PTM Identification and Localization from MS Proteomics Data
|
|
- Felix Garrett
- 6 years ago
- Views:
Transcription
1 PTM Identification and Localization from MS Proteomics Data Marc Vaudel Center for Medical Genetics and Molecular Medicine, Haukeland University Hospital, Bergen, Norway KG Jebsen Center for Diabetes Research, Department of Clinical Science, University of Bergen, Norway
2 Intensity Intensity Proteomics Bioinformatics Proteins Peptides Preparation LC-MS/MS MS1 Spectra + MS2 Spectra Retention Time Proteomics Dataset Precursor m/z 2 Verheggen et al., Mass Spectrom. Rev., 2017
3 Intensity Peptide Identification Targeted (Discovery): Find known mass fingerprints Spectra Library + Precursor m/z 3 Peptide specific intensity
4 Intensity Peptide Identification Untargeted (Discovery): Compare spectra to expected content of samples Spectra Proteins + Precursor m/z 4 Best matching peptide
5 Peptide Identification Database Search Engines Spectrum Sequencing Spectral Libraries
6 There is PTM and PTM One pipeline fits all
7 Database Search Engines Search Parameters Peak Lists Pre-processing Matching Scoring PSMs Database In silico digestion In silico fragmentation >sw Q15149 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 MVAGMLMPRDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASL RARGLVRETFAWCHFYWYLTNEGIAHLRQYLHLPPEIVPASLQRVRRPVAMVMPAR RTPHVQAVQGPLGSPPKRGPLPTEEQRVYRRKELEEVSPETPVVPATTQRTLARP GPEPAPATDERDRVQKKTFTKWVNKHLIKAQRHISDLYEDLRDGHNLISLLEVLSGD SLPREKGRMRFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHF QISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRH KPLLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSS LYDAMPRVPDVQDGVRANELQLRWQEYRELVLLLL Search Engine
8 Number of Yearly Citations Verheggen et al., Mass Spectrom. Rev., 2017 Database Search Engines Other 1000 MyriMatch InsPecT 800 Andromeda 600 OMSSA X! Tandem 400 Paragon 200 SEQUEST Mascot Year
9 Database Search Engines Search Parameters Chimeric Spectra Peak Lists Pre-processing Matching Scoring PSMs Database In silico digestion In silico fragmentation Multiple Pass Search Search Engine
10 See Nesvizhskii, Journal of Proteomics, 2010 Peptide score distribution 100% 80% 60% 40% 20% 0% score
11 The search space problem Verheggen et al., Mass Spectrom. Rev., 2017
12 See Nesvizhskii, Journal of Proteomics, 2010 Peptide score distribution 100% 80% 60% 40% 20% 0% score
13 Chick et al., Nature Biotechnology, 2015 Which PTMs include in the search? Open search: MSFragger, PMID Parameters optimization: Param-Medic, PMID Limit PTMs per peptide
14 The search space problem Verheggen et al., Mass Spectrom. Rev., 2017
15 Site determining ions ADTSQEICSPR ADTSQEICSPR ADTSQEICSPR ADpTSQEICSPR ADTpSQEICSPR ADTSQEICpSPR ,000 1,200 1,400 m/z
16 Tauss et al., JPR, 2011 Scoring PTM isoforms Noise level Isoform score Significance
17 Tauss et al., JPR, 2011 Scoring PTM isoforms Noise level Isoform score Significance
18 Observed Performance Expected Simplistic fragmentation model Challenges in noise estimation
19 Tauss et al., JPR, 2011 Scoring PTM isoforms Noise level Isoform score Significance
20 Fermin et al., MCP, 2013 False Localization Rate Estimation 100% 80% 60% 40% 20% 0% score
21 What about proteins? Nesvizhskii and Aebersold, MCP, 2005
22 PeptideShaker In practice Scoring integrated in most analysis pipelines
23 There is PTM and PTM One pipeline fits all
24 Simplify to standard problem
25 De novo identification MS1 MS2 MS3
26 De novo identification Vegard Tveit
27 De novo identification Vegard Tveit
28 Hybrid approaches Stadlmann, Taubenschmid, et al., Nature, 2017
29 Take home message Vast space of possibilities Importance of experimental workflow and data quality Error rates are difficult to estimate Complex PTMs remain to be explored Talents wanted!
30 Need more help? proteomics-academy.org -> Conferences -> Courses -> Educational Wiki -> Q & A
31 Acknowledgement
32 02/10/17 Thank you for your attention! Questions?
Peptide and protein identification in mass spectrometry based proteomics. Yafeng Zhu, PhD student Karolinska Institutet, Scilifelab
Peptide and protein identification in mass spectrometry based proteomics Yafeng Zhu, PhD student Karolinska Institutet, Scilifelab 2017-10-12 Content How is the peptide sequence identified? What is the
More informationCenter for Mass Spectrometry and Proteomics Phone (612) (612)
Outline Database search types Peptide Mass Fingerprint (PMF) Precursor mass-based Sequence tag Results comparison across programs Manual inspection of results Terminology Mass tolerance MS/MS search FASTA
More informationProtein Grouping, FDR Analysis and Databases.
Protein Grouping, FDR Analysis and Databases. March 15th 2012 Pratik Jagtap The Minnesota http://www.mass.msi.umn.edu/ Protein Grouping, FDR Analysis and Databases Overview. Protein Grouping : Concept
More informationAbout OMICS Group Conferences
About OMICS Group OMICS Group International is an amalgamation of Open Access publications and worldwide international science conferences and events. Established in the year 2007 with the sole aim of
More informationMass Spectrometry Based Proteomics Data Analysis Using GalaxyP
Mass Spectrometry Based Proteomics Data Analysis Using GalaxyP GCC 2015 GalaxyP Workshop July 6th, 2015 Norwich, UK Presenters: Tim Griffin, Pratik Jagtap and James Johnson Documentation: Kevin Murray,
More informationHighly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs
Technical Overview Highly Confident Peptide Mapping of Protein Digests Using Agilent LC/Q TOFs Authors Stephen Madden, Crystal Cody, and Jungkap Park Agilent Technologies, Inc. Santa Clara, California,
More informationCurrent state of proteomics standardization and (C-)HPP data quality guidelines
9/6/2016 3 Department of Pharmacy Analytical Biochemistry Current state of proteomics standardization and (C-)HPP data quality guidelines DTL focus meeting on data integration, standards and fair principles
More information基于质谱的蛋白质药物定性定量分析技术及应用
基于质谱的蛋白质药物定性定量分析技术及应用 蛋白质组学质谱数据分析 单抗全蛋白测序及鉴定 Bioinformatics Solutions Inc. Waterloo, ON, Canada 上海 中国 2017 1 3 PEAKS Studio GUI Introduction Overview of PEAKS Studio GUI Project View Tasks, running info,
More informationLTQ Orbitrap XL Hybrid FT Mass Spectrometer Unrivaled Performance and Flexibility
m a s s s p e c t r o m e t r y LTQ Orbitrap XL Hybrid FT Mass Spectrometer Unrivaled Performance and Flexibility Part of Thermo Fisher Scientific LTQ Orbitrap XL OFFERING OUTSTANDING MASS ACCURACY, RESOLVING
More informationSupplementary Information
Identifying sources of tick blood meals using unidentified tandem mass spectral libraries Özlem Önder 1, Wenguang Shao 2, Brian Kemps 1, Henry Lam 2,3,*, Dustin Brisson 1,* 1 Department of Biology, University
More informationSpectrum Mill MS Proteomics Workbench. Comprehensive tools for MS proteomics
Spectrum Mill MS Proteomics Workbench Comprehensive tools for MS proteomics Meeting the challenge of proteomics data analysis Mass spectrometry is a core technology for proteomics research, but large-scale
More informationApplication Note TOF/MS
Application Note TOF/MS New Level of Confidence for Protein Identification: Results Dependent Analysis and Peptide Mass Fingerprinting Using the 4700 Proteomics Discovery System Purpose The Applied Biosystems
More informationImproving Productivity with Applied Biosystems GPS Explorer
Product Bulletin TOF MS Improving Productivity with Applied Biosystems GPS Explorer Software Purpose GPS Explorer Software is the application layer software for the Applied Biosystems 4700 Proteomics Discovery
More informationProtein Valida-on (Sta-s-cal Inference) and Protein Quan-fica-on. Center for Mass Spectrometry and Proteomics Phone (612) (612)
Protein Valida-on (Sta-s-cal Inference) and Protein Quan-fica-on Terminology Pep-de Spectrum Match Target / Decoy False discovery rate Shared pep-de Parsimony One hit wonders SPECTRUM Rela-ve Abundance
More informationProteinPilot Report for ProteinPilot Software
ProteinPilot Report for ProteinPilot Software Detailed Analysis of Protein Identification / Quantitation Results Automatically Sean L Seymour, Christie Hunter SCIEX, USA Powerful mass spectrometers like
More informationHigh-throughput Proteomic Data Analysis. Suh-Yuen Liang ( 梁素雲 ) NRPGM Core Facilities for Proteomics and Glycomics Academia Sinica Dec.
High-throughput Proteomic Data Analysis Suh-Yuen Liang ( 梁素雲 ) NRPGM Core Facilities for Proteomics and Glycomics Academia Sinica Dec. 9, 2009 High-throughput Proteomic Data Are Information Rich and Dependent
More informationBIOINFORMATICS ORIGINAL PAPER
BIOINFORMATICS ORIGINAL PAPER Vol 25 no 22 29, pages 2969 2974 doi:93/bioinformatics/btp5 Data and text mining Improving peptide identification with single-stage mass spectrum peaks Zengyou He and Weichuan
More informationProteomics software at MSI. Pratik Jagtap Minnesota Supercomputing institute
Proteomics software at MSI. Pratik Jagtap Minnesota Supercomputing institute http://www.mass.msi.umn.edu/ Proteomics software at MSI. proteomics : emerging technology proteomics workflow search algorithms
More informationMass Spectrometry and Proteomics - Lecture 6 - Matthias Trost Newcastle University
Mass Spectrometry and Proteomics - Lecture 6 - Matthias Trost Newcastle University matthias.trost@ncl.ac.uk Previously Quantitation techniques Label-free TMT SILAC Peptide identification and FDR 194 Lecture
More informationProtein Reports CPTAC Common Data Analysis Pipeline (CDAP)
Protein Reports CPTAC Common Data Analysis Pipeline (CDAP) v. 4/13/2015 Summary The purpose of this document is to describe the protein reports generated as part of the CPTAC Common Data Analysis Pipeline
More informationSpectral Counting Approaches and PEAKS
Spectral Counting Approaches and PEAKS INBRE Proteomics Workshop, April 5, 2017 Boris Zybailov Department of Biochemistry and Molecular Biology University of Arkansas for Medical Sciences 1. Introduction
More informationQuantitative mass spec based proteomics
Quantitative mass spec based proteomics Tuula Nyman Institute of Biotechnology tuula.nyman@helsinki.fi THE PROTEOME The complete protein complement expressed by a genome or by a cell or a tissue type (M.
More informationAn Improved Approach for Glycan Structure Identification from HCD MS/MS Spectra
Introduction Method Experiments An Improved Approach for Glycan Structure Identification from HCD MS/MS Spectra Weiping Sun, Yi Liu, Gilles Lajoie, Bin Ma and Kaizhong Zhang Department of Computer Science,
More informationSupporting Information for
Supporting Information for CharmeRT: Boosting peptide identifications by chimeric spectra identification and retention time prediction Viktoria Dorfer*,,a, Sergey Maltsev,b, Stephan Winkler a, Karl Mechtler*,b,c.
More informationProteinPilot Software for Protein Identification and Expression Analysis
ProteinPilot Software for Protein Identification and Expression Analysis Providing expert results for non-experts and experts alike ProteinPilot Software Overview New ProteinPilot Software transforms protein
More informationSupplemental Materials
Supplemental Materials MSGFDB Parameters For all MSGFDB searches, the following parameters were used: 30 ppm precursor mass tolerance, enable target-decoy search, enzyme specific scoring (for Arg-C, Asp-N,
More informationProMass HR Applications!
ProMass HR Applications! ProMass HR Features Ø ProMass HR includes features for high resolution data processing. Ø ProMass HR includes the standard ProMass deconvolution algorithm as well as the full Positive
More informationAgilent Software Tools for Mass Spectrometry Based Multi-omics Studies
Agilent Software Tools for Mass Spectrometry Based Multi-omics Studies Technical Overview Introduction The central dogma for biological information flow is expressed as a series of chemical conversions
More informationProteomics and some of its Mass Spectrometric Applications
Proteomics and some of its Mass Spectrometric Applications What? Large scale screening of proteins, their expression, modifications and interactions by using high-throughput approaches 2 1 Why? The number
More informationAppendix. Table of contents
Appendix Table of contents 1. Appendix figures 2. Legends of Appendix figures 3. References Appendix Figure S1 -Tub STIL (41) DVFFYQADDEHYIPR (55) (64) AVLLDLEPR (72) 1 451aa (1071) YLNENQLSQLSVTR (1084)
More informationKey questions of proteomics. Bioinformatics 2. Proteomics. Foundation of proteomics. What proteins are there? Protein digestion
s s Key questions of proteomics What proteins are there? Bioinformatics 2 Lecture X roteomics How much is there of each of the proteins? - Absolute quantitation - Stoichiometry What (modification/splice)
More informationConfident Protein ID using Spectrum Mill Software
Welcome to our E-Seminar: Confident Protein ID using Spectrum Mill Software Slide 1 Spectrum Mill Informatics Software Start with batches of raw MS data! Sp ec t ru m Mi ll Biologist-friendly answers!
More informationLC/MS/MS Solutions for Biomarker Discovery QSTAR. Elite Hybrid LC/MS/MS System. More performance, more reliability, more answers
LC/MS/MS Solutions for Biomarker Discovery QSTAR Elite Hybrid LC/MS/MS System More performance, more reliability, more answers More is better and the QSTAR Elite LC/MS/MS system has more to offer. More
More informationEnabling Systems Biology Driven Proteome Wide Quantitation of Mycobacterium Tuberculosis
Enabling Systems Biology Driven Proteome Wide Quantitation of Mycobacterium Tuberculosis SWATH Acquisition on the TripleTOF 5600+ System Samuel L. Bader, Robert L. Moritz Institute of Systems Biology,
More informationtimstof Pro powered by PASEF and the Evosep One for high speed and sensitive shotgun proteomics
timstof Pro powered by PASEF and the Evosep One for high speed and sensitive shotgun proteomics The Parallel Accumulation Serial Fragmentation (PASEF) method for trapped ion mobility spectrometry (TIMS)
More informationFilter-based Protein Digestion (FPD): A Detergent-free and Scaffold-based Strategy for TMT workflows
Supporting Information Filter-based Protein Digestion (FPD): A Detergent-free and Scaffold-based Strategy for TMT workflows Ekaterina Stepanova 1, Steven P. Gygi 1, *, Joao A. Paulo 1, * 1 Department of
More informationSCIENCE OF DECISION MAKING: A DATA-MODELING APPROACH
ECBC-TR-1125 SCIENCE OF DECISION MAKING: A DATA-MODELING APPROACH Samir V. Deshpande SCIENCE AND TECHNOLOGY CORPORATION Edgewood, MD 21040-2734 Rabih E. Jabbour RESEARCH AND TECHNOLOGY DIRECTORATE October
More informationRockerBox. Filtering massive Mascot search results at the.dat level
RockerBox Filtering massive Mascot search results at the.dat level Challenges Big experiments High amount of data Large raw and.dat files (> 2GB) How to handle our results?? The 2.2 peptide summary could
More informationIntroduction. Benefits of the SWATH Acquisition Workflow for Metabolomics Applications
SWATH Acquisition Improves Metabolite Coverage over Traditional Data Dependent Techniques for Untargeted Metabolomics A Data Independent Acquisition Technique Employed on the TripleTOF 6600 System Zuzana
More informationInnovations for Protein Research. Protein Research. Powerful workflows built on solid science
Innovations for Protein Research Protein Research Powerful workflows built on solid science Your partner in discovering innovative solutions for quantitative protein and biomarker research Applied Biosystems/MDS
More informationInformatics on MS-Based Proteomics
Informatics on MS-Based Proteomics Yet-Ran Chen 陳逸然 Associate Research Fellow / Associate Professor Agricultural Biotech. Research Center / Institute of Biotechnology & Genomics and Systems Biology Academia
More informationPractical And Efficient Searching In Proteomics: A Cross Engine Comparison
Article ID: WMCPLS0052 ISSN 2051-0799 Practical And Efficient Searching In Proteomics: A Cross Engine Comparison Corresponding Author: Dr. Joao A Paulo, Instructor, Harvard Medical School, 320 Longwood
More informationPeptideShaker enables reanalysis of mass spectrometryderived. proteomics datasets
PeptideShaker enables reanalysis of mass spectrometryderived proteomics datasets Marc Vaudel 1,2, Julia M. Burkhart 1, René P. Zahedi 1, Eystein Oveland 2,3,4, Frode S. Berven 2,4,5, Albert Sickmann 1,
More informationHow to view Results with Scaffold. Proteomics Shared Resource
How to view Results with Scaffold Proteomics Shared Resource Starting out Download Scaffold from http://www.proteomes oftware.com/proteom e_software_prod_sca ffold_download.html Follow installation instructions
More informationN- The rank of the specified protein relative to all other proteins in the list of detected proteins.
PROTEIN SUMMARY file N- The rank of the specified protein relative to all other proteins in the list of detected proteins. Unused (ProtScore) - A measure of the protein confidence for a detected protein,
More informationData Pre-processing in Liquid Chromatography-Mass Spectrometry Based Proteomics
Bioinformatics Advance Access published September 8, 25 The Author (25). Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oxfordjournals.org
More informationExpand Your Research with Metabolomics and Proteomics. Christine Miller Omics Market Manager ASMS 2017
Expand Your Research with Metabolomics and Proteomics Christine Miller Omics Market Manager ASMS 2017 New Additions to Agilent Omics Workflows Acquisition Ion Mobility Q-TOF IM All Ions MS/MS Find Features
More informationPEAKS 8 User Manual. PEAKS Team
PEAKS 8 User Manual PEAKS Team PEAKS 8 User Manual PEAKS Team Publication date 2016 Table of Contents 1. Overview... 1 1. How to Use This Manual... 1 2. What Is PEAKS?... 1 3. What Is New in PEAKS 8?...
More informationNew Approaches to Quantitative Proteomics Analysis
New Approaches to Quantitative Proteomics Analysis Chris Hodgkins, Market Development Manager, SCIEX ANZ 2 nd November, 2017 Who is SCIEX? Founded by Dr. Barry French & others: University of Toronto Introduced
More informationProteomics Informatics (BMSC-GA 4437)
Proteomics Informatics (BMSC-GA 4437) Instructor David Fenyö Contact information David@FenyoLab.org htt://fenyolab.org/resentations/proteomics_informatics_2013/ Learning Objectives Be able analyze a roteomics
More informationProteinPilot Software Overview
ProteinPilot Software Overview High Quality, In-Depth Protein Identification and Protein Expression Analysis Sean L. Seymour and Christie L. Hunter SCIEX, USA As mass spectrometers for quantitative proteomics
More informationDeNovoGUI: an open source graphical user interface for. de novo sequencing of tandem mass spectra.
DeNovoGUI: an open source graphical user interface for de novo sequencing of tandem mass spectra. Thilo Muth 1,$, Lisa Weilnböck 2,$, Erdmann Rapp 1, Christian G. Huber 2, Lennart Martens 3,4, Marc Vaudel
More informationFalse Discovery Rate ProteoRed Multicentre Study 6 Terminology Decoy sequence construction
False Discovery Rate ProteoRed Multicentre Study 6 Terminology FDR: False Discovery Rate PSM: Peptide- Spectrum Match (a.k.a., a hit) PIT: Percentage of Incorrect Targets In the past years, a number of
More informationSupporting Information for Comprehensive HCP Profiling by Targeted and Untargeted Analysis of DIA Mass Spectrometry Data with PRM Verification
Supporting Information for Comprehensive HCP Profiling by Targeted and Untargeted Analysis of DIA Mass Spectrometry Data with PRM Verification Simion Kreimer 1, Yuanwei Gao 1, Somak Ray 1, Mi Jin 2,3,
More informationHigh Resolution Accurate Mass Peptide Quantitation on Thermo Scientific Q Exactive Mass Spectrometers. The world leader in serving science
High Resolution Accurate Mass Peptide Quantitation on Thermo Scientific Q Exactive Mass Spectrometers The world leader in serving science Goals Explore the capabilities of High Resolution Accurate Mass
More informationCell Signaling Technology
Cell Signaling Technology PTMScan Direct: Multipathway v2.0 Proteomics Service Group January 14, 2013 PhosphoScan Deliverables Project Overview Methods PTMScan Direct: Multipathway V2.0 (Tables 1,2) Qualitative
More informationProteomics: A Challenge for Technology and Information Science. What is proteomics?
Proteomics: A Challenge for Technology and Information Science CBCB Seminar, November 21, 2005 Tim Griffin Dept. Biochemistry, Molecular Biology and Biophysics tgriffin@umn.edu What is proteomics? Proteomics
More informationWorkflows and Pipelines for NGS analysis: Lessons from proteomics
Workflows and Pipelines for NGS analysis: Lessons from proteomics Conference on Applying NGS in Basic research Health care and Agriculture 11 th Sep 2014 Debasis Dash Where are the protein coding genes
More informationShotgun Proteomics: How Confident are you in that Identification? or Statistical Evaluation of Shotgun Proteomic Data
Shotgun Proteomics: How Confident are you in that Identification? or Statistical Evaluation of Shotgun Proteomic Data Ron Orlando Complex Carbohydrate Research Center University of Georgia Athens, GA 30602
More informationVyužití cílené proteomiky pro kontrolu falšování potravin: identifikace peptidových markerů v mase pomocí LC- Q Exactive MS/MS
Využití cílené proteomiky pro kontrolu falšování potravin: identifikace peptidových markerů v mase pomocí LC- Q Exactive MS/MS Michal Godula Ph.D. Thermo Fisher Scientific The world leader in serving science
More informationMIAPE: Mass Spectrometry Informatics
MIAPE: Mass Spectrometry Informatics Pierre-Alain Binz[1,2]*, Robert Barkovich[3], Ronald C. Beavis[4], David Creasy[5], David M. Horn[6], Randall K. Julian Jr.[7], Sean L. Seymour[8], Chris F. Taylor[9],
More informationQuantitative Proteomics: From Technology to Cancer Biology
Quantitative Proteomics: From Technology to Cancer Biology Beyond the Genetic Prescription Pad: Personalizing Cancer Medicine in 2014 February 10-11, 2014 Thomas Kislinger Molecular Biomarkers in Body
More informationEvaluation of a GPGPU-based de novo Peptide Sequencing Algorithm
Journal of Medical and Biological Engineering, 34(5): 461-468 461 Evaluation of a GPGPU-based de novo Peptide Sequencing Algorithm Sankua Chao 1 James R. Green 1,* Jeffrey C. Smith 2,* 1 Department of
More informationEnsure your Success with Agilent s Biopharma Workflows
Ensure your Success with Agilent s Biopharma Workflows Steve Madden Software Product Manager Agilent Technologies, Inc. June 5, 2018 Agenda Agilent BioPharma Workflow Platform for LC/MS Intact Proteins
More informationComputational approaches to protein inference in shotgun proteomics
REVIEW Open Access Computational approaches to protein inference in shotgun proteomics Yong Fuga Li, Predrag Radivojac * Abstract Shotgun proteomics has recently emerged as a powerful approach to characterizing
More informationfaster, confident more path to all the information in your samples. Agilent MassHunter Workstation Software Our measure is your success.
Agilent MassHunter Workstation Software faster, A confident more path to all the information in your samples. Our measure is your success. products applications soft ware services MassHunter Workstation
More informationBasic protein and peptide science for proteomics. Henrik Johansson
Basic protein and peptide science for proteomics Henrik Johansson Proteins are the main actors in the cell Membranes Transport and storage Chemical factories DNA Building proteins Structure Proteins mediate
More informationPushing the Leading Edge in Protein Quantitation: Integrated, Precise, and Reproducible Protein Quantitation Workflow Solutions
2017 Metabolomics Seminars Pushing the Leading Edge in Protein Quantitation: Integrated, Precise, and Reproducible Protein Quantitation Workflow Solutions The world leader in serving science 2 3 Cancer
More informationPepLine, a New Software Pipeline using LC-MS/MS Data for Genome Annotation
Development of New Proteomic Tools for Functional Genomics and Genome Annotation PepLine, a New Software Pipeline using LC-MS/MS Data for Genome Annotation Jérôme GARIN Genome Annotation Protein databases
More informationModification Site Localization Scoring Integrated into a Search Engine
Modification Site Localization Scoring Integrated into a Search Engine Peter R. Baker 1, Jonathan C. Trinidad 1, Katalin F. Medzihradszky 1, Alma L. Burlingame 1 and Robert J. Chalkley 1 1 Mass Spectrometry
More informationFACTORS THAT AFFECT PROTEIN IDENTIFICATION BY MASS SPECTROMETRY HAOFEI TIFFANY WANG. (Under the Direction of Ron Orlando) ABSTRACT
FACTORS THAT AFFECT PROTEIN IDENTIFICATION BY MASS SPECTROMETRY by HAOFEI TIFFANY WANG (Under the Direction of Ron Orlando) ABSTRACT Mass spectrometry combined with database search utilities is a valuable
More informationThermo Scientific Q Exactive HF Orbitrap LC-MS/MS System. Higher-Quality Data, Faster Than Ever. Speed Productivity Confidence
Thermo Scientific Q Exactive HF Orbitrap LC-MS/MS System Higher-Quality Data, Faster Than Ever Speed Productivity Confidence Transforming discovery quantitation The Thermo Scientific Q Exactive HF hybrid
More informationQuantification of Isotope Encoded Proteins in 2D Gels
Quantification of Isotope Encoded Proteins in 2D Gels Using Surface Enhanced Resonance Raman Giselle M. Knudsen 1, Brandon M. Davis 2, Shirshendu K. Deb 1, Yvette Loethen 2, Ravindra Gudihal 1, Pradeep
More informationHow to view Results with. Proteomics Shared Resource
How to view Results with Scaffold 3.0 Proteomics Shared Resource An overview This document is intended to walk you through Scaffold version 3.0. This is an introductory guide that goes over the basics
More informationNext Generation Technology for Reproducible and Precise Proteome Profiling
7 th Czech Mass Spectrometry Conference April 11th, 2018 Next Generation Technology for Reproducible and Precise Proteome Profiling Lars Kristensen, Ph.D. Application and training specialist The world
More informationA Heuristic Method for Assigning a False-discovery Rate for Protein Identifications from Mascot Database Search Results*
Research A Heuristic Method for Assigning a False-discovery Rate for Protein Identifications from Mascot Database Search Results* D. Brent Weatherly, James A. Atwood III, Todd A. Minning, Cameron Cavola,
More informationA New Strategy for Quantitative Proteomics Using Isotope-Coded Protein Labels
ICPL TM -Isotope Coded Label A New Strategy for Quantitative Proteomics Using Isotope-Coded Labels Alexander Schmidt Department for Max-Planck-Institute of Biochemistry Spotfire User Conference 2004, Cologne
More informationUtilizing novel technology for the analysis of therapeutic antibodies and host cell protein contamination
Utilizing novel technology for the analysis of therapeutic antibodies and host cell protein contamination Kelli Jonakin, Ph.D. Senior Field Application Scientist, Seattle, WA Eric Johansen, Ph.D. Senior
More informationENHANCED PROTEIN AND PEPTIDE CHARACTERIZATION
Agilent MassHunter BioConfirm Software ENHANCED PROTEIN AND PEPTIDE CHARACTERIZATION Spectrum Algorithm Peak Modeling Deconvolution Mass 16951.778 Sequence Name Myoglobin (horse) Target mass 16951.673
More informationNature Biotechnology: doi: /nbt Supplementary Figure 1. The workflow of Open-pFind.
Supplementary Figure 1 The workflow of Open-pFind. The MS data are first preprocessed by pparse, and then the MS/MS data are searched by the open search module. Next, the MS/MS data are re-searched by
More informationImportant Information for MCP Authors
Guidelines to Authors for Publication of Manuscripts Describing Development and Application of Targeted Mass Spectrometry Measurements of Peptides and Proteins and Submission Checklist The following Guidelines
More informationSupplementary Tables. Note: Open-pFind is embedded as the default open search workflow of the pfind tool. Nature Biotechnology: doi: /nbt.
Supplementary Tables Supplementary Table 1. Detailed information for the six datasets used in this study Dataset Mass spectrometer # Raw files # MS2 scans Reference Dong-Ecoli-QE Q Exactive 5 202,452 /
More informationSupporting Information. Scanning Quadrupole Data Independent Acquisition Part A Qualitative and Quantitative Characterization
S Supporting Information Scanning Quadrupole Data Independent Acquisition Part A Qualitative and Quantitative Characterization M. Arthur Moseley, Christopher J. Hughes 2, Praveen R. Juvvadi 3, Erik J.
More informationTargeted Proteomics Environment
Targeted Proteomics Environment Signal processing for quantitative proteomics Brendan MacLean MacCoss Lab Spectrum-based Quantification Uses peptide spectrum matches already calculated Spectral counting
More informationTHE GALAXY FRAMEWORK AS A BIOINFORMATICS SOLUTION FOR PROTEOMICS AND MULTI-OMICS STUDIES.
THE GALAXY FRAMEWORK AS A BIOINFORMATICS SOLUTION FOR PROTEOMICS AND MULTI-OMICS STUDIES. Pratik Jagtap Managing Director, Center for Mass Spectrometry and Proteomics UNIVERSITY OF MINNESOTA Center for
More informationDe novo sequencing in the identification of mass data. Wang Quanhui Liu Siqi Beijing Institute of Genomics, CAS
De novo sequencing in the identification of mass data Wang Quanhui Liu Siqi Beijing Institute of Genomics, CAS The difficulties in mass data analysis Although the techniques of genomic sequencing are being
More informationtimstof Innovation with Integrity Powered by PASEF TIMS-QTOF MS
timstof Powered by PASEF Innovation with Integrity TIMS-QTOF MS timstof The new standard for high speed, high sensitivity shotgun proteomics The timstof Pro with PASEF technology delivers revolutionary
More informationPRIDE Inspector: a tool to visualize and validate MS proteomics data
Europe PMC Funders Group Author Manuscript Published in final edited form as: Nat Biotechnol. ; 30(2): 135 137. doi:10.1038/nbt.2112. PRIDE Inspector: a tool to visualize and validate MS proteomics data
More informationInvestigating Biological Variation of Liver Enzymes in Human Hepatocytes
Investigating Biological Variation of Liver Enzymes in Human Hepatocytes SWATH Acquisition on the TripleTOF Systems Xu Wang 1, Hui Zhang 2, Christie Hunter 1 1 SCIEX, USA, 2 Pfizer, USA MS/MS ALL with
More informationLiver Mitochondria Proteomics Employing High-Resolution MS Technology
Liver Mitochondria Proteomics Employing High-Resolution MS Technology Jenny Ho, 1 Loïc Dayon, 2 John Corthésy, 2 Umberto De Marchi, 2 Antonio Núñez, 2 Andreas Wiederkehr, 2 Rosa Viner, 3 Michael Blank,
More informationBST 226 Statistical Methods for Bioinformatics David M. Rocke. February 10, 2014 BST 226 Statistical Methods for Bioinformatics 1
BST 226 Statistical Methods for Bioinformatics David M. Rocke February 10, 2014 BST 226 Statistical Methods for Bioinformatics 1 Proteomics by LS/MS/MS Proteins are digested with trypsin or other proteases
More informationMass spectrometry Proteomics and MIAPE
Mass spectrometry Proteomics and MIAPE Florian Breitwieser - Research Center of Molecular Medicine, Vienna, Austria Nov 18, 2010 Outline BioC-devel meeting Europe 17.-18. 11. 2010 MS-MS Proteomics Standard
More informationPrinciples of Proteomic Methods
Principles of Proteomic Methods Marc Wilkins School of Biotechnology and Biomolecular Sciences What is Proteomics? - proteomics is the study of proteomes - proteomics aims to: separate, identify and characterise
More informationElementary, my dear Watson: Fingerprint search in molecular structure databases
Elementary, my dear Watson: Fingerprint search in molecular structure databases Sebastian Böcker Friedrich-Schiller-Universität Jena C4H9N3O2 132.0768 Da molecular structure database H3N H2O C4H4O2 CH2N2
More informationrapiflex Innovation with Integrity Designed for Molecules that Matter. MALDI TOF/TOF
rapiflex Designed for Molecules that Matter. Innovation with Integrity MALDI TOF/TOF rapiflex TM The first MALDI-TOF/TOF that adapts to your needs. The rapiflex is the most advanced MALDI TOF/TOF system
More informationStrategies for Quantitative Proteomics. Atelier "Protéomique Quantitative" La Grande Motte, France - June 26, 2007
Strategies for Quantitative Proteomics Atelier "Protéomique Quantitative", France - June 26, 2007 Bruno Domon, Ph.D. Institut of Molecular Systems Biology ETH Zurich Zürich, Switzerland OUTLINE Introduction
More informationwith Database Search of Tandem Mass Spectra
MCP Papers in Press. Published on August 14, 2008 as Manuscript M800103-MCP200 Spectral Dictionaries: Integrating De Novo Peptide Sequencing with Database Search of Tandem Mass Spectra Sangtae Kim 1, Nitin
More informationwith Database Search of Tandem Mass Spectra
MCP Papers in Press. Published on August 14, 2008 as Manuscript M800103-MCP200 Spectral Dictionaries: Integrating De Novo Peptide Sequencing with Database Search of Tandem Mass Spectra Sangtae Kim 1, Nitin
More informationComparative Evaluation of Tandem MS Search Algorithms Using a Target-Decoy Search Strategy* S
Research Comparative Evaluation of Tandem MS Search Algorithms Using a Target-Decoy Search Strategy* S Brian M. Balgley, Tom Laudeman, Li Yang, Tao Song, and Cheng S. Lee Peptide identification of tandem
More information