Thank you for joining us! Our Webinar will begin shortly.
|
|
- Dennis Hamilton
- 6 years ago
- Views:
Transcription
1 Practical Considerations for LC/MS Bioanalysis of Proteins via the Surrogate Peptide Approach Thank you for joining us! Our Webinar will begin shortly. While you are waiting, please feel free to browse our library of Webinar content: Click below to learn more about our NEW GlycoWorks RapiFluor-MS N-Glycan Analysis Kit and our NEW ACQUITY UPLC Glycoprotein BEH Amide 3Å 1.7 µm Columns Waters Corporation 1
2 Friendly Reminders Please use text chat functionality to submit questions during the Webinar. Upon conclusion, follow up information will be available: Recorded version of today s presentation PDF Copies of today s slides Discount Offers on BioSeparations Products Product specific information Reference materials 215 Waters Corporation 2
3 Today s Presenter Erin E. Chambers, Ph.D. Director, Technology Advancement Pi Principal i lapplications Chemist it Waters Corporation, Milford, MA USA Erin Chambers is the Director of the Technology Advancement group and a Principal Applications Chemist, providing pharmaceutical applications development and support for Waters. Erin s primary scientific roles are to support regulated and discovery Bioanalysis, and develop bioanalytical methods for drug molecules, both large and small. She is responsible for sample preparation, mass spectrometry, t and LC method development, and also provides customer and in-house training on these topics. Her most recent focus has been on peptide and protein bioanalysis. Her primary research interests include diabetes and Alzheimer s disease. 215 Waters Corporation 3
4 Practical Considerations for LC/MS Bioanalysis of Proteins via the Surrogate Peptide Approach Erin E Chambers, PhD 215 Waters Corporation 4
5 Topics Challenges in Workflow Options and Typical Steps Antibodies and Choice of Representative Peptide Effect of Protein and Peptide-level l clean-up Addressing the Challenges with a Flexible Kit-based Approach ADC Quantification What about intact antibody analysis? 215 Waters Corporation 5
6 Challenges for an LC/MS Approach Many possible workflow options How do I choose? What steps should I include/omit for my protein? Method Development Many steps to optimize i Lack of standardization approaches reagent choice/quality different labs, different results Reproducibility Long term lot-to-lot reproducibility/traceability Sensitivity 215 Waters Corporation 6
7 Possible Protein Bioanalysis Workflows for Surrogate Peptide Approach 215 Waters Corporation 7
8 Sample Preparation Method Development Challenges: Digestion Optimization of protein denaturation Optimization of protein reduction/alkylation: time, temp, reagent; omit? Finding the appropriate enzyme, protein : enzyme ratio, temp Digestion time optimization Testing digestion reproducibility 215 Waters Corporation 8
9 Optimization Complexity: Enzyme native peptide 13 C 15 N peptide Digestion Efficiency 1 9 native peptide 13 C 15 N peptide TypeA ($473/mg) Increasing Digestion Time Type B ($9.2/mg) Type C ($.5/mg) 3 2 Type A ($.3/mg) Type B ($82/mg) Increasing ($13/mg) Protein:Trypsin Ratio Type A Protein to trypsin ratio Type C ($.7/mg) Type A ($15/mg) Type B ($.2/mg) Vendor #1 Vendor #2 Vendor #3 Vendor #4 215 Waters Corporation 9
10 Optimization Complexity: Reducing Agent Concentration There is a sweet spot for reducing agent concentration For a representative generic signature peptide (GPSV), area counts reached a peak in the middle of the concentration range For the unique signature peptide of Remicade, area counts increased with decreasing concentrations of reduction reagent Area Decreasing Concentration 215 Waters Corporation 1
11 Optimization Complexity: Reduction Temperature So many literature protocols Different reagents, different optimal temperature Reagent 1 prefers higher temperature Reagent 2 prefers lower temperature Reducing Agent 1 6 C Reducing Agent 2 6 C Area Normalized to 8C Area Normalized to 8C One must carefully choose the specific reducing agent, the concentration of each reagent, and the time and temperature 4 variables to optimize! 215 Waters Corporation 11
12 Optimization Complexity: Reduction/Alkylation Time Peptide area increases with decreased reduction time Peptide area decreases with decreased alkylation time Area Reduction Time Alkylation Time Area Decreasing time Decreasing time (normalized to longest time) (normalized to longest time) 215 Waters Corporation 12
13 Sensitivity and Sample Prep: What is Enough and How do I Get There? Specific: Anti-human in Rat Generic: Protein A in Human None: Direct Human Plasma 1 ng/ml 5 ng/ml 5 ng/ml 1 ng/ml 1 ng/ml 5 ng/ml 5 ng/ml 5 ng/ml Blank Plasma Blank Plasma Blank Plasma 215 Waters Corporation 13
14 Topics Challenges in Workflow Options and Typical Steps Antibodies and Choice of Representative Peptide Unique or generic signature peptide o Impact on 3 vs 5-step protocol Effect of Protein and Peptide-level clean-up Addressing the challenges with a Flexible Kit-based Approach ADC Quantification What about intact antibody analysis? 215 Waters Corporation 14
15 Infliximab (Remicade) Remicade Light chain [2]: DILLTQSPAILSVSPGERVSFSCRASQFVGSSIHWYQQRTNGSPRLLIKYASESMSGIPSRFSGSGSGTDFTLSINTVESEDIADYYCQQS HSWPFTFGSGTNLEVKTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK ADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Remicade Heavy chain [2]: EVKLEESGGGLVQPGGSMKLSCVASGFIFSNHWMNWVRQSPEKGLEWVAEIRSKSINSATHYAESVKGRFTISRDDSKSAVYLQMNSLRTE DTGVYYCSRNYYGSTYDYGQGTTLTVSXASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Conserved region: blue variable regions: red CDR regions: green Unique signature Generic signature Van Dongen et al. 61st ASMS, MP525 Minneapolis Minnesota, USA 9-13 June 213. Formula: C 6428 H 9912 N 1694 O 1987 S 46 Molecular Weight: ~ kd Waters Corporation 15
16 Trastuzumab (Herceptin) Conserved region Surrogate Peptides Anti-HER2 Light chain DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV THQGLSSPVTKSFNRGEC Anti-HER2 Heavy chain EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY Q Q ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Unique Signature Generic Signature Formula: C 647 H 112 N 1726 O 213 S 42 Molecular Weight: ~ kda (claims are 148 package insert) Waters Corporation 16
17 Bevacuzimab (Avastin) Bevacizumab light chain DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPSRFSGSGSGTDFTLTIS SLQPEDFATYYCQQYSTVPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDN ALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Bevacizumab heavy chain EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTYAADFKRRFTFSLDTSK STAYLQMNSLRAEDTAVYYCAKYPHYYGSSHWYFDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTALGCLVK DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKVEPKSCDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK Unique Signature Generic Signature Drug Bank Formula: C 6538 H 134 N 1716 O 233 S 44 Molecular Weight: ~ 149. kd Waters Corporation 17
18 Adalimumab (Humira) Light chain: DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPS RFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK ADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Heavy chain: EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDY ADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVS Q SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC DKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Unique Signature Generic Signature C 6428 H 9912 N 1694 O 1987 S 46 Protein average weight Drug Bank Waters Corporation 18
19 Peptide Choice: Impact on Protocol for Unique Peptides Eliminate reduction/alkylation? 3 step, normalized to 5 step protocol Area For unique signature peptides from 4 monoclonal antibody drugs, 3 step protocol works well 215 Waters Corporation 19
20 Peptide Choice: Impact on Protocol for Generic Peptides Eliminate reduction/alkylation? 3 step, normalized to 5 step protocol Area For generic signature peptides from 4 monoclonal antibody drugs, 5 step protocol is more efficient, more often than not 215 Waters Corporation 2
21 Labeled Antibody Internal Standard: SILu Mab SILuMab Heavy Chain EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKI GTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRW APLGAFDIWGQGTMVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ QPREPQVYTLPPS RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SILuMab Light Chain QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIY DATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGV VFGGGTKLTVL GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ VTHEGSTVEKTVAPTECS Labeled Peptides: DTLMISR Heavy Chain (IgG1, IgG2, IgG3, IgG4) FNWYVDGVEVHNAK Heavy Chain (IgG1) VVSVLTVLHQDWLNGK Heavy Chain (IgG1, IgG3, IgG4) NQVSLTCLVK Heavy Chain (IgG1, IgG2, IgG3, IgG4) GFYPSDIAVEWESNGQPENNYK Heavy Chain (IgG1, IgG4) AGVETTTPSK Light Chain (lambda) YAASSYLSLTPEQWK Light Chain (lambda) 215 Waters Corporation 21
22 Intact Murine mab Mass Check Standard (Waters) Murine mab Light chain: DVLMTQTPLSLPVSLGDQASISCRSSQYIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSG TDFTLKISRVEAEDLGVYYCFQGSHVPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKD INVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC Q Murine mab Heavy chain: QVQLKESGPGLVAPSQSLSITCTVSGFSLLGYGVNWVRQPPGQGLEWLMGIWGDGSTDYNSALKSRISITK DNSKSQVFLKMNSLQTDDTAKYYCTRAPYGKQYFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTDSMVTL GCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP RDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAHTQPREEQFN STFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFF PEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPG Conserved region: blue Variable regions: in red Signature peptides: BOXED Signature Generic 215 Waters Corporation 22
23 Murine Monoclonal Antibody prot A spe blk ISTD murine mab 14Aug215_RemicadeSPE_ProteinA_ MRM of 11 Channels ES > (Murine 4) 4.91e6 Murine mab Internal Standard Murine mab IS Peptides Retention Time (min) 1MNSLQTDDTAK VNSAAFPAPIEK NTQPIMDTDGSYFVYSK SVSELPIMHQDWLNGK prot a spe 5 ug/ml 14Aug215_RemicadeSPE_ProteinA_138 1 Antibody Drug Unique and Generic Signature Peptides Time MRM of 11 Channels ES > ( Remicade DILLTQSPAILSVSPGER) 8.35e6 mab Peptides Retention Time (min) 5 SINSATHYAESVK* DSTYSLSSTLTLSK GPSVFPLAPSSK DILLTQSPAILSVSPGER* VVSVLTVLHQDWLNGK Time Generic Internal Standard Workflow check Standard d 215 Waters Corporation 23
24 Topics Challenges in Workflow Options and Typical Steps Antibodies and Choice of Representative Peptide Effect of Protein and Peptide-level clean-up Precipitation pre-treatment Generic and Specific Affinity Capture of Protein Peptide purification from digest Addressing the challenges with a Flexible Kit-based Approach ADC Quantification What about intact antibody analysis? 215 Waters Corporation 24
25 Albumin Interferences: HSA peptides and Trastuzumab peptide p MEOH 1:1 25Jan215_Herceptin_dilution_MEOH_12 1 Trastuzumab (1ug/mL) 5.18 MRM of 24 Channels ES > 68.3 (Herceptin-FTISADTSK HC) 7.3e Jan215_Herceptin_dilution_ACN_114 1 Albumin Peptides MRM of 24 Channels ES+ TIC 2.22e Jan215_Herceptin_dilution_MEOH_12 A.2 Range: Aqueous Time Waters Corporation 25
26 PPT Pretreatment: Albumin depletion and Herceptin Recovery Normalized to Direct Digestion Incubation (1 ul Plasma) Reduced recovery of trastuzumab (Herceptin) seen with organic solvents with greatest albumin removal Solvent 4 in 1:1 ratio to plasma yields greatest balance of albumin removal and increased area counts for trastuzumab 215 Waters Corporation 26
27 Off-line Sample Preparation Options for Purification at the Protein Level Off line Sample Preparation Technique General Proteins Monoclonal Antibodies Discovery Development/ Clinical Sensitivity None x x x low MW cutoff filters x x x x low Depletion Plates x x x x low Protein A/G x x x medium Kappa (anti human) x x high Specific Capture Reagent x x x high 215 Waters Corporation 27
28 Protein A/G Cross Reactivity Can be used as generic purification in discovery for certain pre-clinical species 215 Waters Corporation 28
29 Removal of Endogenous Background: Effect of Protein-Level Purification Specific: Anti-human in Rat Generic: Protein A in Human None: Direct Human Plasma 215 Waters Corporation 29
30 Effect of Protein-Level Purification : Detection Limit Comparison Specific: Anti-human in Rat Generic: Protein A in Human None: Direct Human Plasma 1 ng/ml 1 ng/ml LLOQ 5 ng/ml LOD ~5 ng/ml 1 ng/ml LOD >1 ng/ml 215 Waters Corporation 3
31 Conclusions: Comparison of Pre-fractionation Techniques Absolute LLOQ/LOD for Kappa anti-human and Protein A similar Kappa S:N much higher and integration much cleaner Protein A LLOQ may be 2-3X higher/worse due to interferences and ease of integration LLOQ/LOD for whole digest 2-1X worse than Kappa or Protein A NSB may occur after very specific clean-up at protein level! Too clean? All techniques yield linear curves Anti-human 3 orders magnitude o Due to capacity When more beads are used, the linear range could be extended o Will NSB impact be even greater using more beads? Protein A 4 orders magnitude Whole plasma digestion 3 4 orders magnitude 215 Waters Corporation 31
32 Matrix Effects at the Signature Peptide Level 1 nm trastuzumab u ab in ~15 area counts Solvent A human serum digest 1 nm trastuzumab in serum digest ~5-7 area counts = 2-3X lower! Addressing the problem with sample prep 215 Waters Corporation 32
33 Peptide Clean-up: Mixed-mode Cation Exchange SPE Oasis MCX Single SPE method recovers unique and generic signature peptides with high efficiency Strong cation exchange mixedmode (Oasis MCX) best overall µelution format eliminates dry down and concentrates up to 15X Oasis WCX 215 Waters Corporation 33
34 Example 1: Incremental Improvement in Signal Combining Clean-up Options 1 1: MRM of 2 Channels ES > (FTISADTSK HC) 6.23e5 Area Direct plasma digestion: no clean-up : MRM of 2 Channels ES > (FTISADTSK HC) 6.23e5 Area Protein A plasma clean-up : MRM of 2 Channels ES > (FTISADTSK HC) e5 Area Protein A plasma clean-up, Oasis MCX digest clean-up Time Waters Corporation 34
35 Example 2: Mixed-mode Cation Exchange Clean-up of Unique Herceptin Peptide Before SPE Before SPE After SPE Summary Strong cation exchange most universal >9 recovery for unique and generic signature peptides tested Eliminates digest reagents Increases sensitivity Eliminates phospholipids Digest concentration without evaporation Increased system robustness 215 Waters Corporation 35
36 Topics Challenges in Workflow Options and Typical Steps Antibodies and Choice of Representative Peptide Effect of Protein and Peptide-level clean-up Addressing the challenges with a Flexible Kit-based Approach Reproducibility and Standardization di ti Broadly applicable protocol Sensitivity ADC Quantification What about intact antibody analysis? 215 Waters Corporation 36
37 Solution to the Complexity: Waters Kits Prototype Kits: A Few Key Attributes Processing time for 3-step: ~2 hours for antibodies in plasma Processing time for 5-step: ~3 hours for antibodies in plasma Standardized protocols Scalable, flexible format Reduced variability High Sensitivity Eliminates Method Development for Discovery Studies No capital investment required 215 Waters Corporation 37
38 Large Molecule Drugs 29 sales ($Billion) Anti-infective Oncology Pegasys PEGIntron Herceptin Remicade Rituxan Avastin Erbitux 5.7 Humira Rheumatology Endocrine CNS Norditropin SimpleXx.8 Avonex Lantus 4.3 Tysabri Levemir NovoMix 1.1 Rebif Humalog Enbrel NovoRapid /NovoLog 6.1 Neulasta Blood NovoSeven Procrit/Eprex Kogenate Monoclonal Ab Other protein Modified slide from McKinsey and Company US Patent Expiration Date Data Source: Evaluate Pharma 215 Waters Corporation 38
39 Reproducibility:Waters Prototype Kits Mean Area CV s Intra-kit Inter-kit 215 Waters Corporation 39
40 Standardized Protocol: Remicade (infliximab) Unique Signature Peptide prot a no spe 35 ug/ml 22Dec214_ProtA_nospe_142a Sm (Mn, 5x5) g/ml MRM of 1 Channels ES > (TNO Remicade signaturedilltqspailsvspger) 1.37e7 Area Dec214_ProtA_nospe_129 Sm (Mn, 5x5) MRM of 1 Channels ES > (TNO Remicade signaturedilltqspailsvspger) 1.58e6 Area 35. g/ml Dec214_ProtA_nospe_121 Sm (Mn, 3x3) MRM of 1 Channels ES > (TNO Remicade signaturedilltqspailsvspger) 2.91e5 Area 3.5 g/ml Dec214_ProtA_nospe_112 Sm (Mn, 3x3) MRM of 1 Channels ES > (TNO Remicade signaturedilltqspailsvspger) 3.7e4 Area.35 g/ml Dec214_ProtA_nospe_15 Sm (Mn, 5x5) MRM of 1 Channels ES > (TNO Remicade signaturedilltqspailsvspger) 1.23e4 Blank plasma Area Time 215 Waters Corporation 4
41 Standardized Protocol: Remicade (infliximab) Generic Signature Peptide prot a no spe 35 ug/ml 22Dec214_ProtA_nospe_142a Sm (Mn, 5x5) g/ml MRM of 1 Channels ES > (TNO Furlong Remicade signaturevvsvltvlhqdwlngk) 1.9e7 Area Dec214_ProtA_nospe_129 Sm (Mn, 3x3) MRM of 1 Channels ES > (TNO Furlong Remicade signaturevvsvltvlhqdwlngk) 2.16e6 Area 35. g/ml Dec214_ProtA_nospe_121 Sm (Mn, 2x3) MRM of 1 Channels ES > (TNO Furlong Remicade signaturevvsvltvlhqdwlngk) 2.52e5 Area 3.5 g/ml Dec214_ProtA_nospe_112 Sm (Mn, 1x1) MRM of 1 Channels ES > (TNO Furlong Remicade signaturevvsvltvlhqdwlngk) 3.78e4 Area.35 g/ml Dec214_ProtA_nospe_15 Sm (Mn, 1x1) MRM of 1 Channels ES > (TNO Furlong Remicade signaturevvsvltvlhqdwlngk) 2.34e3 Blank plasma Area Time 215 Waters Corporation 41
42 Standardized Protocol: Remicade (infliximab) Unique Signature Peptide Peptide DILLTQSPAILSVSPGER DILLTQSPAILSVSPGER* Std. Curve Range Linear fit Mean Accuracy of all (ug/ml) Weighting (r 2 ) points /x /x * Quantified using SILUMAB VVSV (IS) Otherwise quant using DTL Silumab peptide as IS Compound name: Remicade DILLTQSPAILSVSPGER Correlation coefficient: r = , r^2 = Calibration curve: * x Response type: Internal Std ( Ref 2 ), Area * ( IS Conc. / IS Area ) Curve type: Linear, Origin: Exclude, Weighting: 1/x, Axis trans: None 1. Residual. -1. Conc 75. Response Conc Waters Corporation 42
43 Standardized Protocol: Remicade (infliximab) Unique Signature Peptide Mean Cal. Conc QC Conc (ug/ml) (ug/ml) Std. Dev. CV Mean Accuracy DILLTQSPAILSVSPGER* SILUMAB DTL(IS) Mean Cal. Conc QC Conc (ug/ml) (ug/ml) Std. Dev. CV Mean Accuracy DILLTQSPAILSVSPGER* SILUMAB VVSV (IS) * Signature 215 Waters Corporation 43
44 Standardized Protocol: Remicade (infliximab) Generic Signature Peptide Peptide Std. Curve Range (ug/ml) Weighting Linear fit (r 2 ) Mean Accuracy of all points GPSVFPLAPSSK /x STSGGTAALGC[+57]LVK /x DSTYSLSSTLTLSK /x DSTYSLSSTLTLSK* /x VVSVLTVLHQDWLNGK /x VVSVLTVLHQDWLNGK* /x *Quantified using SILUMAB VVSV (IS) Compound name: Furlong Remicade VVSVLTVLHQDWLNGK Correlation coefficient: r = , r^2 = Calibration curve: * x Response type: Internal Std ( Ref 2 ), Area * ( IS Conc. / IS Area ) Curve type: Linear, Origin: Exclude, Weighting: 1/x, Axis trans: None 1. All others are quant using DTL Silumab pepitde as IS Compound name: Merck DSTYSLSSTLTLSK Correlation coefficient: r = , r^2 = Calibration curve: * x Response type: Internal Std ( Ref 2 ), Area * ( IS Conc. / IS Area ) Curve type: Linear, Origin: Exclude, Weighting: 1/x, Axis trans: None Residual. -1. Conc Residual Conc Response Conc ponse Resp Conc Waters Corporation 44
45 Standardized Protocol: Remicade (infliximab)generic Signature Peptide Peptide QC Conc (ug/ml) Mean Cal. Conc (ug/ml) Std. Dev. CV Mean Accuracy GPSVFPLAPSSK SILUMAB DTL(IS) Mean Cal. Conc QC Conc (ug/ml) (ug/ml) Std. Dev. CV Mean Accuracy STSGGTAALGC[+57]LVK SILUMAB DTL(IS) Mean Cal. Conc QC Conc (ug/ml) (ug/ml) Std. Dev. CV Mean Accuracy DSTYSLSSTLTLSK SILUMAB DTL(IS) Mean Cal. Conc QC Conc (ug/ml) (ug/ml) Std. Dev. CV Mean Accuracy DSTYSLSSTLTLSK SILUMAB VVSV (IS) Mean Cal. Conc Peptide QC Conc (ug/ml) (ug/ml) Std. Dev. CV Mean Accuracy VVSVLTVLHQDWLNGK SILUMAB DTL(IS) Mean Cal. Conc QC Conc (ug/ml) (ug/ml) Std. Dev. CV Mean Accuracy VVSVLTVLHQDWLNGK SILUMAB VVSV (IS) Waters Corporation
46 Standardized Protocol: Herceptin (trastuzumab) Unique Signature Peptide Compound name: FT peptide Correlation coefficient: r = , r^2 = Calibration curve: * x Response type: Internal Std ( Ref 2 ), Area * ( IS Conc. / IS Area ) Curve type: Linear, Oi Origin: i Exclude, Weighting: 1/x, Ai Axis trans: None Trastuzumab (Herceptin) Whole Plasma Digest: Linearity 1 ng/ml 5 µg/ml Respons se 2 1 Std. Conc ug/ml Area IS Area Conc. Dev Conc Waters Corporation 46
47 Standardized Protocol: Herceptin (trastuzumab) Unique Signature Peptide Compound name: FT peptide Correlation coefficient: r =.99968, r^2 = Calibration curve: * x Response type: Internal Std ( Ref 2 ), Area * ( IS Conc. / IS Area ) Curve type: Linear, Origin: i Exclude, Weighting: 1/x, Axis trans: None Trastuzumab (Herceptin) Kappa affinity: Linearity 5 ng/ml 5 µg/ml Response Std. Conc Area IS Area Conc. Dev Conc Waters Corporation 47
48 Standardized Protocol: Avastin (bevacizumab), QC Statistics Peptide QC Conc (ug/ml) Mean Cal. Conc (ug/ml) Std. Dev. CV Mean Accuracy GPSVFPLAPSSK SILUMAB DTL(IS) * Mean Cal. Conc QC Conc (ug/ml) (ug/ml) Std. Dev. CV Mean Accuracy STSGGTAALGC[+57]LVK SILUMAB DTL(IS) Mean Cal. Conc QC Conc (ug/ml) (ug/ml) Std. Dev. CV Mean Accuracy DSTYSLSSTLTLSK * * * * SILUMAB DTL(IS) * Outside of curve dynamic range 215 Waters Corporation 48
49 Standardized Protocol: Avastin (bevacizumab) prot a no spe.5 ug/ml 9Jan215_ProtA_nospe_137 Sm (Mn, 2x2) MRM of 1 Channels ES > (Merck DSTYSLSSTLTLSK) 2.13e6 1. g/ml Area Jan215_ProtA_nospe_135 Sm (Mn, 2x2) MRM of 1 Channels ES > (Merck DSTYSLSSTLTLSK) 5. g/ml 1.15e6 Area Jan215_ProtA_nospe_131 Sm (Mn, 2x2) MRM of 1 Channels ES > (Merck DSTYSLSSTLTLSK) 2.5 g/ml 6.4e5 Area Jan215_ProtA_nospe_128 Sm (Mn, 2x2) MRM of 1 Channels ES > (Merck DSTYSLSSTLTLSK) 5.91e g/ml Area Jan215_ProtA_nospe_126 Sm (Mn, 2x2) MRM of 1 Channels ES > (Merck DSTYSLSSTLTLSK).5 g/ml 5.3e Area Jan215_ProtA_nospe_121 Sm (Mn, 2x2) MRM of 1 Channels ES > (Merck DSTYSLSSTLTLSK).25 g/ml 5.46e5 259 Area Jan215_ProtA_nospe_12 Sm (Mn, 2x2) MRM of 1 Channels ES > (Merck DSTYSLSSTLTLSK).1 g/ml 4.71e Area Jan215_ProtA_nospe_16 Sm (Mn, 2x2) MRM of 1 Channels ES > (Merck DSTYSLSSTLTLSK) Blank Plasma 4.4e5 Area 548 Time Waters Corporation 49
50 Standardized Protocol: Humira (adalimumab) Unique Signature Peptide Peptide: APYTFGQGTK 1-5 ug/ml Compound name: Humira Correlation coefficient: r = , r^2 = Calibration curve:.388 * x Response type: Internal Std ( Ref 2 ), Area * ( IS Conc. / IS Area ) Curve type: Linear, Origin: Exclude, Weighting: 1/x, Axis trans: None ug/ml 14Aug215_Dir_5step_SPE_mabs_HumPlsm_25p_41 Sm (Mn, 2x3) ; g/ml MRM of 12 Channels ES > (Humira APYTFGQGTK LC) 4.93e4 Area Residual Aug215_Dir_5step_SPE_mabs_HumPlsm_5p_38 Sm (Mn, 2x3) MRM of 12 Channels ES+ 5.29; > (Humira APYTFGQGTK LC) 1.33e4 5. g/ml Area -2. Conc Response Aug215_Dir_5step_SPE_mabs_HumPlsm_1p_33 Sm (Mn, 2x3) MRM of 12 Channels ES ; > (Humira APYTFGQGTK LC) 1.88e3 Area 1. g/ml Aug215_Dir_5step_SPE_mabs_HumPlsm_5p_3 Sm (Mn, 2x3) MRM of 12 Channels ES ;53 1 Conc > (Humira APYTFGQGTK LC) Area 5. g/ml Aug215_Dir_5step_SPE_mabs_HumPlsm_Blk_2 Sm (Mn, 2x3) MRM of 12 Channels ES > (Humira APYTFGQGTK LC) 1.65e3 Area Time Waters Corporation Blank plasma
51 Standardized Protocol: High Sensitivity Remicade (infliximab) SINSATHYAESVK Unique Signature Peptide QC.35 ug/ml 14Aug215 _ RemicadeSPE_ ProteinA_ 15 1 Blank plasma MRM of 11 Channels ES > 63.8 (Remicade SINSATHYAESVK ) 2.19e4 Area Aug215_RemicadeSPE_ProteinA_11 MRM of 11 Channels ES > 63.8 (Remicade SINSATHYAESVK ) 2.76e4 Area.3535 g/ml 35 ng/ml Aug215_RemicadeSPE_ProteinA_119 MRM of 11 Channels ES > 63.8 (Remicade SINSATHYAESVK ) 2.4e5 Area.35 g/ml Aug215_RemicadeSPE_ProteinA_128 MRM of 11 Channels ES > 63.8 (Remicade SINSATHYAESVK ) 2.28e6 Area 3.5 g/ml Aug215_RemicadeSPE_ProteinA_135 ProteinA 135 MRM of 11 Channels ES > 63.8 (Remicade SINSATHYAESVK ) 2.5e7 Area 35. g/ml Aug215_RemicadeSPE_ProteinA_145 MRM of 11 Channels ES > 63.8 (Remicade SINSATHYAESVK ) 1.32e8 Area 35. g/ml Time 215 Waters Corporation 51
52 Competitor vs. Waters: Digestion, No Reduction/Alkylation Area for Unique Signature Peptides of 4 Monoclonal Antibodies, Normalized to Waters Prototype Kit Commerically Available Competitor Kit Waters Prototype Kit 2 Both protocols were completed in comparable time 215 Waters Corporation 52
53 Competitor vs. Waters Area for Generic Signature Peptides of 4 Monoclonal Antibodies, Normalized to Waters Prototype Kit Commerically Available Competitor Kit Waters Prototype Kit 215 Waters Corporation 53
54 Topics Challenges in Workflow Options and Typical Steps Antibodies and Choice of Representative Peptide Effect of Protein and Peptide-level clean-up Addressing the challenges with a Flexible Kit-based Approach ADC Quantification What about intact antibody analysis? 215 Waters Corporation 54
55 Trastuzumab Emtansine (T-DM1) Trastuzumab based 9 lysines MCC (Linker) Da SMCC linker Two-step conjugation Drug Maytansinoid Hydrophobic DM1 + MCC (Drug + Linker) Da ADCs from 3 sources Data courtesy of Liuxi Chen Bioconjugate Chemistry 214, 25, Waters Corporation 55
56 Why Does Drug Location Matter? The potential effect of drug loading, location and distribution: Efficacy and Toxicity CDR Binding Stability Pharmacokinetics ADC manufacturing process control PK E2 E4 E4 E8 Clin. Cancer Res. 1, Chemistry & Biology 2, , Waters Corporation 56
57 ADC Conjugated Peptide Quantification Strategy Control mab Lys-conjugated ADC Trypsin/Lys C Asp N Identification Quantification Peptide Mapping (MS E & DDA) Identifies conjugated peptides Confirms conjugation sites Generates accurate mass list of identified conjugated peptides Accurate Mass Screening (MS E ) Quantifies conjugated peptides across samples Automatically combines different charge states and adducts ions Automatically combines intensity ty from the same peptide at different RT Data courtesy of Liuxi Chen 215 Waters Corporation 57
58 MultiEnzymes for Lys ADC Quantification Trypsin Asp N Unconjugated peptide K K Conjugated peptide K K miscleavage Quantitation Relative abundance of conjugated peptides Relative site occupancy ratio Data courtesy of Liuxi Chen 215 Waters Corporation 58
59 Control mab vs T-DM1 - LC/MS E Chromatograms T-DM1 Data courtesy of Liuxi Chen Trypsin Tmab T-DM1 Conjugated peptide Elution window Asp N Tmab 215 Waters Corporation 59
60 Control mab vs T-DM1 - LC/MS E Chromatograms T-DM1 Data courtesy of Liuxi Chen 1x Trypsin Tmab T-DM1 1x Asp N Tmab 215 Waters Corporation 6
61 Representative Data: Relative Site Occupancy, AspN Results 3 Light Chain Heavy Chain Fab Heavy Chain Fc ve Site Occu upancy Relati 5 LC42 LC183 HC HC3 HC43 HC65 HC76 HC225 HC251 HC277 HC395 N term Lys Site Number Data courtesy of Liuxi Chen 215 Waters Corporation 61
62 Relative abundance of conjugated peptides from different sources (T-DM1) Relative Int tensity Trypsin results AspN results 12 N term L42 L17 N term H3 H43 H65 H76 H124 H3 H43 H65 H76 1 Relative e Intensity Company A Batch 1 Company A Batch 2 Company B 2 Company C Process 1 2 L126 L145 L149 L169 L183 L188 L19 L27 H136 H216 H217 Company C Process 2 Relat tive Intensity Data courtesy of Liuxi Chen H225 H249 H251 H277 H291 H293 H323 H325 H329 H337 H343 H363 H395 H417 H442 Lys Residue Number 215 Waters Corporation 62
63 Topics Challenges in Workflow Options and Typical Steps Antibodies and Choice of Representative Peptide Effect of Protein and Peptide-level clean-up Addressing the challenges with a Flexible Kit-based Approach ADC Quantification What about intact antibody analysis? 215 Waters Corporation 63
64 Improved Sensitivity Capability of ionkey for Deglycosylated gy y mab Analysis PWHM: 8.5s ng ng ng ng ng ng pg LOD 1 pg LOQ 4.51 Time m/z Waters Corporation 64 1 m/z m/z m/z m/z m/z man f Greg Ro Data courtesy o
65 Improved Sensitivity Capability of ionkey for Glycosylated y mab Analysis.4 ng LOD 1 ng LOQ No Glycoform Carryover f Greg Roman Data courtesy o 215 Waters Corporation 65
66 Generic Affinity Capture of Humira from Rat Plasma Blank Rat Plasma_25pt ugml 151 ( Blank Rat Plasma_25pt ugml 151 (2.947) 1: TOF MS ES e5 1 2.e g/ml m/z m/z Blank Rat Plasma_1pt ugml 15 ( Blank Rat Plasma_1pt ugml 15 (2.93) 1: TOF MS ES e e g/ml m/z m/z Blank Rat Plasma_5pt ugml 15 (2.93) 1: TOF MS ES Blank Rat Plasma_5pt ugml 15 ( e e g/ml Humira Linear Range: 25-5 g/ml Deconvoluted Spectra Humira 1 ugml_4 151 (2.947) 1: TOF MS ES e mass Humira 5 ugml_3 147 (2.879) 1: TOF MS ES e5 m/z Blank Rat Plasma_25pt ugml 151 (2.947) 1: TOF MS ES e g/ml m/z Blank Rat Plasma_25pt ugml 151 ( e m/z m/z mass Waters Corporation Data courtesy of Greg Roman 66
67 Trastuzumab ADC (De-Glycosylated): IonKey/MS Trastuzumab MW: g/mol C4 Herceptin ADC 1X Dilution_2 156 (3.51) Cm (144:169) 1: TOF MS ES e ng Linker and Drug: g/mol 1 Drug + 1 Antibody: g/mol m/z C4 Herceptin ADC 1X Dilution_2 151 (2.947) Cm (143:161) 1: TOF MS ES e4 2.5 ng m/z C4 Herceptin ADC 1X Dilution_2 151 (2.947) Cm (145:165) 165) 1: TOF MS ES e ng m/z C4 Herceptin ADC 1X Dilution_2 15 (2.93) Cm (144:165) 1: TOF MS ES e ng m/z Waters Corporation 67
68 Intact Mass Analysis on T-DM1 +Drug 2 +Drug 3 +Drug 4 +Drug 1 +Drug 5 +Drug +Linker +Linker +Linker +Linker +Linker +Drug 6 +Drug 7 Antibody with -7 drugs observed Linker-only peaks observed 215 Waters Corporation 68
69 Conclusions Protein BA workflows are complex Optimization of multiple aspects of multiple steps is required The number and nature of steps to include depends on many variables Waters prototype kits provide standardized, reproducible, and fully flexible solutions to accommodate multiple workflows with fast, optimized protocols For ADC analysis, conjugated peptides can be identified d and quantified using a 2-stage workflow, HRMS, and specifically designed software Intact analysis is closer than you might think 215 Waters Corporation 69
70 Acknowledgements Mary Lame Hua Yang Liuxi Chen Henry Shion Gregory Roman James Murphy Weibin Chen John Gebler Sherri Naughton Catalin Doneanu 215 Waters Corporation 7
71 Thank You for Attending! Post-Event Home Page: 3 Introductory Offer on Protein, Peptide and Glycan Separation Columns and Kits Full Webinar Recording of Today s Session w/pdf Slide Deck Compilation of TODAY S KEY Literature, Brochures etc For Questions and to Submit your Ideas for our Next Topic Please - mychemrep@waters.com 215 Waters Corporation 71
A Generic Kit-Based Approach for Quantifying Monoclonal Antibody Drugs Through Direct Digestion of Discovery Study Samples
A Generic Kit-Based Approach for Quantifying Monoclonal Antibody Drugs Through Direct Digestion of Discovery Study Samples Mary Lame, Hua Yang, Sherri Naughton, and Erin Chambers Waters Corporation, Milford,
More informationLC/MS Based Quantitation of Intact Proteins for Bioanalytical Applications
LC/MS Based Quantitation of Intact Proteins for Bioanalytical Applications Alex Zhu, Ph.D. Agilent Technologies Wilmington, DE ASMS,2017-06 1 Outline Introduction on intact protein quantitation Agilent
More informationAdvanced Characterization of Antibody Drug Conjugates (ADCs) by Liquid Chromatography and Mass Spectrometry (LC/MS) John Gebler, Ph.D.
Advanced Characterization of Antibody Drug Conjugates (ADCs) by Liquid Chromatography and Mass Spectrometry (LC/MS) John Gebler, Ph.D. Director www.waters.com/adc 2015 Waters Corporation 1 2015 Waters
More informationADVANCING ATTRIBUTE CONTROL OF ANTIBODIES AND ITS DERIVATIVES USING HIGH RESOLUTION ANALYTICS
ADVANCING ATTRIBUTE CONTROL OF ANTIBODIES AND ITS DERIVATIVES USING HIGH RESOLUTION ANALYTICS Henry Shion 1, Jing Fang 1, William Alley 1, Barbara Sullivan 2, Nick Tomczyk 3, Liuxi Chen 1, Ying-Qing Yu
More informationUPLC/MS/MS Method for the Quantification of Trastuzumab in Human Serum at the 5-nM Level Using Xevo TQD MS and ACQUITY UPLC H-Class System
UPLC/MS/MS Method for the Quantification of Trastuzumab in Human Serum at the 5-nM Level Using Xevo TQD MS and ACQUITY UPLC H-Class System Catalin Doneanu and Robert Plumb Waters Corporation, Milford,
More informationBioBA High Capacity Enrichment Sample Preparation Kit:
BioBA High Capacity Enrichment Sample Preparation Kit: Biologics Bioanalysis Made Easy Ian Moore 1, Chang Liu 1, Gary Impey 1, Suma Ramagiri 1 1 Sciex, Concord, Canada Common Immunocapture Sample Extraction
More informationTools and workflows to simplify method development for targeted MRM methods
Tools and workflows to simplify method development for targeted MRM methods Nikunj Tanna Senior Scientist, Scientific Operations Waters Corporation, Milford, MA 2016 Waters Corporation 1 Journey of a large
More informationBioanalytical LC-MS of monoclonal antibody therapeutics
Bioanalytical LC-MS of monoclonal antibody therapeutics William D van Dongen, product manager pharma bioanalysis small molecules immunogenicity 40 years experience in bioanalysis Bioanalytical Expertise
More informationRapidly Characterize Antibody- Drug Conjugates and Derive Drug-to-Antibody Ratios Using LC/MS
Rapidly Characterize Antibody- Drug Conjugates and Derive Drug-to-Antibody Ratios Using LC/MS Ning Tang, Ph.D. Agilent Technologies Santa Clara, California, USA Heterogeneity in ADCs Complexity T-DM1 (Genentech)
More informationJohn Mehl, Bogdan Sleczka, Eugene Ciccimaro, Christian Caporuscio, Ekaterina Deyanova, Richard Huang, Timothy Olah, Celia D Arienzo
Bioanalytical strategies for the quantitation of in-vivo site specific modifications of therapeutic antibodies in early discovery cyno studies using IP-LC-MS John Mehl, Bogdan Sleczka, Eugene Ciccimaro,
More informationUltra-Sensitive Quantification of Trastuzumab Emtansine in Mouse Plasma using Trap-Elute MicroLC MS Method
Ultra-Sensitive Quantification of Trastuzumab Emtansine in Mouse Plasma using Trap-Elute MicroLC MS Method Featuring SCIEX QTRAP 6500+ System with OptiFlow Turbo V source and M5 MicroLC system Lei Xiong,
More informationDried Blood Spot Analysis From The Clinic To The Laboratory
Dried Blood Spot Analysis From The Clinic To The Laboratory Joanne Mather, Pharmaceutical Life Sciences Waters Corporation 211 Waters Corporation 1 From The Clinic To The Lab Blood Spot Sampling First
More informationImproving Sensitivity for an Immunocapture LC-MS Assay of Infliximab in Rat Plasma Using Trap-and-Elute MicroLC-MS
Improving Sensitivity for an Immunocapture LC-MS Assay of in Rat Plasma Using Trap-and-Elute MicroLC-MS Using the SCIEX M3 MicroLC system for Increased Sensitivity in Antibody Quantitation Remco van Soest
More informationThe Overview of LC-MS Quantitative Solutions for Biotherapeutic Analysis
The Overview of LC-MS Quantitative Solutions for Biotherapeutic Analysis Featuring SCIEX Instrumentation and Technologies Lei Xiong, Elliott Jones SCIEX, Redwood City, California, USA Figure 1. Summary
More informationQuantitation of Proteins and Monoclonal Antibodies In Serum by LC-MS/MS Using Full-Length Stable Isotope Labeled Internal Standards
Quantitation of Proteins and Monoclonal Antibodies In Serum by LC-MS/MS Using Full-Length Stable Isotope Labeled Internal Standards Kevin Ray, Ph.D. Senior Manager of Analytical R&D MilliporeSigma Outline
More informationDevelopment of a hybrid assay for the quantification of a mab drug in human serum at the low ng/ml levels
Development of a hybrid assay for the quantification of a mab drug in human serum at the low ng/ml levels EBF Open Symposium 21-23 November 2018 marco.michi@aptuit.com Presentation Topics Current scenario
More informationUniversal Solution for Monoclonal Antibody Quantification in Biological Fluids Using Trap-Elute MicroLC-MS Method
Universal Solution for Monoclonal Antibody Quantification in Biological Fluids Using Trap-Elute MicroLC-MS Method Featuring the SCIEX QTRAP 6500+ LC-MS/MS System with OptiFlow Turbo V source and M5 MicroLC
More informationPharmacokinetic Analysis of the mab Adalimumab by ELISA and Hybrid LBA/LC/MS: A Comparison Study
Pharmacokinetic Analysis of the mab Adalimumab by ELISA and Hybrid LBA/LC/MS: A Comparison Study Featuring the SCIEX BioBA Solution Xi Qu 1, Shuyu Hou 1, Meghan McCann 1, Caroline Becker 1, Xun Wang 1,
More informationThank you for joining us! Our Webinar will begin shortly Principles of SPE: Troubleshooting Techniques
Thank you for joining us! Our Webinar will begin shortly Principles of SPE: Troubleshooting Techniques Using the Power of Chromatography to Solve Sample Preparation Challenges 2013 Waters Corporation 1
More informationAnalysis of Intact Monoclonal Antibodies Using an M3 MicroLC with the TripleTOF 6600
Procedures Analysis of Intact Monoclonal Antibodies Using an M3 MicroLC with the TripleTOF 66 Robust and Sensitive Workflow for Qualitative and Quantitative Analysis of Biotherapeutic IgGs Khatereh Motamedchaboki,
More informationImproving Sensitivity in Bioanalysis using Trap-and-Elute MicroLC-MS
Improving Sensitivity in Bioanalysis using Trap-and-Elute MicroLC-MS Using the SCIEX M3 MicroLC system for Increased Sensitivity in Antibody Quantitation Remco van Soest and Lei Xiong SCIEX, Redwood City,
More informationImproved SPE for UPLC/MS Determination of Diquat and Paraquat in Environmental
Improved SPE for UPLC/MS Determination of Diquat and Paraquat in Environmental Samples Michael S.Young, Jeremy C. Shia, Kim vantran, Kevin M. Jenkins and Masayo Yabo Waters Corporation 34 Maple Street,
More informationIMPROVE SPEED AND ACCURACY OF MONOCLONAL ANTIBODY BIOANALYSIS USING NANOTECHNOLOGY AND LCMS
IMPROVE SPEED AND ACCURACY OF MONOCLONAL ANTIBODY BIOANALYSIS USING NANOTECHNOLOGY AND LCMS As scientists gain an advanced understanding of diseases at the molecular level, the biopharmaceutical industry
More informationQuantification of Host Cell Protein Impurities Using the Agilent 1290 Infinity II LC Coupled with the 6495B Triple Quadrupole LC/MS System
Application Note Biotherapeutics Quantification of Host Cell Protein Impurities Using the Agilent 9 Infinity II LC Coupled with the 6495B Triple Quadrupole LC/MS System Authors Linfeng Wu and Yanan Yang
More informationProteins. Patrick Boyce Biopharmaceutical Marketing Manager Waters Corporation 1
Routine Characterization of mabs and Other Proteins Patrick Boyce Biopharmaceutical Marketing Manager Europe and India 2011 Waters Corporation 1 Agenda Why? What scientific challenges? Technology Example
More informationChip-based LC-MS methods for sensitive determination of mabs in serum
Chip-based LC-MS methods for sensitive determination of mabs in serum William D van Dongen, PhD Product Manager Bioanalysis william.vandongen@tno.triskelion.nl 40 years experience in bioanalysis Bioanaly(cal
More informationBioanalysis of Intact Therapeutic Monoclonal Antibodies from Non-Human Primates Using MSIA D.A.R.T. S Technology
APPLICATION NOTE Bioanalysis of Intact Therapeutic Monoclonal Antibodies from Non-Human Primates Using MSIA D.A.R.T. S Technology An Integral Part of Ligand Binding-Mass Spectrometric Immunoassay Workflow
More informationA Sensitive and Robust Method for the Quantification of Goserelin in Plasma Using Micro-Elution Plates
A Sensitive and Robust Method for the Quantification of Goserelin in Plasma Using Micro-Elution Plates Tirupateswara B. Rao, P. Veeranjaneyulu, Sudarshan Mantha, and Dr. Gopal Vaidyanathan Waters Corporation,
More informationSimplifying ImmunoAffinity Capture Workflow
CAE TUDY MART Digest ImmunoAffinity (IA) Kit implifying ImmunoAffinity Capture Workflow Rapid, ensitive, LC-RM Quantitative Analysis of Proteins in Plasma As pharmaceuticals grow more efficacious, reporting
More informationBIOANALYSIS CONSUMABLE SOLUTIONS. Sample Preparation and Liquid Chromatography Solutions for Quantitative BIOANALYSIS
BIOANALYSIS CONSUMABLE SOLUTIONS Sample Preparation and Liquid Chromatography Solutions for Quantitative BIOANALYSIS At Waters, we understand the unique challenges faced by the bioanalytical community,
More informationMicroflow Liquid Chromatography Mass Spectrometry System. Nexera Mikros C146-E350
Microflow Liquid Chromatography Mass Spectrometry System Nexera Mikros C146-E35 Micro: Above and Beyond Nano The High Sensitivity You Expect from a Low Flow System with the Ruggedness of HPLC Covering
More informationWaters Solutions for DMPK and Biomarker Analysis. Waters User Meeting ASMS 2011 Denver, Colorado. Stephen McDonald
Waters Solutions for DMPK and Biomarker Analysis Waters User Meeting ASMS 2011 Denver, Colorado Stephen McDonald 2011 Waters Corporation 1 Drug Development Process Pre-clinical testing R&D - 18 months
More informationDISCOVERY AND VALIDATION OF TARGETS AND BIOMARKERS BY MASS SPECTROMETRY-BASED PROTEOMICS. September, 2011
DISCOVERY AND VALIDATION OF TARGETS AND BIOMARKERS BY MASS SPECTROMETRY-BASED PROTEOMICS September, 2011 1 CAPRION PROTEOMICS Leading proteomics-based service provider - Biomarker and target discovery
More informationAnalytical Characterization of Biotherapeutics: Looking to the Future with Biosimilars
Analytical Characterization of Biotherapeutics: Looking to the Future with Biosimilars Jared Auclair, Ph.D. Northeastern University Department of Chemistry and Chemical Biology Barnett Institute of Chemical
More informationmabs and ADCs analysis by RP
mabs and ADCs analysis by RP Shanhua Lin, Ph.D. The world leader in serving science Protein and mab Separation by HPLC Size difference? YES Size Exclusion Chromatography (SEC) MAbPac SEC-1 NO NO Charge
More informationCLSI C60: Assay Validation & Post-Validation Monitoring
CLSI C60: Assay Validation & Post-Validation Monitoring Ross J. Molinaro, MT(ASCP), PhD, DABCC, FACB Medical Director Core Laboratory, Emory University Hospital Midtown Emory Clinical Translational Research
More informationApplication Note LCMS-87 Automated Acquisition and Analysis of Data for Monitoring Protein Conjugation by LC-MS Using BioPharma Compass
Application Note LCMS-87 Automated Acquisition and Analysis of Data for Monitoring Protein Conjugation by LC-MS Using BioPharma Compass Abstract Here we describe the development and use of an automated
More informationPut the PRO in Protein Characterization
Put the PRO in Protein Characterization Aaron Boice LC/Q-TOF Product Manager 5-June-2017 Agenda The Right Tools for the Job Tackling Intact Proteins Break it Down Peptides and PTMs Sweet Success Released
More informationEoin F.J. Cosgrave, Matthew A. Lauber, Robert Birdsall, and Sean M. McCarthy Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION
New Capabilities for Monitoring Released N-Glycans through the Combined Use of RapiFluor-MS Labeling, ACQUITY UPLC H-Class Bio System, and Serial Fluorescence/ACQUITY QDa Mass Detection Eoin F.J. Cosgrave,
More informationLigand Binding Mass Spectrometric Immunoassay (LB-MSIA ) Workflow with Deglycosylation for Therapeutic Antibodies
Ligand Binding Mass Spectrometric Immunoassay (LB-MSIA ) Workflow with Deglycosylation for Therapeutic Antibodies Kwasi Antwi, Amanda Ribar, Urban A. Kiernan, and Eric E. Niederkofler, Thermo Fisher Scientific,
More information2012 Waters Corporation 1
UPLC User meeeting April 2012 Principles and Practices for SEC, IEX for Intact Protein Analysis by UPLC anders_feldthus@waters.com 2012 Waters Corporation 1 Agenda Ion-Exchange Chromatography Theory and
More informationAccelerate mab Characterization Using Automated Sample Prep
Accelerate mab Characterization Using Automated Sample Prep David Knorr, Ph.D. Automation Solutions Ning Tang, Ph.D. LC/MS 15 February 2012 Page 1 Protein Sample Processing Workflows Glycan Profiling Biological
More information6 th EBF Open meeting, Barcelona November 21st, 2013
Validation of an immunoassay to selectively quantify the naked antibody of a new Sanofi Antibody Drug Conjugate: an additional tool for improvement of PK interpretation 6 th EBF Open meeting, Barcelona
More informationIncreasing Throughput and Efficiency with Exactive LC/MS and Triple Quadrupole LC/MS/MS
Increasing Throughput and Efficiency with Exactive LC/MS and Triple Quadrupole LC/MS/MS Nicholas Duczak Thermo Scientific Annual Mass Spectrometry Users Meeting Somerset, NJ October 12th, 2011 Lead Finding
More informationTowards an in vivo Stability Assay for ADCs and Their Metabolites in Serum by Affinity Capture LC-MS
Towards an in vivo Stability Assay for ADCs and Their Metabolites in Serum by Affinity Capture LC-MS mz (@Dr_mz13), PhD 11-Feb-2013 One of the challenges of ADCs includes the development of a method to
More informationmab quantification in preclinical tissue supports in vitro potency/in vivo efficacy correlations
mab quantification in preclinical tissue supports in vitro potency/in vivo efficacy correlations John T. Mehl, Ph.D. Bioanalytical Research Princeton, NJ AAPS November 4, 2014 San Diego, CA 1 LC-MS/MS
More informationOnline affinity and digestion: A flexible and robust tool for the characterization and quantification of proteins
PO-CON1486E Online affinity and digestion: A flexible and robust tool for the characterization and quantification of proteins ASMS 2014 WP161 David Colquhoun 1 ; Mohamed Nazim Boutaghou 1 ; Rachel Lieberman
More informationmab and ADC Analysis Shanhua Lin, Ph.D. The world leader in serving science
mab and ADC Analysis Shanhua Lin, Ph.D. The world leader in serving science 2 Structure of IgG and Typical Forms of Heterogeneity Protein and mab Separation by HPLC Size difference? YES Size Exclusion
More informationApplying Affimers. Dr Amanda Nicholl at Avacta Life Sciences. Improving Antibody PK Assay Development
Improving Pharmacokinetic Assays in a Regulatory Bioanalysis Setting Applying Affimers With an increasing number of antibody-based therapeutics entering the clinic, the need for validated anti-idiotypic
More informationChromatographic Workflows for Biopharmaceutical Characterization
Chromatographic Workflows for Biopharmaceutical Characterization Dr. Ken Cook European Bioseparation Sales Support Expert Thermo Fisher Scientific, Hemel Hempstead/Germany The world leader in serving science
More informationDeveloping Quantitative UPLC Assays with UV
Developing Quantitative UPLC Assays with UV Detection for Antibodies & Other Proteins Steve Taylor 2011 Waters Corporation 1 Outline UPLC technology for RP protein separations Method development parameters
More informationmab Glycopeptide Profiling with V-Tag Adding reliable glycoprofiling to your peptide mapping workflow with ease and simplicity
mab Glycopeptide Profiling with V-Tag Adding reliable glycoprofiling to your peptide mapping workflow with ease and simplicity Who is the V-Tag Glycoprofiling Technology for? V = Velocity The Ludger V-Tag
More informationEnsure your Success with Agilent s Biopharma Workflows
Ensure your Success with Agilent s Biopharma Workflows Steve Madden Software Product Manager Agilent Technologies, Inc. June 5, 2018 Agenda Agilent BioPharma Workflow Platform for LC/MS Intact Proteins
More informationBackground. Ferring Pharmaceuticals
Background Ferring Pharmaceuticals Founded in 195 and have since then worked with peptides Today, focus are on peptides as well as proteins Many of our peptides are agonists targeting the oxytocin or vasopressin
More informationAnswers, Simple and Streamlined. Solutions for Biotherapeutic Intact Mass Analysis
Answers, Simple and Streamlined Solutions for Biotherapeutic Intact Mass Analysis Expert Functionality for Mass Spec Non-Experts SCIEX OS on the X500B QTOF system dramatically improves the user experience,
More informationReady, Set, Test! AACC Conference Mass Spectrometry in the Clinical Lab: Best Practice and Current Applications September 17-18, 2013 St.
Ready, Set, Test! Ross Molinaro, PhD, MLS(ASCP) CM, DABCC, FACB Medical Director, Clinical Laboratories Emory University Hospital Midtown Emory Clinical Translational Research Laboratory AACC Conference
More informationWAIT! Ready, Set, Test! Financial Disclosure. Research/Educational grants/consulting/salary support
Ready, Set, Test! Ross Molinaro, PhD, MLS(ASCP) CM, DABCC, FACB Medical Director, Clinical Laboratories Emory University Hospital Midtown Emory Clinical Translational Research Laboratory AACC Conference
More informationPrecise Characterization of Intact Monoclonal Antibodies by the Agilent 6545XT AdvanceBio LC/Q-TOF
Precise Characterization of Intact Monoclonal Antibodies by the Agilent 6545XT AdvanceBio LC/Q-TOF Application Note Author David L. Wong Agilent Technologies, Inc. Santa Clara, CA, USA Introduction Monoclonal
More informationMaximizing Chromatographic Resolution of Peptide Maps using UPLC with Tandem Columns
Maximizing Chromatographic Resolution of Peptide Maps using UPLC with Tandem Columns Hongwei Xie, Martin Gilar, and Jeff Mazzeo Waters Corporation, Milford, MA U.S. APPLICATION BENEFITS The ACQUITY UPLC
More informationProMass HR Applications!
ProMass HR Applications! ProMass HR Features Ø ProMass HR includes features for high resolution data processing. Ø ProMass HR includes the standard ProMass deconvolution algorithm as well as the full Positive
More information[ product solution ] Waters Oasis µ Elution PlateS. Patented Innovation. Elution volume as low as 25 μl. No evaporation and reconstitution
[ product solution ] Waters µ Elution PlateS Elution volume as low as 25 μl No evaporation and reconstitution Ideal for small sample volumes Up to a 15x increase in concentration Patented Innovation Now
More informationquantification of an oligonucleotide
Challenges with a LCMS method for quantification of an oligonucleotide Lieve Dillen Regulated Bioanalysis Pictured above: IV absorption utline Introduction to the compound Anticipated challenges LC-MS/MS
More informationOverview of Waters Solutions for Biopharmaceutical Analysis and Characterization
Overview of Waters Solutions for Biopharmaceutical Analysis and Characterization Denis Calnan Biopharma Business Development Manager (Northern Europe) 2011 Waters Corporation 1 About Waters Facts and Figures
More informationBIOPHARMACEUTICAL. Key Applications PLATFORM SOLUTION
BIOPHARMACEUTICAL Key Applications PLATFORM SOLUTION TABLE OF CONTENTS Biopharmaceutical Platform Solution with UNIFI: Key Applications Intact Protein MS Analysis I Peptide Mapping I Released Glycan Analysis
More informationDevelopment of an Immunoprecipitation and LC-MS/MS based Method for Quantifying the 105 kda Recombinant Protein SXN in Plasma.
Development of an Immunoprecipitation and LC-MS/MS based Method for Quantifying the 105 kda Recombinant Protein SXN101959 in Plasma. Richard Kay Principal Scientist, Bioanalytical Sciences, Quotient Bioresearch
More informationStrategies for Quantitative Proteomics. Atelier "Protéomique Quantitative" La Grande Motte, France - June 26, 2007
Strategies for Quantitative Proteomics Atelier "Protéomique Quantitative", France - June 26, 2007 Bruno Domon, Ph.D. Institut of Molecular Systems Biology ETH Zurich Zürich, Switzerland OUTLINE Introduction
More informationA Unique LC-MS Assay for Host Cell Proteins(HCPs) ) in Biologics
A Unique LC-MS Assay for Host Cell Proteins(HCPs) ) in Biologics Catalin Doneanu,, Ph.D. Biopharmaceutical Sciences, Waters September 16, 2009 Mass Spec 2009 2009 Waters Corporation Host Cell Proteins
More informationHongwei Xie, Martin Gilar, and John C. Gebler Waters Corporation, Milford, MA, U.S.A. INTRODUCTION EXPERIMENTAL
Analysis of Deamidation and Oxidation in MONOCLONAL Antibody Using Peptide Mapping with UPLC/MS E Hongwei Xie, Martin Gilar, and John C. Gebler Waters Corporation, Milford, MA, U.S.A. INTRODUCTION Monoclonal
More informationAntibody-drug Conjugates: Characterization and Control Strategies of Lysine-linked Products
Antibody-drug Conjugates: Characterization and Control Strategies of Lysine-linked Products Fred Jacobson Protein Analytical Chemistry Genentech, Inc. CASSS CMC Strategy Forum Japan 2013 December 9-10,
More informationGary A. Schultz, Advion BioServices, Inc. Ithaca, NY 14850
Validation of an immunoprecipitation, digestion and immunoaffinity LC/LC/nanoLC-MS/MS assay for human b-nerve growth factor (NGF) and implementation in support of clinical trials Gary A. Schultz, schultzg@advion.com
More informationExploring Extra Sensitivity Using ionkey/ms with the Xevo G2-XS Q-Tof HRMS for Small Molecule Pharmaceutical Analysis in Human Plasma
Exploring Extra Sensitivity Using ionkey/ms with the Xevo G2-XS Q-Tof HRMS for Small Molecule Pharmaceutical Analysis in Human Plasma Yun Wang Alelyunas, Mark D. Wrona, Jim Murphy, Angela Doneanu, Gregory
More informationA Rapid and Reproducible Immuno-MS Platform from Sample Collection to Quantitation of IgG
PO-CON1457E A Rapid and Reproducible Immuno-MS Platform from Sample Collection to Quantitation of IgG ASMS 14 ThP766 Rachel Lieberman 1, David Colquhoun 1, Jeremy Post 1, Brian Feild 1, Scott Kuzdzal 1,
More informationApplication Note. Kwasi Antwi, Amanda Ribar, Urban A. Kiernan, and Eric E. Niederkofler Thermo Fisher Scientific, Tempe, Arizona
Analysis of an Antibody Drug Conjugate using MSIA D.A.R.T. S. Technology, an Integral Part of Ligand Binding Mass Spectrometric Immunoassay (LB-MSIA) Workflow Application Note Kwasi Antwi, Amanda Ribar,
More informationHigher Order mab Aggregate Analysis using New Innovative SEC Technology
Higher Order mab Aggregate Analysis using New Innovative SEC Technology Ronald E. Majors, Ph.D. LCGC No. America West Chester, PA USA WCBP 2016 Washington, DC Linda Lloyd, Ph.D. Agilent Technologies Church
More informationQuantitatitive Analysis of Phosphorothioate Oligonucleotide in Human Plasma Using LC-MS/MS with On-Line Extraction
Laixin Wang, Sherry Liu, Qiuying Zhu, Scott Reuschel and Min Meng Tandem Labs Quantitatitive Analysis of Phosphorothioate Oligonucleotide in Human Plasma Using LC-MS/MS with On-Line Extraction Introduction
More informationDRUG DISCOVERY & 2 September 2010
LC-MS/MS QUANTITATION IN DRUG DISCOVERY & DEVELOPMENT Ludmila Alexandrova 2 September 2010 1 For personal use only. Please do not reuse or reproduce without the author s permission. 2 Presentation Outline
More informationab Ipilimumab ELISA Kit (Yervoy )
Version 1 Last updated 23 August 2018 ab237653 Ipilimumab ELISA Kit (Yervoy ) For the measurement of Ipilimumab in human serum and plasma. This product is for research use only and is not intended for
More informationLigand Binding Assays: Summary and Consensus from the Bioanalytical Workshop (CC V)
Ligand Binding Assays: Summary and Consensus from the Bioanalytical Workshop (CC V) Binodh DeSilva Executive Director Immunochemistry and Biomarker Development Bristol-Myers Squibb Contributors Lauren
More informationSimultaneous in vivo Quantification and Metabolite Identification of Plasma Samples Using High Resolution QTof and Routine MS E Data Analysis
Simultaneous in vivo Quantification and Metabolite Identification of Plasma Samples Using High Resolution QTof and Routine MS E Data Analysis Mark Wrona, 1 Paul Rainville, 1 Eric Langlois, 2 Nigel Ewing,
More informationPLRP-S Polymeric Reversed-Phase Column for LC/MS Separation of mabs and ADC
PLRP-S Polymeric Reversed-Phase Column for LC/MS Separation of mabs and ADC Analysis of Intact and Fragmented mabs and ADC Application Note Biotherapeutics and Biologics Author Suresh Babu C.V. Agilent
More informationSubmission preparation what to watch out for
Submission preparation what to watch out for EBF 2017 Boris Gorovits AAPS BIOTEC section Pfizer June 2017 Analytes Commonly Assessed for ADC PK Unconjugated Drug analyte Total Antibody analyte Conjugated
More informationSeparation of Native Monoclonal Antibodies and Identification of Charge Variants:
Separation of Native Monoclonal Antibodies and Identification of Charge Variants: Teamwork of the Agilent 31 OFFGEL Fractionator, Agilent 21 Bioanalyzer and Agilent LC/MS Systems Application Note Biosimilar
More informationQuantitative analysis of Adalimumab using nano-surface and molecular-orientation limited (nsmol) proteolysis and LC/MS/MS
PO-CON1686E Quantitative analysis of Adalimumab using nano-surface and molecular-orientation limited (nsmol) ASMS 2016 WP 634 Deepti Bhandarkar (1), Rashi Kochhar (1), Shailendra Rane (1), Shailesh Damale
More informationGenerating Automated and Efficient LC/MS Peptide Mapping Results with the Biopharmaceutical Platform Solution with UNIFI
with the Biopharmaceutical Platform Solution with UNIFI Vera B. Ivleva, Ying Qing Yu, Scott Berger, and Weibin Chen Waters Corporation, Milford, MA, USA A P P L I C AT ION B E N E F I T S The ability to
More informationProPac Elite WCX, 5 μm Particle, for Fast, High Resolution Protein and mab Analysis. July 2018
ProPac Elite WCX, 5 μm Particle, for Fast, High Resolution Protein and mab Analysis July 218 ProPac Elite WCX Acidic Variants Basic Variants 5µm Weak Cation Exchange Column Chemistry based on Thermo Scientific
More informationDeveloping Robust and Efficient IEX Methods for Charge Variant Analysis of Biotherapeutics Using ACQUITY UPLC H-Class System and Auto Blend Plus
Developing Robust and Efficient IEX Methods for Charge Variant Analysis of Biotherapeutics Using ACQUITY UPLC H-Class System and Auto Blend Plus Robert Birdsall, Thomas Wheat, and Weibin Chen Waters Corporation,
More informationZipChip TM. Microfluidic CE-ESI Biotherapeutics CE-ESI-MS Applications. Please visit us at
ZipChip TM Microfluidic CE-ESI Biotherapeutics CE-ESI-MS Applications Please visit us at http://www.908devices.com/ // Actionable Intelligence HPMS & On-board Analytics / Slide 1 June 2016 // ZipChip CE-ESI
More informationA comprehensive CE/ESI-MS solution for BioPharma applications
A comprehensive CE/ESI-MS solution for BioPharma applications Thermo Scientific Q Exactive hybrid quadrupole-orbitrap mass spectrometers with ZipChip system Fast CE Separation Nanospray Sensitivity HRAM
More informationSimultaneous Quantitation of a Monoclonal Antibody and Two Proteins in Human Plasma by High Resolution and Accurate Mass Measurements
Simultaneous Quantitation of a Monoclonal Antibody and Two Proteins in Human Plasma by High Resolution and Accurate Mass Measurements Paul-Gerhard Lassahn 1, Kai Scheffler 2, Myriam Demant 3, Nathanael
More informationHigh throughput analysis at microscale: performance of ionkey/ms with Xevo G2-XS QTof under rapid gradient conditions
JOURNAL OF APPLIED BIOANALYSIS, October 2015, p. 128-135. http://dx.doi.org/10.17145/jab.15.021 (ISSN 2405-710X) Vol. 1, No. 4 APPLICATION NOTE High throughput analysis at microscale: performance of ionkey/ms
More informationHigh throughput analysis at microscale: performance of ionkey/ms with Xevo G2-XS QTof under rapid gradient conditions
JOURNAL OF APPLIED BIOANALYSIS, October 2015, p. 128-135. http://dx.doi.org/10.17145/jab.15.021 (ISSN 2405-710X) Vol. 1, No. 4 APPLICATION NOTE High throughput analysis at microscale: performance of ionkey/ms
More information[ WHITE PAPER ] High Throughput Microflow LC-MS: Sensitivity Gains on a Practical Timescale ABSTRACT INTRODUCTION
High Throughput Microflow LC-MS: Sensitivity Gains on a Practical Timescale Michael Donegan, James Murphy, and Angela Doneanu Waters Corporation, Milford, MA, USA ABSTRACT The sensitivity gains observed
More informationChallenges in peptide mapping mass spectrometry of biopharmaceuticals
Challenges in peptide mapping mass spectrometry of biopharmaceuticals Will Burkitt, Ben Holmes, Johanna Paris, Nisha Patel, John O Hara 07.MAR.2018 Characterisation within UCB 2 Context to the type of
More informationTrastuzumab Glycan Batch-to-Batch Profiling using a UPLC/FLR/Mass Spectrometry Platform
Trastuzumab Glycan Batch-to-Batch Profiling using a UPLC/FLR/Mass Spectrometry Platform Ying Qing Yu, Joomi Ahn, and Martin Gilar Waters Corporation, Milford, MA, U.S. APPLICATION BENEFITS Used together,
More informationA fast and simple workflow for surrogate peptide bioanalysis: NISTmAb case study
APPLICATION NOTE 21767 A fast and simple workflow for surrogate peptide bioanalysis: NISTmAb case study Authors Jon Bardsley, Thermo Fisher Scientific, Runcorn, UK Keywords Biopharmaceutical, bioanalytical,
More informationMonitoring Charge Heterogeneity of Antibody-Maytansinoid Conjugates (AMC) with icief
Monitoring Charge Heterogeneity of Antibody-Maytansinoid Conjugates (AMC) with icief Joyce Lin, Rajesh Krishnamurthy, Alexandru Lazar ImmunoGen, Inc., Waltham, MA CE Pharm 2008 utline I. Introduction of
More informationBiochromatography Bring more Zen into your life and laboratory
Seminar Biochromatography Bring more Zen into your life and laboratory Method development and maintaining peptide, protein, glycan and anti-body analyses by LC or LC-MS can be very time consuming and might
More informationN-Glycan Profiling Analysis of a Monoclonal Antibody Using UHPLC/FLD/Q-TOF
N-Glycan Profiling Analysis of a Monoclonal Antibody Using UHPLC/FLD/Q-TOF Application Note Authors Xianming Liu, Wei Zhang, Yi Du, Sheng Yin, Hong Que, and Weichang Zhou WuXi AppTec iopharmaceuticals
More informationXpress CF+ : A Cell-Free Platform for the Rapid Screening and Production of Homogeneous ADCs
Xpress CF+ : A Cell-Free Platform for the Rapid Screening and Production of Homogeneous ADCs Alexander R. Steiner, M.S. Director, Protein Biochemistry Tuesday Feb 3 rd, 215 Making novel drugs is Pammolli
More information