLAG-tagged proteins. a, Purification of FLAG-RNF12 by FLAG-affinity from nuclear extracts of wild-type (WT) and two FLAG- RNF12 transgenic
More informationSUPPLEMENTARY INFORMATION FILE
SUPPLEMENTARY INFORMATION FILE Existence of a microrna pathway in anucleate platelets Patricia Landry, Isabelle Plante, Dominique L. Ouellet, Marjorie P. Perron, Guy Rousseau & Patrick Provost 1. SUPPLEMENTARY
More informationSupplementary Fig. 1. Schematic structure of TRAIP and RAP80. The prey line below TRAIP indicates bait and the two lines above RAP80 highlight the
Supplementary Fig. 1. Schematic structure of TRAIP and RAP80. The prey line below TRAIP indicates bait and the two lines above RAP80 highlight the prey clones identified in the yeast two hybrid screen.
More informationSupplemental Material Igreja and Izaurralde 1. CUP promotes deadenylation and inhibits decapping of mrna targets. Catia Igreja and Elisa Izaurralde
Supplemental Material Igreja and Izaurralde 1 CUP promotes deadenylation and inhibits decapping of mrna targets Catia Igreja and Elisa Izaurralde Supplemental Materials and methods Functional assays and
More informationSUPPLEMENTARY INFORMATION
ARTICLE NUMBER: 0 DOI: 0.0/NMICROBIOL.0. The host protein CLUH participates in the subnuclear transport of influenza virus ribonucleoprotein complexes Tomomi Ando,, Seiya Yamayoshi, Yuriko Tomita,, Shinji
More informationPrimers used for PCR of conductin, SGK1 and GAPDH have been described in (Dehner et al,
Supplementary METHODS Flow Cytometry (FACS) For FACS analysis, trypsinized cells were fixed in ethanol, rehydrated in PBS and treated with 40μg/ml propidium iodide and 10μ/ml RNase for 30 min at room temperature.
More informationSupplemental Figure 1
Supplemental Fig. 1. Kinetics of,,, AKT and ERK activation in BMMCs following SCF stimulation. Starved BMMCs were stimulated with 250ng/mL of SCF for the indicated time. Soluble Cell Lysates (SCLs) were
More informationInteraction of the Retinoblastoma Protein with Orc1 and Its Recruitment to Human Origins of DNA Replication
Interaction of the Retinoblastoma Protein with Orc1 and Its Recruitment to Human Origins of DNA Replication Ramiro Mendoza-Maldonado 1, Roberta Paolinelli 2, Laura Galbiati 1, Sara Giadrossi 1, Mauro Giacca
More informationSupplemental material
Supplemental material THE JOURNAL OF CELL BIOLOGY Gillespie et al., http://www.jcb.org/cgi/content/full/jcb.200907037/dc1 repressor complex induced by p38- Gillespie et al. Figure S1. Reduced fiber size
More informationSupplementary Figure 1. TRIM9 does not affect AP-1, NF-AT or ISRE activity. (a,b) At 24h post-transfection with TRIM9 or vector and indicated
Supplementary Figure 1. TRIM9 does not affect AP-1, NF-AT or ISRE activity. (a,b) At 24h post-transfection with TRIM9 or vector and indicated reporter luciferase constructs, HEK293T cells were stimulated
More information42 fl organelles = 34.5 fl (1) 3.5X X 0.93 = 78,000 (2)
SUPPLEMENTAL DATA Supplementary Experimental Procedures Fluorescence Microscopy - A Zeiss Axiovert 200M microscope equipped with a Zeiss 100x Plan- Apochromat (1.40 NA) DIC objective and Hamamatsu Orca
More informationSupplemental Data. Wu et al. (2). Plant Cell..5/tpc RGLG Hormonal treatment H2O B RGLG µm ABA µm ACC µm GA Time (hours) µm µm MJ µm IA
Supplemental Data. Wu et al. (2). Plant Cell..5/tpc..4. A B Supplemental Figure. Immunoblot analysis verifies the expression of the AD-PP2C and BD-RGLG proteins in the Y2H assay. Total proteins were extracted
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11326 Supplementary Figure 1: Histone exchange increases over the ORF in a set2 mutant. (a) Gene average analysis. Schematic representation of the bin distribution over the coding and
More informationSupplemental Materials and Methods
Supplemental Materials and Methods Co-immunoprecipitation (Co-IP) assay Cells were lysed with NETN buffer (20 mm Tris-HCl, ph 8.0, 0 mm NaCl, 1 mm EDT, 0.5% Nonidet P-40) containing 50 mm β-glycerophosphate,
More informationFig. S1. CrgA intracellular levels in M. tuberculosis. Ten and twenty micrograms of
Supplementary data Fig. S1. CrgA intracellular levels in M. tuberculosis. Ten and twenty micrograms of cell free protein lysates from WT M. tuberculosis (Rv) together with various known concentrations
More informationSupplementary Figure 1. RAD51 and RAD51 paralogs are enriched spontaneously onto
Supplementary Figure legends Supplementary Figure 1. and paralogs are enriched spontaneously onto the S-phase chromatin during DN replication. () Chromatin fractionation was carried out as described in
More information3.1 The Role of the Enzymatic Activity of Sir2 for Efficient. The Sir proteins are recruited to DNA by site-specific DNA-binding proteins and
35 3 RESULTS 3.1 The Role of the Enzymatic Activity of Sir2 for Efficient Association of the SIR Complex with DNA The Sir proteins are recruited to DNA by site-specific DNA-binding proteins and subsequently
More informationVERIFY Tagged Antigen. Validation Data
VERIFY Tagged Antigen Validation Data Antibody Validation Figure 1. Over-expression cell lysate for human STAT3 (NM_139276) was used to test 3 commercial antibodies. Antibody A shows strong antigen binding.
More informationSupplementary Materials for
advances.sciencemag.org/cgi/content/full/4/9/eaat5401/dc1 Supplementary Materials for GLK-IKKβ signaling induces dimerization and translocation of the AhR-RORγt complex in IL-17A induction and autoimmune
More informationSupplementary Fig. 1. (A) Working model. The pluripotency transcription factor OCT4
SUPPLEMENTARY FIGURE LEGENDS Supplementary Fig. 1. (A) Working model. The pluripotency transcription factor OCT4 directly up-regulates the expression of NIPP1 and CCNF that together inhibit protein phosphatase
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12119 SUPPLEMENTARY FIGURES AND LEGENDS pre-let-7a- 1 +14U pre-let-7a- 1 Ddx3x Dhx30 Dis3l2 Elavl1 Ggt5 Hnrnph 2 Osbpl5 Puf60 Rnpc3 Rpl7 Sf3b3 Sf3b4 Tia1 Triobp U2af1 U2af2 1 6 2 4 3
More informationSupplementary Fig. S1. SAMHD1c has a more potent dntpase activity than. SAMHD1c. Purified recombinant SAMHD1c and SAMHD1c proteins (with
Supplementary Fig. S1. SAMHD1c has a more potent dntpase activity than SAMHD1c. Purified recombinant SAMHD1c and SAMHD1c proteins (with concentration of 800nM) were incubated with 1mM dgtp for the indicated
More informationSupplemental Data. Sethi et al. (2014). Plant Cell /tpc
Supplemental Data Supplemental Figure 1. MYC2 Binds to the E-box but not the E1-box of the MPK6 Promoter. (A) E1-box and E-box (wild type) containing MPK6 promoter fragment. The region shown in red denotes
More informationSUPPLEMENTARY INFORMATION. Prolyl isomerase Pin1 and protein kinase HIPK2 cooperate to promote
SUPPLEMENTARY INFORMATION Prolyl isomerase Pin1 and protein kinase HIPK2 cooperate to promote cortical neurogenesis by suppressing Groucho/TLE:Hes1-mediated inhibition of neuronal differentiation Running
More information7.06 Problem Set #3, 2006
7.06 Problem Set #3, 2006 1. You are studying the EGF/Ras/MAPK pathway in cultured cells. When the pathway is activated, cells are signaled to proliferate. You generate various mutants described below.
More informationASPP1 Fw GGTTGGGAATCCACGTGTTG ASPP1 Rv GCCATATCTTGGAGCTCTGAGAG
Supplemental Materials and Methods Plasmids: the following plasmids were used in the supplementary data: pwzl-myc- Lats2 (Aylon et al, 2006), pretrosuper-vector and pretrosuper-shp53 (generous gift of
More informationSUPPLEMENTARY INFORMATION. Small molecule activation of the TRAIL receptor DR5 in human cancer cells
SUPPLEMENTARY INFORMATION Small molecule activation of the TRAIL receptor DR5 in human cancer cells Gelin Wang 1*, Xiaoming Wang 2, Hong Yu 1, Shuguang Wei 1, Noelle Williams 1, Daniel L. Holmes 1, Randal
More informationSupplementary Information
Supplementary Information Sam68 modulates the promoter specificity of NF-κB and mediates expression of CD25 in activated T cells Kai Fu 1, 6, Xin Sun 1, 6, Wenxin Zheng 1, 6, Eric M. Wier 1, Andrea Hodgson
More informationThe Human Protein PRR14 Tethers Heterochromatin to the Nuclear Lamina During Interphase and Mitotic Exit
Cell Reports, Volume 5 Supplemental Information The Human Protein PRR14 Tethers Heterochromatin to the Nuclear Lamina During Interphase and Mitotic Exit Andrey Poleshko, Katelyn M. Mansfield, Caroline
More information14_integrins_EGFR
α1 Integrin α1 -/- fibroblasts from integrin α1 knockout animals Figure S1. Serum-starved fibroblasts from α -/- 1 and +/+ mice were stimulated with 10% FBS for 30 min. (FBS) or plated on collagen I (CI)
More informationSupplementary
Supplementary information Supplementary Material and Methods Plasmid construction The transposable element vectors for inducible expression of RFP-FUS wt and EGFP-FUS R521C and EGFP-FUS P525L were derived
More informationJ. Cell Sci. 128: doi: /jcs : Supplementary Material. Supplemental Figures. Journal of Cell Science Supplementary Material
Supplemental Figures Figure S1. Trio controls endothelial barrier function. (A) TagRFP-shTrio constructs were expressed in ECs. Western blot shows efficient Trio knockdown in TagRFP-expressing ECs. (B)
More informationSupplemental Fig. 1: PEA-15 knockdown efficiency assessed by immunohistochemistry and qpcr
Supplemental figure legends Supplemental Fig. 1: PEA-15 knockdown efficiency assessed by immunohistochemistry and qpcr A, LβT2 cells were transfected with either scrambled or PEA-15 sirna. Cells were then
More informationPhosphorylation of CLIP-170 by Plk1 and CK2 promotes timely formation of kinetochore microtubule attachments
The EMBO Journal (2010) 29, 2953 2965 & 2010 European Molecular Biology Organization All Rights Reserved 0261-4189/10 www.embojournal.org Phosphorylation of CLIP-170 by Plk1 and CK2 promotes timely formation
More informationSupplementary Figure S1 Purification of deubiquitinases HEK293 cells were transfected with the indicated DUB-expressing plasmids.
Supplementary Figure S1 Purification of deubiquitinases HEK293 cells were transfected with the indicated DUB-expressing plasmids. The cells were harvested 72 h after transfection. FLAG-tagged deubiquitinases
More informationDOI: 10.1038/ncb3259 A Ismail et al. Supplementary Figure 1 B 60000 45000 SSC 30000 15000 Live cells 0 0 15000 30000 45000 60000 FSC- PARR 60000 45000 PARR Width 30000 FSC- 15000 Single cells 0 0 15000
More informationENCODE RBP Antibody Characterization Guidelines
ENCODE RBP Antibody Characterization Guidelines Approved on November 18, 2016 Background An integral part of the ENCODE Project is to characterize the antibodies used in the experiments. This document
More informationSupplementary Figure 1. Localization of truncated Borealin co-transfected with Borealin shrna.
Supplementary Figure 1. Localization of truncated Borealin co-transfected with Borealin shrna. HeLa M cells were transfected with empty psuper or a vector producing a shrna targetingg the 3 UTR (missing
More informationIsolation of the recombinant middle and head + middle modules.
Supplementary Figure 1 Isolation of the recombinant middle and head + middle modules. (a) Scheme illustrating the multi-step purification protocol for the reconstituted middle module. Extract from infected
More informationSupplementary methods Shoc2 In Vitro Ubiquitination Assay
Supplementary methods Shoc2 In Vitro Ubiquitination Assay 35 S-labelled Shoc2 was prepared using a TNT quick Coupled transcription/ translation System (Promega) as recommended by manufacturer. For the
More informationEGFR (Phospho-Ser695)
Assay Biotechnology Company www.assaybiotech.com Tel: 1-877-883-7988 Fax: 1-877-610-9758 EGFR (Phospho-Ser695) Colorimetric Cell-Based ELISA Kit Catalog #: OKAG02090 Please read the provided manual entirely
More informationSupplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity.
Supplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity. (A) Amino acid alignment of HDA5, HDA15 and HDA18. The blue line
More informationSupplementary Fig. 1. Multiple five micron sections of liver tissues of rats treated
Supplementary Figure Legends Supplementary Fig. 1. Multiple five micron sections of liver tissues of rats treated with either vehicle (left; n=3) or CCl 4 (right; n=3) were co-immunostained for NRP-1 (green)
More informationPDIP46 (DNA polymerase δ interacting protein 46) is an activating factor for human DNA polymerase δ
PDIP46 (DNA polymerase δ interacting protein 46) is an activating factor for human DNA polymerase δ Supplementary Material Figure S1. PDIP46 is associated with Pol isolated by immunoaffinity chromatography.
More information