Characterization of DIM-1, an Integron-Encoded Metallo-ß- Netherlands
|
|
- Charla Ryan
- 6 years ago
- Views:
Transcription
1 AAC Accepts, published online ahead of print on March 0 Antimicrob. Agents Chemother. doi:./aac.01-0 Copyright 0, American Society for Microbiology and/or the Listed Authors/Institutions. All Rights Reserved. 1 Revised AAC01-0 Version Characterization of DIM-1, an Integron-Encoded Metallo-ß- Lactamase from a Pseudomonas stutzeri Clinical Isolate in the Netherlands Laurent Poirel, 1 Jose-Manuel Rodríguez-Martínez, 1 Nashwan Al Naiemi, Yvette J. Debets-Ossenkopp, and Patrice Nordmann 1 * 1 Service de Bactériologie-Virologie, Hôpital de Bicêtre, Assistance Publique/Hôpitaux de Paris, Faculté de Médecine Paris-Sud, Université Paris XI, K.-Bicêtre, France, 1 and Dept of Microbiology, Vrije Universiteit Medical Center, Amsterdam, The Netherlands Keywords : Pseudomonas stutzeri, metallo-ß-lactamase, DIM, integron Running title : Metallo-ß-lactamase DIM-1 in Pseudomonas stutzeri L.P. and J.M.R.M. contributed equally to this work * Corresponding author. Mailing address: Service de Bactériologie-Virologie, Hôpital de Bicêtre, rue du Général Leclerc, Le Kremlin-Bicêtre cedex, France. Phone: Fax: nordmann.patrice@bct.aphp.fr 1
2 A carbapenem-resistant Pseudomonas stutzeri strain isolated from a Dutch patient was analyzed in detail. This isolate produced a metallo-ß-lactamase (MBL) whose gene, of.% GC content, was cloned and expressed in Escherichia coli. ß- Lactamase DIM-1 (for Dutch IMipenemase) was weakly related to other Ambler class B ß-lactamases, sharing less than % amino acid identity with the most closely- related MBL GIM-1, and % with IMP-type MBLs. ß-Lactamase DIM-1 hydrolyzed significantly broad-spectrum cephalosporins and carbapenems, and spared aztreonam. This MBL gene was embedded in a class 1 integron containing two other gene cassettes encoding resistance to aminoglycosides and disinfectants, that was located on a 0-kb plasmid.
3 Metallo-ß-lactamases (MBLs) represent one of the most challenging antibiotic resistance threat in gram negatives (). Those enzymes hydrolyze very efficiently all ß- lactams including carbapenems (with the exception of aztreonam) and are located most often onto transferable genetic platforms (). Different MBL-type enzymes have been described, with IMP- and VIM-derivatives being the most widespread (). The bla IMP-like and bla VIM-like genes have been identified in most clinically-relevant bacteria belonging to the Enterobacteriacae family, in Pseudomonas spp., and in Acinetobacter spp. (). Several other MBLs have been identified in specific geographical locations, being SIM-1 from Acinetobacter baumannii in Korea (1), KHM-1 from Citrobacter freundii in Japan (), and NDM-1 from Klebsiella pneumoniae, Escherichia coli, and Enterobacter cloacae in India and the UK (, M. Doumith, M. Warner, M. Weinbren, J. Clayton, D.M. 1 Livermore, N. Woodford, Abstract C1-0, presented at the th ICAAC, San Francisco, 1 CA, 1 to 1 September 00), although SPM-1 in Brazil (1, 0, 0), GIM-1 in Germany 1 (), and AIM-1 in Australia (D. Yong, T.R. Walsh, J. Bell, B. Ritchie, R. Pratt, and M.A. 1 Toleman, presented at the th ICAAC, Chicago, DC, 1 to 0 September 00) were all 1 identified from Pseudomonas aeruginosa.
4 The genetic vehicles that carry MBL genes vary, but most of those genes are found as a form of gene cassettes (bla IMP-like, bla VIM-like, bla SIM and bla GIM-1 ) embedded into class 1 integron structures (). In addition, a peculiar insertion sequence named ISCR belonging to the IS1 family and likely moving by rolling-circle transposition has been identified at the origin of mobilization of bla SPM-1 (0, ). This study characterized a novel and clinically-significant MBL which gene was identified in a class 1 integron. MATERIALS AND METHODS Bacterial strains. Pseudomonas stutzeri clinical isolate 1 was identified with the API-0 NE system (biomérieux, Marcy l'etoile, France), and confirmed by rdna sequencing. E. coli TOP was the host for cloning experiments (1). 1 Susceptibility testing. Antibiotic-containing disks were used for routine 1 antibiograms by the disk diffusion assay (Sanofi-Diagnostic Pasteur, Marnes-la-Coquette, 1 France) as recommended (). The ESBL double-disk synergy test was performed with 1 disks containing ceftazidime or cefepime and ticarcillin-clavulanic acid on Mueller-Hinton
5 agar plates, and the results were interpreted as described previously (). The MBL detection was performed by using Etest MBL strips (AB Biodisk, Solna, Sweden). MICs were determined by an agar dilution technique with Mueller-Hinton agar (Sanofi-Diagnostic Pasteur) with an inoculum of CFU per spot, as described previously (1). All plates were incubated at C for 1 h at ambient atmosphere. MICs of ß-lactams were determined alone or in combination with a fixed concentration of clavulanic acid ( µg/ml) and tazobactam ( µg/ml). MIC results were interpreted according to the guidelines of the CLSI (). PCR and hybridization experiments. Total DNA of P. stutzeri 1 was extracted as described previously (). This DNA was used as a template in standard PCR conditions () with a series of primers designed for the detection of class B ß-lactamase genes 1 bla IMP, bla VIM, bla SPM, and bla SIM (1, ). Southern hybridizations were performed as 1 described by Sambrook et al. () using the ECL nonradioactive labeling and detection kit 1 (GE Healthcare, Orsay, France). 1 Cloning experiments, recombinant plasmid analysis, and DNA sequencing. 1 Total DNA of P. stutzeri 1 isolate was digested by XbaI restriction enzyme, ligated into
6 the XbaI site of plasmid pbk-cmv and transformed in E. coli TOP reference strain, as described (1). Recombinant plasmids were selected onto Trypticase soy (TS) agar plates containing amoxicillin (0 µg/ml) and kanamycin (0 µg/ml). The cloned DNA fragments of several recombinant plasmids were sequenced on both strands with an Applied Biosystems sequencer (ABI 0) (Applied Biosystems, Foster City, Ca). The entire sequence provided in this study was made of sequences of several plasmids that contained overlapping cloned fragments. The nucleotide and deduced amino acid sequences were analyzed and compared to sequences available over the Internet at the National Center for Biotechnology Information website ( Genetic support. Transformation experiments were performed with P. stutzeri 1 DNA into P. aeruginosa PU1 recipient strain, as described (1). Plasmid DNA extraction 1 from P. stutzeri 1 was attempted with the Qiagen plasmid DNA maxi kit (Qiagen, 1 Courtaboeuf, France) and with the Kieser method (1) and visualized and sized as 1 described (1). Hybridization was performed with a -bp probe specific for bla DIM-1 1 gene generated with internal primers DIM-1A ( -TCTATTCAGCTTGTCTTCGC- ) and 1 DIM-1B ( -TGTTAGAGGCTGTCTCAGCC- ).
7 ß-Lactamase purification and isoelectric focusing (IEF) analysis. Cultures of E. coli TOP(pXD-1) were grown overnight at C in four liters of TS broth containing amoxicillin (0 µg/ml) and kanamycin (0 µg/ml). ß-Lactamase was purified by ion- exchange chromatography. Briefly, the ß-lactamase extract obtained by sonication of the cells, resuspended in 0 mm sodium phosphate buffer (ph ), was cleared by ultracentrifugation, treated with DNAse, and dialyzed against 0 mm diethanolamine buffer (ph.). This extract was loaded on the Q-Sepharose column, and the ß-lactamase- containing fractions were eluted with a linear 0 to 0. M NaCl gradient. The fractions containing the highest ß-lactamase activity were again dialyzed against the same buffer mentioned above, and the same procedure repeated by eluting more slowly with a linear 0 to 0. M NaCl gradient. The purity of the enzyme was estimated by sodium dodecyl sulfate 1 (SDS)-polyacrylamide gel electrophoresis analysis. The protein content was measured by 1 the Bio-Rad DC protein assay. 1 IEF analysis was performed with an ampholine polyacrylamide gel (ph. to.), 1 as described previously (1), using a purified ß-lactamase extract from a culture of E. coli
8 TOP(pXD-1). The focused ß-lactamases were detected by overlaying the gel with 1 mm nitrocefin (Oxoid, Dardilly, France) in 0 mm phosphate buffer (ph.0). Kinetic measurements. Purified ß-lactamase was used for kinetic measurements performed at 0 C with 0 mm Hepes buffer (ph.) supplemented with 0 µm ZnSO with an ULTROSPEC 000 UV spectrophotometer (Amersham Pharmacia Biotech) as described (). The specific activity of the purified ß-lactamase from E. coli TOP(pXD-1) was obtained as described previously, with imipenem as substrate (). One unit of enzyme activity was defined as the activity which hydrolyzed 1 µmol of imipenem per min per mg of protein. The total protein content was measured with the DC Protein assay kit (Bio-Rad, Ivry-sur-Seine, France). In order to evaluate whether the zinc ion concentration might have an impact on DIM-1 hydrolytic activity, specific activities were measured using the 1 purified enzyme and variable concentrations of ZnSO (0, 0, 0, 0, 00, 00 µm and 1 1mM) and using imipenem as substrate. 1 Fifty percent inhibitory concentration (IC 0 ) was determined for DIM-1 as the 1 concentration of EDTA that reduced the hydrolysis rate of 0 µm benzylpenicillin by
9 0%, under conditions in which DIM-1 was preincubated with various concentrations of EDTA for min at 0 C, before adding the substrate. Nucleotide sequence accession number. The nucleotide sequence data reported in this work have been deposited in the GenBank nucleotide database under accession no. GU01. RESULTS and DISCUSSION Properties of P. stutzeri isolate 1. This strain was isolated in June 00 at the VU Medical Center, Amsterdam (The Netherlands) from purulent exudate obtained from tibial osteomyelitis in a -year old patient who did not have any history of recent travel or hospitalization elsewhere. P. stutzeri 1 was resistant to ticarcillin, piperacillin, piperacillin-tazobactam, and imipenem, had reduced susceptibility to ceftazidime, 1 cefepime, cefpirome and remained fully susceptible to aztreonam. Double-disk synergy 1 test was negative with clavulanate-ceftazidime and clavulanate-imipenem (data not 1 shown), but was positive with the MBL E-test (MIC of IMP at µg/ml vs MIC of 1 IMP/EDTA at µg/ml). This P. stutzeri isolate was also resistant to gentamicin,
10 tobramycin, fluoroquinolones, rifampin, chloramphenicol and tetracycline, and remained susceptible to amikacin, netilmicin, and colistin. Cloning and sequencing of the ß-lactamase gene. Preliminary attempts to detect MBL encoding genes by PCR failed (data not shown). Using total DNA of P. stutzeri 1 as a template in cloning experiments, several E. coli strains harboring recombinant plasmids including pxd-1 were obtained. Sequence analysis of a ca. -kb cloned fragment of pxd-1 revealed a -bp long open reading frame (ORF) encoding a 1-amino-acid preprotein corresponding to an Ambler class B ß-lactamase designated DIM-1 (for Dutch IMipenemase) (1). It possessed the conserved motifs characteristic of MBL enzymes (Fig. 1), including the consensus zinc binding motif HXHXD (residues to ), together with the critical residues for MBL activity, such as His, His, Asp, His1, 1 Cys1, and His according to the BBL nomenclature (, 1-) (Fig. 1). According to 1 its amino acid sequence, it can be classified as a member of subclass 1 MBL, together with 1 IMP- and VIM-types ß-lactamases (). DIM-1 was distantly related to other Ambler class 1 B ß-lactamases. Indeed, the highest percentages of amino acid identity were % with 1 GIM-1 (), % with a putative MBL identified in-silico in the genome of Shewanella
11 denitrificans (Genbank NC_00), and % with KHM-1 (). ß-Lactamase DIM-1 shared % identity with the widespread IMP-type enzymes, and only 0% with the VIM- type enzymes. The G+C content of the bla DIM-1 gene was.%, a value which fits with that of many gram negative species but differs significantly from the G+C content of the P. stutzeri genome being % according to the Genbank database (n NC_00), thus suggesting an horizontal acquisition of bla DIM-1. ß-Lactam susceptibility. MICs of ß-lactams for E. coli TOP(pXD-1) indicated the expression of an MBL that hydrolysed expanded-spectrum cephalosporins (including cephamycins) together with carbapenems, that conferred reduced susceptibility to imipenem and meropenem, and that paradoxally spared aztreonam (Table 1). Addition of ß-lactamase inhibitors such as clavulanic acid or tazobactam did not restore the 1 susceptibility to ß-lactams. 1 Biochemical properties of DIM-1. IEF analysis showed that P. stutzeri 1 and 1 E. coli TOP(pXD-1) had ß-lactamase activities with a pi value of., corresponding to 1 that of DIM-1 (data not shown). The specific activity of the purified ß-lactamase DIM-1 1 was 1 U.mg of protein -1 with benzylpenicillin as substrate. Its overall recovery was 0%
12 with a -fold purification. The purity of the enzyme was estimated to be more than % according to SDS-gel electrophoresis analysis (data not shown). Kinetic parameters of DIM-1 showed its broad-spectrum activity against most ß-lactams, including oxyimino- cephalosporins, cephamycins, and carbapenems but excluding aztreonam (Table ). Analysis of the relative hydrolysis rates of DIM-1 showed that cefotaxime was hydrolyzed at a similar level to that of benzylpenicillin, and cefoxitin was also a good substrate. Ceftazidime was significantly hydrolyzed, with a K m value of 0 µm reflecting a relatively good affinity of DIM-1 for that substrate, as commonly observed for many MBLs. On the opposite, the monobactam aztreonam was not hydrolyzed by DIM-1, as for all MBLs (, ). IC 0 determinations performed with benzylpenicillin as a substrate showed that DIM-1 activity was inhibited by EDTA (1 µm). 1 In addition, we observed that the DIM-1 hydrolytic activity was correlated with the 1 zinc ion concentration. Whereas, the specific activity of DIM-1 for imipenem was U.mg of protein -1 in absence on ZnSO, it was respectively 0.1, 0.1, 0.1, 0., 0., and 1 0. U.mg of protein -1 in presence of increased concentrations of ZnSO (ranging from 0, 1 0, 0, 0, 00, 00 µm and 1mM), thus indicating a significant correlation. 1
13 Genetic environment and support of the bla DIM-1 gene. Sequence analysis of recombinant plasmid pxd-1 harboring the bla DIM-1 gene revealed that it was as a form of a gene cassette, which was inserted at the atti1 recombination site (), similarly to the other acquired MBL encoding genes identified in gram negatives such as bla IMP, bla VIM, and bla SIM genes. Analysis of the -end sequence of the integron showed that the P C promoter sequences were located in the structural integrase gene but no secondary promoter P was identified (1). Thus, the gene cassettes located in that integron are under the control of weak promoter sequences. The dim-1 gene cassette possessed imperfect core (GTTAGAG) and inverse core (CGCTAAC) sites, that latter being located inside the bla DIM-1 coding sequence ( bp from the -end of the gene). The length of its -be sequence was only 1 bp, in which the 1 usually conserved R and L regions of -bes were not detected, indicating that this - 1 be has been likely truncated and therefore suggesting that the dim-1 cassette may not be 1 functional in recombination anymore. A second gene cassette was identified, containing 1 the aadb gene encoding resistance to aminoglycosides (Fig. ). The third gene cassette 1 contained the qach gene encoding resistance to disinfectants. Inside the qach gene 1
14 cassette, the ISKpn insertion sequence was identified that had targeted the -be (), as previously noticed with other members of the IS family that target preferentially the gene cassette -bes (1, ). Analysis of the right extremity of this integron showed that the -conserved segment made of the qace 1 and sul1 genes usually identified were absent, but the tnic gene of transposon Tn00 encoding a 0 amino acid long resolvase was identified. The tnpa gene of transposon Tn was identified (a Tn-like transposon), as well as its IRR extremity (Fig. ). The left-hand extremity of class 1 integrons defined by an inverted repeat structure was identified downstream of the int1 gene, truncating a tnpa gene (subsequently lacking bp at its -extremity) that encodes the transposase of transposon Tn. The IRR of 1 Tn was also identified, that was preceeded by a novel insertion sequence element 1 named ISPst (Fig. ). ISPst is 1, bp long, belongs to the IS0 family, and its 1 transposase shares 0% amino acid identity with that of ISPst1 also identified from a P. 1 stutzeri isolate ( Its transposition had generated a -bp 1 duplication. 1
15 Electro-transformation experiments did not result into the transfer of bla DIM-1 either to P. aeruginosa PU1 or E. coli TOP recipients strains. However, analysis of plasmid content of P. stutzeri 1 identified a single 0-kb plasmid that harbored the bla DIM-1 gene, as confirmed by Southern hybridization (data not shown). However, the negative mating- out result prevented to know which other antibiotic resistance markers were plasmid- associated with the bla DIM-1 gene. As a conclusion, we identified here a novel MBL sharing weak amino acid identity with other MBLs but sharing similar biochemical properties. The dissemination of the bla DIM-1 gene among other gram negative isolates, and especially in Enterobacteriaceae, remains to be evaluated. Indeed, several pieces of evidence had indicated that environmental species such as Pseudomonas sp. may act as intermediate reservoirs for 1 capturing antibiotic resistance genes from other environmental species and then 1 exchanging those genes with Enterobacteriaceae. 1 1 ACKNOWLEDGMENTS This work was mostly funded by the INSERM, France, and by grants from the Ministère 1 de l'education Nationale et de la Recherche (UPRES-EA), Université Paris XI, France 1 and from the European Community (DRESP, LSHM-CT-00-0 and TROCAR, 1
16 HEALTH-F-00-01). J.M. R.M. was funded by a postdoctoral grant from the Ministerio de Educación y Ciencia from Spain (00/0). REFERENCES 1. Ambler, R. P., A. F. Coulson, J.-M. Frère, J. M. Ghuysen, B. Joris, M. Forsman, R. C. Levesque, G. Tiraby, and S. G. Waley. 11. A standard numbering scheme for the class A ß-lactamases. Biochem. J. :-0.. Bellais, S., D. Aubert, T. Naas, and P. Nordmann Molecular and biochemical heterogeneity of class B carbapenem-hydrolyzing ß-lactamases in Chryseobacterium meningosepticum. Antimicrob. Agents Chemother. :1-1.. Bellais, S., D. Girlich, A. Karim, and P. Nordmann. 00. EBR-1, a novel 1 Ambler subclass B1 ß-lactamase from Empedobacter brevis. Antimicrob. Agents 1 Chemother. :-. 1. Bush, K. 1. Metallo-β-lactamases: a class apart. Clin. Infect. Dis. (Suppl. 1 1):S-S. 1
17 . Castanheira, M., M. A. Toleman, R. N. Jones, F. J. Schmidt, and T. R. Walsh. 00. Molecular characterization of a ß-lactamase gene, bla GIM-1, encoding a new subclass of metallo-ß-lactamase. Antimicrob. Agents Chemother. :-1.. Clinical and Laboratory Standards Institute. 0. Performance standards for antimicrobial susceptibility testing. CLSI M0-S0. Clinical and Laboratory Standards Institute, Wayne, PA.. Collis, C. M., and R. M. Hall. 1. Expression of antibiotic resistance genes in the integrated cassettes of integrons. Antimicrob. Agents Chemother. :1-1.. Cornaglia, G., M. Akova, G. Amicosante, R. Cantón, R. Cauda, J.-D. Docquier, M. Edelstein, J.-M. Frère, M. Fuzi, M. Galleni, H. Giamarellou, M. Gniadkowski, R. Koncan, B. Libisch, F. Luzzaro, V. Miriagou, F. Navarro, P. 1 Nordmann, L. Pagani, L. Peixe, L. Poirel, M. Souli, E. Tacconelli, A. 1 Vatopoulos, and G. M. Rossolini; ESCMID Study Group for Antimicrobial 1 Resistance Surveillance (ESGARS). 00. Metallo-ß-lactamases as emerging 1 resistance determinants in Gram-negative pathogens: open issues. Int. J. 1 Antimicrob. Agents :0-. 1
18 . Galleni, M., J. Lamotte-Brasseur, G. M. Rossolini, J. Spencer, O. Dideberg, and J.-M. Frère Standard numbering scheme for class B β-lactamases. Antimicrob. Agents Chemother. :0-.. Gouet, P., E. Courcelle, D. I. Stuart, and F. Metoz. 1. ESPrip : multiple sequence alignments in PostScript. Bioinformatics 1:0-0.. Jarlier, V., M.-H. Nicolas, G. Fournier, and A. Philippon. 1. Extended broad-spectrum ß-lactamases conferring transferable resistance to newer ß-lactam agents in Enterobacteriaceae: hospital prevalence and susceptibility patterns. Rev. Infect. Dis. :-. 1. Kieser, T. 1. Factors affecting the isolation of CCC DNA from Streptomyces lividans and Escherichia coli. Plasmid 1: Lee, K., J. H. Yum, D. Yong, H. M. Lee, H. D. Kim, J.-D. Docquier, G. M. 1 Rossolini, and Y. Chong. 00. Novel acquired metallo-ß-lactamase gene, bla SIM- 1 1, in a class 1 integron from Acinetobacter baumannii clinical isolates from Korea. 1 Antimicrob. Agents Chemother. :-1. 1
19 1. Levesque, C., S. Brassard, J. Lapointe, and P. H. Roy. 1. Diversity and relative strength of tandem promoters for the antibiotic-resistance genes of several integrons. Gene 1:-. 1. Mammeri, H., L. Poirel, and P. Nordmann. 00. In vivo selection of a chromosomally encoded β-lactamase variant conferring ceftazidime resistance in Klebsiella oxytoca. Antimicrob. Agents Chemother. :-. 1. Philippon, L. N., T. Naas, A. T. Bouthors, V. Barakett, and P. Nordmann. 1. OXA-1, a class D clavulanic acid-inhibited extended-spectrum β-lactamase from Pseudomonas aeruginosa. Antimicrob. Agents Chemother. 1: Picão, R. C., L. Poirel, A. C. Gales, and P. Nordmann. 00. Diversity of ß- lactamases produced by ceftazidime-resistant Pseudomonas aeruginosa isolates 1 causing bloodstream infections in Brazil. Antimicrob. Agents Chemother. : Poirel, L., L. Brinas, N. Fortineau, and P. Nordmann. 00. Integron-encoded 1 GES-type extended-spectrum ß-lactamase with increased activity toward aztreonam 1 in Pseudomonas aeruginosa. Antimicrob. Agents Chemother. :-. 1
20 1. Poirel, L., L. Brinas, A. Verlinde, L. Ide, and P. Nordmann. 00. BEL-1, a novel clavulanic acid-inhibited extended-spectrum ß-lactamase, and the class 1 integron In in Pseudomonas aeruginosa. Antimicrob. Agents Chemother. :-. 0. Poirel, L., M. Magalhaes, M. Lopes, and P. Nordmann. 00. Molecular analysis of metallo-beta-lactamase gene bla SPM-1 -surrounding sequences from disseminated Pseudomonas aeruginosa isolates in Recife, Brazil. Antimicrob. Agents Chemother. :-. 1. Poirel L., T. Naas, D. Nicolas, L. Collet, S. Bellais, J. D. Cavallo, and P. Nordmann Characterization of VIM-, a carbapenem-hydrolyzing metallo- ß-lactamase and its plasmid- and integron-borne gene from a Pseudomonas 1 aeruginosa clinical isolate in France. Antimicrob. Agents Chemother. : Poirel, L., and P. Nordmann. 00. Acquired carbapenem-hydrolyzing ß- 1 lactamases and their genetic support. Curr. Pharm. Biotechnol. : Poirel, L., J. D. Pitout, and P. Nordmann. 00. Carbapenemases: molecular 1 diversity and clinical consequences. Future Microbiol. :
21 . Post, V., and R. M. Hall. 00. Insertion sequences in the IS family that target the attc recombination sites of integron-associated gene cassettes. FEMS Microbiol. Lett. 0:1-1.. Rasmussen, B. A., and K. Bush. 1. Carbapenem-hydrolyzing β-lactamases. Antimicrob. Agents Chemother. 1:-.. Sambrook, J., E. F. Fritsch, and T. Maniatis. 1. Molecular cloning: a laboratory manual, nd ed. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.. Sekiguchi, J., K. Morita, T. Kitao, N. Watanabe, M. Okazaki, T. Miyoshi- Akiyama, M. Kanamori, and T. Kirikae. 00. KHM-1, a novel plasmid- mediated metallo-ß-lactamase from a Citrobacter freundii clinical isolate. 1 Antimicrob. Agents Chemother. : Tetu, S. G., and A. J. Holmes. 00. A family of insertion sequences that impacts 1 integrons by specific targeting of gene cassette recombination sites, the IS- 1 attc group. J. Bacteriol. 10:-0. 1
22 . Toleman, M. A., P. M. Bennett, and T. R. Walsh. 00. ISCR elements: novel gene-capturing systems of the 1 st century? Microbiol. Mol. Biol. Rev. 0: Toleman, M. A., A. M. Simm, T. A. Murphy, A. C. Gales, D. J. Biedenbach, R. N. Jones, and T. R. Walsh. 00. Molecular characterization of SPM-1, a novel metallo-ß-lactamase isolated in Latin America: report from the SENTRY antimicrobial surveillance programme. J. Antimicrob. Chemother. 0:-. 1. Ullah, J. H., T. R. Walsh, I. A. Taylor, D. C. Emery, C. S. Verma, S. J. Gamblin, and J. Spencer. 1. The crystal structure of the L1 metallo-β- lactamase from Stenotrophomonas maltophilia at 1.A resolution. J. Mol. Biol. :1-1.. Walsh, T. R., L. Hall, S. J. Assinder, W. W. Nichols, S. J. Cartwright, A. P. 1 MacGowan, and P. M. Bennett. 1. Sequence analysis of the L-1 metallo-β- 1 lactamase from Xanthomonas maltophilia. Biochim. Biophys. Acta : Walsh, T. R., M. A. Toleman, L. Poirel, and P. Nordmann. 00. Metallo-ß- 1 lactamases: the quiet before the storm? Clin. Microbiol. Rev. 1:0-.
23 . Wang, Z., W. Fast, A. M. Valentine, and S. J. Benkovic. 1. Metallo-β- lactamase: structure and mechanism. Curr. Opin. Chem. Biol. :1-.. Yong, D., M. A. Toleman, C. G. Giske, H. S. Cho, K. Sundman, K. Lee, and T. R. Walsh. 00. Characterization of a new metallo-ß-lactamase gene, bla NDM-1, and a novel erythromycin esterase gene carried on a unique genetic structure in Klebsiella pneumoniae sequence type 1 from India. Antimicrob. Agents Chemother. :0-0
24 FIGURE LEGENDS Figure 1. Panel A. Comparison of the amino acid sequence of ß-lactamase DIM-1 to those of other acquired MBLs (GIM-1, SIM-1, IMP-1, VIM-1, NDM-1 and SPM-1), and several naturally-occurring MBLs sharing some degree of similarities (IND-1 from Chryseobacterium indologenes, JOHN-1 from Flavobacterium johnsoniae, SLB-1 from Shewanella livingstonensis, and SFB-1 from Shewanella frigidimarina). Shaded amino acids are those conserved with DIM-1. Numbering of ß-lactamases is according to BBL (). Stars indicate conserved amino acid residues. Dashes correspond to the sequence gaps. Panel B. Secondary structure of DIM-1 as compared to that of VIM-. The beta strands and alpha helix are indicated above the DIM-1 sequence. The conserved residues are 1 indicated in black. The conservative amino acid substitutions are boxed. The figure was 1 obtained with ESPript software (). 1 1 Figure. Schematic map representing the In integron structure containing the bla DIM-1 1 gene, together with its flanking sequences. The -bes are indicated by white circles. The 1 horizontal arrows indicate the transcription orientations. The insertion sequences ISPst
25 and ISKpn are represented by rectangles. The right inverted repeats (IRR) of transposons Tn and Tn are represented by black triangles.
26 TABLE 1. MICs of β-lactams for P. stutzeri 1 clinical isolate, E. coli TOP harboring recombinant plasmid pxd-1 expressing DIM-1, and E. coli TOP reference strain. β-lactam (s) a P. stutzeri E. coli E. coli 1 TOP TOP (pxd-1) Amoxicillin >1 >1 Amoxicillin+ CLA >1 >1 Ticarcillin >1 >1 Ticarcillin + CLA >1 >1 Piperacillin >1 1 1 Piperacillin + TZB Cefoxitin 1 1 Ceftazidime 0.0 Cefotaxime Cefepime Aztreonam Imipenem 0.0 a CLA, clavulanic acid at a fixed concentration of µg/ml; TZB, tazobactam at a fixed concentration of µg/ml.
27 Table. Kinetic parameters of purified ß-lactamase DIM-1 a Substrate k cat (s -1 ) K m (µm) k cat /K m (mm -1.s -1 ) Benzylpenicillin 0 0,00 Ampicillin 0 0 Ticarcillin 0 1,00 Cephalothin 0,000 Ceftazidime 0 0 Cefotaxime.,000 Cefepime 0 1 Cefoxitin 0 00 Aztreonam < 0.01 ND ND Imipenem 0 0 Meropenem 0 00 a Data are the means of three independent experiments. Standard deviations were within % of the means. b ND, no detectable hydrolysis (< 0.01 s -1 ).
28 Figure 1 (A) DIM MRTHFTALLLLFSLSSLANDEVPELRIEKVKENIFLHTSYSRVNGFGLVSSNGLVVIDKG-NAFIVDTPWSDRDTETLVHWIRKNG-YELLGS GIM MKNVLVFLILLVALPALAQGHKP-LEVIKIEDGVYLHTSFKNIEGYGLVDSNGLVVLDNN-QAYIIDTPWSEEDTKLLLSWATDRG-YQVMAS SIM MRTLLILCLFGTLNTAFAEEAQPDLKIEKIEEGIYLHTSFQEYKGFGIVKKQGLVVLDNH-KAYLIDTPASAGDTEKLVNWLEKND-FTVNGS IMP MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA-EAYLIDTPFTAKDTEKLVTWFVERG-YKIKGS SLB MLSLPSYSHEVEP----TSTTIQSVTSSLEGQLSISKLADGVYLHHSYKNVSNFGLVEANGLVVIKDK-QAFIIDTPWTDNDTQKLVDWITQQG-FIPVAS SFB MISAPSFAHENEQQTDQSNTDAVKKPQQQPTELFLSPLVPDVYLHQSYKQVSGFGLVESNGLVVVQNK-QAFIIDTPWTDSDTAKLVDWITQQG-LTVTAS JOHN MRKLASIILFLAAVSNSLGQSKNSPLQISHLTGDFYVYRTFNDYKGT-KISANAMYVVTDK-GVVLFDAPWDKTQFQPLLDSIKAKHNKEVVML IND MKKSIRFFIVSILLSPFASAQVKDFVIEPPIKNNLHIYKTFGVFGGK-EYSANSMYLVTKK-GVVLFDVPWEKIQYQSLMDTIKKRHNLPVVAV VIM MLKVISSLLVYMTASVMAVASPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHIATQSFDGA-VYPSNGLIVRDGD-ELLLIDTAWGAKNTAALLAEIEKQIGLPVTRA NDM-1 MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGG-RVLVVDTAWTDDQTAQILNWIKQEINLPVALA SPM MNSPKSRALLGFMGAFCLLLVAGAPLSAKSSDHVDLPYNLTATKIDSDVFVVTDRDFYSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVA 1 1 DIM-1 VSTHWHEDRTAGIKWLNDQSISTYATTSTNHLLKENKKEPAKYTLK-GNESTLVDGL IEVFYPGGGHTIDNVVVWLPKSKILFGGCFVRSL GIM-1 ISTHSHEDRTAGIKLLNSKSIPTYTSELTKKLLAREGKPVPTHYFK-DDEFTLGNGL IELYYPGAGHTEDNIVAWLPKSKILFGGCLVRSH SIM-1 ISTHFHDDSTAGIEWLNTKSIPTYASKLTNELLNKNGKTQAKHSFD-KESFWLVKNK IEIFYPGPGHTQDNEVVWIPNKKILFGGCFIKPN IMP-1 ISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFS-GVNYWLVKNK IEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPY SLB-1 ISTHSHQDRAGGIGYLNRQGITTTVSETTQQILTENDKTTAKSTFT-GMQYIMKTDL VEVYDLGAGHTKDNLVVWLPTQQILFGGCLIKSL SFB-1 ISTHSHQDRAGGIGYLNSQGIATWVSDKTQRLLTANKLSTASHTFR-TKQHTLQQQL IEVYDLGAGHTVDNLLVWLPKQQILFGGCLIKSL JOHN-1 FGTHSHEDRAGGFDFYKKKGIKTYSIKLTDDILKKNKEPRAEFIISNDTTFTVGNHT FEVYYPGKGHAPDNIVAWFKKEKILYGGCFVKSA IND-1 FATHSHDDRAGDLSFFNNKGIKTYATAKTNEFLKKDGKATSTEIIKTGKPYRIGGEE FVVDFLGEGHTADNVVVWFPKYNVLDGGCLVKSN VIM-1 VSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGP VELFYPGAAHSTDNLVVYVPSANVLYGGCAVHEL NDM-1 VVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGP LKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDS SPM-1 INTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDRIKAAEFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPK * * * * * ** *** DIM-1 DSEGLGYTGEAHIDQWSRSAQNALSRYSEAQIVIPGHGKIGDIALLKHTKSLAETASNKSIQPNANASAD GIM-1 EWEGLGYVGDASISSWADSIKNIVSKKYPIQMVVPGHGKVGSSDILDHTIDLAESASNKLMQPTAEASAD SIM-1 ---GLGNLSDANLEAWPGSAKKMISKYSKAKLVIPSHSEIGDASLLKLTWEQAIKGLNESKSKPPLIN-- IMP-1 ---GLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN-- SLB-1 NSSTLGYTGEADLQQWPLTIAKVQAQFPQVKIVVPGHGQVGDKALLEHTIELLIPK-NETVNSSS SFB-1 SSRTLGYTGEADLEQWPLTVAKVQAQFIQAKIVVPGHGKIGDTSLLSHTIDLLTQ JOHN-1 EALDLGYLGDADVKEWQKSIKKVQAKFKKPDYIISGHDDWTSKESLNHTLKLVDEYLAQKSAGKK----- IND-1 SATDLGYIKEANVEQWPKTINKLKAKYSKATLIIPGHDEWKGGGHVEHTLELLNKK VIM-1 SSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVAE NDM-1 KAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR SPM-1 E---LGYLGDANVKAWPDSAR--RLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL * * * *
29 (B)
30 Figure ISPst ΔtnpA In int1 bla DIM-1 aadb qach ISKpn tnic tnpa IRR IRR Tn Tn-like
Emergence and persistence of integron structures harbouring VIM genes in the Children s Memorial Health Institute, Warsaw, Poland,
Journal of Antimicrobial Chemotherapy (2009) 63, 269 273 doi:10.1093/jac/dkn512 Advance Access publication 18 December 2008 Emergence and persistence of integron structures harbouring VIM genes in the
More informationAAC Accepts, published online ahead of print on 2 June 2008 Antimicrob. Agents Chemother. doi: /aac
AAC Accepts, published online ahead of print on June 00 Antimicrob. Agents Chemother. doi:.11/aac.00175-0 Copyright 00, American Society for Microbiology and/or the Listed Authors/Institutions. All Rights
More informationGenetic support of Extended- Spectrum ß-Lactamases
Genetic support of Extended- Spectrum ß-Lactamases Laurent Poirel Dept of Microbiology (Pr Nordmann) Bicêtre Hospital. South-Paris Medical School. France ESCMID Conference on ESBL 29-31 May 2006 TEM-like
More informationVIM-19, a Metallo- -Lactamase with Increased Carbapenemase Activity from Escherichia coli and Klebsiella pneumoniae
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Jan. 2010, p. 471 476 Vol. 54, No. 1 0066-4804/10/$12.00 doi:10.1128/aac.00458-09 Copyright 2010, American Society for Microbiology. All Rights Reserved. VIM-19,
More informationVIM-19, a metallo-ß-lactamase with increased carbapenemase activity
AAC Accepts, published online ahead of print on 16 November 2009 Antimicrob. Agents Chemother. doi:10.1128/aac.00458-09 Copyright 2009, American Society for Microbiology and/or the Listed Authors/Institutions.
More informationResistance, Yonsei University College of Medicine, Seoul, Korea; and 2 Department of
AAC Accepts, published online ahead of print on March 0 Antimicrob. Agents Chemother. doi:./aac.0- Copyright 0, American Society for Microbiology and/or the Listed Authors/Institutions. All Rights Reserved.
More informationJAC A nosocomial outbreak of Pseudomonas aeruginosa isolates expressing the extended-spectrum β-lactamase GES-2 in South Africa
Journal of Antimicrobial Chemotherapy (2002) 49, 561 565 JAC A nosocomial outbreak of Pseudomonas aeruginosa isolates expressing the extended-spectrum β-lactamase GES-2 in South Africa Laurent Poirel a,
More informationBEL-1, a Novel Clavulanic Acid-Inhibited Extended-Spectrum -Lactamase, and the Class 1 Integron In120 in Pseudomonas aeruginosa
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Sept. 2005, p. 3743 3748 Vol. 49, No. 9 0066-4804/05/$08.00 0 doi:10.1128/aac.49.9.3743 3748.2005 Copyright 2005, American Society for Microbiology. All Rights Reserved.
More informationOXA-28, an Extended-Spectrum Variant of OXA-10 -Lactamase from Pseudomonas aeruginosa and Its Plasmid- and Integron-Located Gene
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Feb. 2001, p. 447 453 Vol. 45, No. 2 0066-4804/01/$04.00 0 DOI: 10.1128/AAC.45.2.447 453.2001 Copyright 2001, American Society for Microbiology. All Rights Reserved.
More informationCharacterization of a Naturally Occurring Class D -Lactamase from Achromobacter xylosoxidans
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, June 2008, p. 1952 1956 Vol. 52, No. 6 0066-4804/08/$08.00 0 doi:10.1128/aac.01463-07 Copyright 2008, American Society for Microbiology. All Rights Reserved. Characterization
More informationWhen Carbapenem-Hydrolyzing ß-Lactamase KPC. attributed to outer-membrane protein deficiency coupled with plasmid-mediated
AAC Accepts, published online ahead of print on 18 July 2011 Antimicrob. Agents Chemother. doi:10.1128/aac.00719-11 Copyright 2011, American Society for Microbiology and/or the Listed Authors/Institutions.
More informationDissemination of transposon Tn6001 in carbapenem-non-susceptible and extensively drug-resistant Pseudomonas aeruginosa in Taiwan
Journal of Antimicrobial Chemotherapy (2009) 64, 1170 1174 doi:10.1093/jac/dkp341 Advance Access publication 22 September 2009 Dissemination of transposon Tn6001 in carbapenem-non-susceptible and extensively
More informationWELCOME. to the CDS WORKSHOP
WELCOME to the CDS WORKSHOP Sydney 2010 Excel Spreadsheet for Registration Recent Additions to the CDS Doripenem 10mg disc A carbapenem claimed to be more active against Pseudomonas than Meropenem Daptomycin:
More informationINTERNATIONAL JOURNAL OF PHARMACEUTICAL RESEARCH AND BIO-SCIENCE
INTERNATIONAL JOURNAL OF PHARMACEUTICAL RESEARCH AND BIO-SCIENCE THE DETECTION OF METALLO BETA LACTAMASE PRODUCING PSEUDOMONAS AERUGINOSA IN A TERTIARY CARE HOSPITAL DR. B. V. RAMANA 1, K. RAJASEKHAR 2,
More informationAntimicrobial Agents and Chemotherapy New Data Letter
AAC Accepted Manuscript Posted Online 15 August 2016 Antimicrob. Agents Chemother. doi:10.1128/aac.01519-16 Copyright 2016, American Society for Microbiology. All Rights Reserved. 1 Antimicrobial Agents
More informationREVIEW. Genetic support of extended-spectrum b-lactamases L. Poirel, T. Naas and P. Nordmann
REVIEW Genetic support of extended-spectrum b-lactamases L. Poirel, T. Naas and P. Nordmann Service de Bactériologie-Virologie, Hôpital de Bicêtre, South-Paris Medical School, University Paris XI, Le Kremlin-Bicêtre,
More informationCloning and Characterization of E. meningoseptica Beta Lactamase
Cloning and Characterization of E. meningoseptica Beta Lactamase Authors: Lindsey Purcell, Jessica Matts, Patricia Canaan* Department of Biochemistry and Molecular Biology Abstract Elizabethkingia meningoseptica
More informationOngoing epidemic of bla VIM-1 -positive Klebsiella pneumoniae in Athens, Greece: a prospective survey
Journal of Antimicrobial Chemotherapy (2008) 61, 59 63 doi:10.1093/jac/dkm443 Advance Access publication 13 November 2007 Ongoing epidemic of bla VIM-1 -positive Klebsiella pneumoniae in Athens, Greece:
More informationTRANSMISSIBLE GENETIC ELEMENTS: PLASMIDS, TRANSPOSONS & INTEGRONS
TRANSMISSIBLE GENETIC ELEMENTS: PLASMIDS, TRANSPOSONS & INTEGRONS MOBILE GENETIC ELEMENTS 1 PLASMIDS -MOST OFTEN CIRCULAR MOLECULES OF DOUBLE-STRANDED DNA -VARY WIDELY IN SIZE -SELF-TRANSMISSIBLE ELEMENTS
More informationPrevalence of metallo-β-lactamases in clinical isolates of Pseudomonas aeruginosa from King Abdulaziz University Hospital in Jeddah
World Journal of Pharmaceutical Sciences ISSN (Print): 2321-3310; ISSN (Online): 2321-3086 Published by Atom and Cell Publishers All Rights Reserved Available online at: http://www.wjpsonline.org/ Original
More informationEnvironmental microbiota represents a natural reservoir for dissemination
AAC Accepts, published online ahead of print on August 0 Antimicrob. Agents Chemother. doi:./aac.001- Copyright 0, American Society for Microbiology and/or the Listed Authors/Institutions. All Rights Reserved.
More informationGES-2, a Class A -Lactamase from Pseudomonas aeruginosa with Increased Hydrolysis of Imipenem
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Sept. 2001, p. 2598 2603 Vol. 45, No. 9 0066-4804/01/$04.00 0 DOI: 10.1128/AAC.45.9.2598 2603.2001 Copyright 2001, American Society for Microbiology. All Rights Reserved.
More informationEBR-1, a Novel Ambler Subclass B1 -Lactamase from Empedobacter brevis
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Oct. 2002, p. 3223 3227 Vol. 46, No. 10 0066-4804/02/$04.00 0 DOI: 10.1128/AAC.46.10.3223 3227.2002 Copyright 2002, American Society for Microbiology. All Rights
More informationReceived 23 December 2010/Returned for modification 11 January 2011/Accepted 7 February 2011
JOURNAL OF CLINICAL MICROBIOLOGY, Apr. 2011, p. 1608 1613 Vol. 49, No. 4 0095-1137/11/$12.00 doi:10.1128/jcm.02607-10 Copyright 2011, American Society for Microbiology. All Rights Reserved. Evaluation
More informationExtended Spectrum β-lactamases: Critical Tools of Bacterial Resistance
Review Article Mahidol University Journal of Pharmaceutical Science 2012; 39 (1), 1-8 Extended Spectrum β-lactamases: Critical Tools of Bacterial Resistance Department of Microbiology, Faculty of Pharmacy,
More informationIMP-29, a novel IMP-type metallo-β-lactamase in Pseudomonas aeruginosa
AAC Accepts, published online ahead of print on 30 January 2012 Antimicrob. Agents Chemother. doi:10.1128/aac.05838-11 Copyright 2012, American Society for Microbiology. All Rights Reserved. 1 2 IMP-29,
More informationORIGINAL ARTICLE /j x
ORIGINAL ARTICLE 10.1111/j.1469-0691.2008.02030.x Metallo-b-lactamase-producing Pseudomonas aeruginosa isolated from a large tertiary centre in Kenya J. D. D. Pitout 1,2,3, G. Revathi 4, B. L Chow 1, B.
More informationBeta-lactamase inhibition: A potted history of beta lactamase and lessons from recent development of betalactamase inhibiter combinations
Beta-lactamase inhibition: A potted history of beta lactamase and lessons from recent development of betalactamase inhibiter combinations Dr Shampa Das, Senior Lecturer, Molecular and Clinical Pharmacology,
More informationIdentification of plasmid- and integron-borne bla IMP-1 and bla IMP-10 in clinical isolates of Serratia marcescens
Journal of Medical Microbiology (2009), 58, 217 221 DOI 10.1099/jmm.0.006874-0 Identification of plasmid- and integron-borne bla IMP-1 and bla IMP-10 in clinical isolates of Serratia marcescens Zhuting
More informationOxacillinase-Mediated Resistance to Cefepime and Susceptibility to Ceftazidime in Pseudomonas aeruginosa
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, June 2001, p. 1615 1620 Vol. 45, No. 6 0066-4804/01/$04.00 0 DOI: 10.1128/AAC.45.6.1615 1620.2001 Copyright 2001, American Society for Microbiology. All Rights Reserved.
More informationJOHN DEMPSEY HOSPITAL Farmington, Connecticut ANTIBIOTIC SUSCEPTIBILITY PROFILES for INPATIENT Bacterial Isolates
JOHN DEMPSEY HOSPITAL Farmington, Connecticut 2017 ANTIBIOTIC SUSCEPTIBILITY PROFILES for INPATIENT Bacterial Isolates **GROUPED BY CULTURE SOURCES** (data from 1/1/17 1/1/18) Prepared by: UCHC/JDH Antimicrobial
More informationThe biomérieux solution. VITEK2 : A challenge with ESBL ESBL. Karen Bush
International Newsletter n 4 December 2003 Through the IDENTIFYING RESISTANCE Newsletter, biomérieux s ambition is to contribute to the awareness and progress in the field of resistance to antibiotics.
More informationSUMMARY. Key words: antibioticresistance, Enterobacteriaceae, ESBL, CTX-M,
SUMMARY Key words: antibioticresistance, Enterobacteriaceae, ESBL, CTX-M, The doctoral thesis entitled Prevalence of Enterobacteriaceae producing extendedspectrum beta-lactamases (ESBL) isolated from broilers
More informationGenetic and Biochemical Characterization of the First Extended-Spectrum CARB-Type ß-Lactamase, RTG-4, from Acinetobacter baumannii
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, July 2009, p. 3010 3016 Vol. 53, No. 7 0066-4804/09/$08.00 0 doi:10.1128/aac.01164-08 Copyright 2009, American Society for Microbiology. All Rights Reserved. Genetic
More informationUse of Molecular Assays for Resistance Detection
Use of Molecular Assays for Resistance Detection Antimicrobial resistance and susceptibility are complex, and current in vitro methods have been developed to predict a microorganism s response to antibacterial
More informationIS1999 Increases Expression of the Extended-Spectrum -Lactamase VEB-1 in Pseudomonas aeruginosa
JOURNAL OF BACTERIOLOGY, Sept. 2003, p. 5314 5319 Vol. 185, No. 17 0021-9193/03/$08.00 0 DOI: 10.1128/JB.185.17.5314 5319.2003 Copyright 2003, American Society for Microbiology. All Rights Reserved. IS1999
More informationThe Laboratory Diagnosis of Enterobacteriaceae that produce Carbapenemases. and Johann DD Pitout 1-3
JCM Accepts, published online ahead of print on 19 September 2012 J. Clin. Microbiol. doi:10.1128/jcm.02117-12 Copyright 2012, American Society for Microbiology. All Rights Reserved. 1 The Laboratory Diagnosis
More informationEvaluation of tests to predict metallo- -lactamase in cystic fibrosis (CF) and non-(cf) Pseudomonas
Brazilian Journal of Microbiology 45, 3, 835-839 (2014) ISSN 1678-4405 Copyright 2014, Sociedade Brasileira de Microbiologia www.sbmicrobiologia.org.br Short Communication Evaluation of tests to predict
More informationMetallo-β-lactamase (MBL) project: From molecular biology to the development of an MBL-inhibitor
Metallo-β-lactamase (MBL) project: From molecular biology to the development of an MBL-inhibitor Indo-Norwegian Workshop on Antimicrobial Resistance Tromsø, Norway 26-27 th of September 2013 Ørjan Samuelsen
More informationTitle: Detection of carbapenemases in Enterobacteriaceae by a commercial multiplex PCR
JCM Accepts, published online ahead of print on 11 July 2012 J. Clin. Microbiol. doi:10.1128/jcm.00991-12 Copyright 2012, American Society for Microbiology. All Rights Reserved. 1 2 3 4 5 6 7 8 9 10 11
More informationCRE Laboratory Testing and CRE Lab Testing Recommendations in-depth recommendations on CRE laboratory detection
December 2014 Dear Laboratory Director, The Illinois Department of Public Health (IDPH) amended the Control of Communicable Diseases Code (77 Ill. Adm. Code 690) to require reporting of Carbapenem-Resistant
More informationSequences of -Lactamase Genes Encoding CTX-M-1 (MEN-1) and CTX-M-2 and Relationship of Their Amino Acid Sequences with Those of Other -Lactamases
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Feb. 1996, p. 509 513 Vol. 40, No. 2 0066-4804/96/$04.00 0 Copyright 1996, American Society for Microbiology Sequences of -Lactamase Genes Encoding CTX-M-1 (MEN-1)
More informationMolecular susceptibility testing
Molecular susceptibility testing Dr Andrew Ginn Supervising Scientist Antimicrobial Resistance Reference Laboratory ICPMR, Westmead Hospital Resistance genes Gram negatives Transmissible; e.g. ESBLs, MBLs,
More informationCombatting AMR: diagnostics
Combatting AMR: diagnostics Professor Neil Woodford Antimicrobial Resistance & Healthcare Associated Infections (AMRHAI) Reference Unit Crown copyright Gonorrhoea: a paradigm for better diagnostics International
More informationACCEPTED. Laboratory Medicine, Kosin University College of Medicine, , 34 Amnam-Dong,
AAC Accepts, published online ahead of print on 21 May 2007 Antimicrob. Agents Chemother. doi:10.1128/aac.00279-07 Copyright 2007, American Society for Microbiology and/or the Listed Authors/Institutions.
More information*Kotgire Santosh A and Tankhiwale Nilima. Sciences University Sawangi(M) Wardha, Maharashtra, India *Author for Correspondence
PREVALENCE AND ANTIMICROBIAL SUSCEPTIBILITY PROFILE OF METALLO-β-LACTAMASES (M-β-L) PRODUCING PSEUDOMONAS AREUGINOSA FROM RURAL HOSPITAL: COMPARISON OF TWO DISK DIFFUSION METHODS *Kotgire Santosh A and
More informationEzy MIC Strip FEATURES AND ADVANTAGES
Imipenem with & without EDTA Ezy MIC Strips (IPM+EDTA/IPM) (Imipenem + EDTA: 1-64 mcg/ml) (Imipenem : 4-256 mcg/ml) Antimicrobial Susceptibility Testing For In Vitro Diagnostic use EM078 Not for Medicinal
More informationDetection and characterization of extended spectrum β-lactamase producing Escherichia coli from poultry of eastern India
Detection and characterization of extended spectrum β-lactamase producing Escherichia coli from poultry of eastern India Dr. Samiran Bandyopadhyay Scientist Indian Veterinary Research Institute Eastern
More informationScreening for Resistant Organisms and Infection Control
Screening for Resistant Organisms and Infection Control Dr Sonal Saxena Professor Department of Microbiology Lady Hardinge Medical College New Delhi 1 MDRO The proportion of K. pneumoniae and E. coli with
More informationA Comparison of Four Chromogenic Culture Media for. Carbapenemase-producing Enterobacteriaceae.
JCM Accepts, published online ahead of print on 3 July 2012 J. Clin. Microbiol. doi:10.1128/jcm.01613-12 Copyright 2012, American Society for Microbiology. All Rights Reserved. 1 2 A Comparison of Four
More informationCarbapenemase genes and genetic platforms in Gram-negative bacilli: Enterobacteriaceae, Pseudomonas and Acinetobacter species
REVIEW 10.1111/1469-0691.12655 Carbapenemase genes and genetic platforms in Gram-negative bacilli: Enterobacteriaceae, Pseudomonas and Acinetobacter species S. M. Diene and J.-M. Rolain Aix-Marseille Universite,
More informationApplication Note INTRODUCTION
Application Note 20 A microtiter-based assay for the determination of ID 50 s of β-lactamase inhibitors employing reporter substrates detected at UV or visible wavelengths INTRODUCTION β-lactamases are
More informationACCEPTED. Genetics and expression of the carbapenem-hydrolyzing. and Patrice Nordmann 1. Virologie, Hygiène Hospitalière, CHU, Nantes 2, France
AAC Accepts, published online ahead of print on 12 January 2007 Antimicrob. Agents Chemother. doi:10.1128/aac.01132-06 Copyright 2007, American Society for Microbiology and/or the Listed Authors/Institutions.
More informationAccurate and Timely Identification of Genes Conferring Resistance to Carbapenems Serves as an Important Tool for Infection Control Measures
International Journal of Current Microbiology and Applied Sciences ISSN: 2319-7706 Volume 7 Number 05 (2018) Journal homepage: http://www.ijcmas.com Original Research Article https://doi.org/10.20546/ijcmas.2018.705.296
More informationOXA-type beta-lactamases among extended-spectrum cephalosporin-resistant Pseudomonas aeruginosa isolates in a university hospital in southern Taiwan
OXA-type J Microbiol ESBLs Immunol in P. Infect aeruginosa 2006;39:130-134 OXA-type beta-lactamases among extended-spectrum cephalosporin-resistant Pseudomonas aeruginosa isolates in a university hospital
More informationgenerated by the usage of antimicrobial drugs is absent. She is the author of 14 publications in international journals.
Fernando Baquero Doctor in Medicine, Ramón y Cajal Research Professor in Bacterial Evolution at the Biomedical Research Foundation and Department of Microbiology of the Ramón y Cajal Universty Hospital.
More informationOXA-18, a Class D Clavulanic Acid-Inhibited Extended-Spectrum -Lactamase from Pseudomonas aeruginosa
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Oct. 1997, p. 2188 2195 Vol. 41, No. 10 0066-4804/97/$04.00 0 Copyright 1997, American Society for Microbiology OXA-18, a Class D Clavulanic Acid-Inhibited Extended-Spectrum
More informationCharacterization of a novel metallo-β-lactamase variant, GIM-2, from a clinical isolate
AAC Accepts, published online ahead of print on 29 December 2014 Antimicrob. Agents Chemother. doi:10.1128/aac.05062-14 Copyright 2014, American Society for Microbiology. All Rights Reserved. 1 2 Characterization
More informationCME/SAM. Clinical Laboratory Detection of AmpC β-lactamase Does It Affect Patient Outcome?
Microbiology and Infectious Disease / Laboratory Detection of AmpC β-lactamase Clinical Laboratory Detection of AmpC β-lactamase Does It Affect Patient Outcome? Kenneth H. Rand, MD, 1 Bradley Turner, MD,
More informationMetallo- -Lactamases: the Quiet before the Storm?
CLINICAL MICROBIOLOGY REVIEWS, Apr. 2005, p. 306 325 Vol. 18, No. 2 0893-8512/05/$08.00 0 doi:10.1128/cmr.18.2.306 325.2005 Copyright 2005, American Society for Microbiology. All Rights Reserved. Metallo-
More informationOriginal Research article Prevalence of Metallo-betalactamases (MBL) producing Pseudomonas aeruginosa in a Tertiary care Hospital.
Original Research article Prevalence of Metallo-betalactamases (MBL) producing Pseudomonas aeruginosa in a Tertiary care Hospital. Dr Anil Rajput*, Dr Bhavin Prajapati **, Dr.Bimal Chauhan***, Dr Atit
More informationJ Med Bacteriol. Vol. 2, No. 3, 4 (2013): pp jmb.tums.ac.ir
J Med Bacteriol. Vol. 2, No. 3, 4 (2013): pp. 11-16 jmb.tums.ac.ir ISMB TUMS Frequency of IMP-1 and VIM Genes among Metallo-beta- Lactamase Producing Acinetobacter spp. Isolated from Health Care Associated
More informationImipenem-susceptible, meropenem-resistant Klebsiella pneumoniae producing
AAC Accepts, published online ahead of print on 15 December 2014 Antimicrob. Agents Chemother. doi:10.1128/aac.04330-14 Copyright 2014, American Society for Microbiology. All Rights Reserved. 1 Imipenem-susceptible,
More informationPrevalence and molecular characterization of clinical isolates of Escherichia coli expressing an AmpC phenotype
J Antimicrob Chemother 2010; 65: 460 464 doi:10.1093/jac/dkp484 Advance publication 22 January 2010 Prevalence and molecular characterization of clinical isolates of Escherichia coli expressing an AmpC
More informationAbstract. Introduction
ORIGINAL ARTICLE BACTERIOLOGY A sensitive and specific phenotypic assay for detection of metallo-blactamases and KPC in Klebsiella pneumoniae with the use of meropenem disks supplemented with aminophenylboronic
More informationOXA-198, an Acquired Carbapenem-Hydrolyzing Class D -Lactamase from Pseudomonas aeruginosa
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Oct. 2011, p. 4828 4833 Vol. 55, No. 10 0066-4804/11/$12.00 doi:10.1128/aac.00522-11 Copyright 2011, American Society for Microbiology. All Rights Reserved. OXA-198,
More informationCurriculum Vitae. Abbas Maleki, Ph.D. Clinical Microbiology Research Center, Ilam University of Medical Sciences, Ilam, Iran
Curriculum Vitae Abbas Maleki, Ph.D Clinical Microbiology Research Center, Ilam University of Medical Sciences, Ilam, Iran E-mail: abbasmaleki_ilam@yahoo.com maleki-a@medilam.ac.ir Tel: +989187419401 Personal
More informationThe Prevalence of TEM-1 gene causing resistance to beta-lactam antibiotics in Klebsiella pneumoniae isolates from clinical samples and plasmid curing
Available online at www.ijmrhs.com ISSN No: 2319-5886 International Journal of Medical Research & Health Sciences, 2016, 5, 11:557-561 The Prevalence of TEM-1 gene causing resistance to beta-lactam antibiotics
More informationBiochemical Characterization of the POM-1 Metallo-β-Lactamase from. Pseudomonas otitidis
AAC Accepts, published online ahead of print on 15 December 2014 Antimicrob. Agents Chemother. doi:10.1128/aac.03843-14 Copyright 2014, American Society for Microbiology. All Rights Reserved. 1 2 3 4 5
More informationDetection and molecular characterization of extended spectrum of beta lactamase (ESBL) producing Escherichia coli
ISSN: 2319-7706 Volume 2 Number 8 (2013) pp. 196-205 http://www.ijcmas.com Original Research Article Detection and molecular characterization of extended spectrum of beta lactamase (ESBL) producing Escherichia
More informationMutagenesis for Studying Gene Function Spring, 2007 Guangyi Wang, Ph.D. POST103B
Mutagenesis for Studying Gene Function Spring, 2007 Guangyi Wang, Ph.D. POST103B guangyi@hawaii.edu http://www.soest.hawaii.edu/marinefungi/ocn403webpage.htm Overview of Last Lecture DNA microarray hybridization
More informationNEXT STEP TO STOP THE SPREAD OF ANTIMICROBIAL RESISTANCE. Patricia Ruiz Garbajosa Servicio de Microbiología Hospital Universitario Ramón y Cajal
NEXT STEP TO STOP THE SPREAD OF ANTIMICROBIAL RESISTANCE Patricia Ruiz Garbajosa Servicio de Microbiología Hospital Universitario Ramón y Cajal ANTIMICROBIAL RESISTANCE AND HEALTHCARE-ASSOCIATED INFECTION
More informationReceived 10 June 2009/Returned for modification 7 August 2009/Accepted 10 September 2009
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Dec. 2009, p. 5046 5054 Vol. 53, No. 12 0066-4804/09/$12.00 doi:10.1128/aac.00774-09 Copyright 2009, American Society for Microbiology. All Rights Reserved. Characterization
More informationTitle: Description of the First Escherichia coli Clinical Isolate Harboring Colistin-
AAC Accepted Manuscript Posted Online 24 October 2016 Antimicrob. Agents Chemother. doi:10.1128/aac.01945-16 Copyright 2016, American Society for Microbiology. All Rights Reserved. 1 2 Title: Description
More informationReceived 19 May 2000/Returned for modification 24 August 2000/Accepted 17 November 2000
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Feb. 2001, p. 546 552 Vol. 45, No. 2 0066-4804/01/$04.00 0 DOI: 10.1128/AAC.45.2.546 552.2001 Copyright 2001, American Society for Microbiology. All Rights Reserved.
More informationCarbapenem-resistant Enterobacteriaceae (CRE): Surveillance and Response. David Selvage, MHS, PA-C New Mexico Department of Health March 15, 2016
Carbapenem-resistant Enterobacteriaceae (CRE): Surveillance and Response David Selvage, MHS, PA-C New Mexico Department of Health March 15, 2016 What are Carbapenem-resistant Enterobacteriaceae (CRE)?
More informationMultidrug-Resistant Organisms: Where Are We with Detection and Reporting in 2015?
Analysis. Answers. Action. www.aphl.org Multidrug-Resistant Organisms: Where Are We with Detection and Reporting in 2015? Audrey N. Schuetz, MD, MPH 1 Faculty Disclosure The Association of Public Health
More informationReceived 16 September 2005/Accepted 20 September 2005
JOURNAL OF CLINICAL MICROBIOLOGY, Dec. 2005, p. 5945 5949 Vol. 43, No. 12 0095-1137/05/$08.00 0 doi:10.1128/jcm.43.12.5945 5949.2005 Copyright 2005, American Society for Microbiology. All Rights Reserved.
More informationACCEPTED. Extended-spectrum ß-lactamases of the CTX-M type now in. Switzerland
AAC Accepts, published online ahead of print on 0 April 00 Antimicrob. Agents Chemother. doi:./aac.0-0 Copyright 00, American Society for Microbiology and/or the Listed Authors/Institutions. All Rights
More informationEvaluation of the Osiris Expert System for Identification of -Lactam Phenotypes in Isolates of Pseudomonas aeruginosa
JOURNAL OF CLINICAL MICROBIOLOGY, Aug. 2003, p. 3712 3718 Vol. 41, No. 8 0095-1137/03/$08.00 0 DOI: 10.1128/JCM.41.8.3712 3718.2003 Copyright 2003, American Society for Microbiology. All Rights Reserved.
More informationAntibiotic Susceptibility Testing (ABST/AST)
Antibiotic Susceptibility Testing (ABST/AST) Goal Offer guidance to physicians in selecting effective antibacterial therapy for a pathogen in a specific body site. Performed on bacteria isolated from clinical
More informationSupplementary Information for
Supplementary Information for Direct, rapid antimicrobial susceptibility test from positive blood cultures based on microscopic imaging analysis J. Choi 1, H. Y. Jeong 2,3, G. Y. Lee 2,4, S. Han 1, S.
More informationIMP-Producing Carbapenem-Resistant Klebsiella pneumoniae in the United States
JOURNAL OF CLINICAL ROBIOLOGY, Dec. 2011, p. 4239 4245 Vol. 49, No. 12 0095-1137/11/$12.00 doi:10.1128/jcm.05297-11 Copyright 2011, American Society for Microbiology. All Rights Reserved. IMP-Producing
More informationPhenotypic and Genotypic Detection of Metallo-Beta-Lactamases among Imipenem Resistant Gram Negative Isolates
Phenotypic and Genotypic Detection of Metallo-Beta-Lactamases among Imipenem Resistant Gram Negative Isolates Mohammad Mohammadzadeh 1*, Mahnaz Tavakoli 1, Abolfazl Mohebi 2, Samad Aghayi 2 1 Department
More informationMolecular and Biochemical Characterization of OXA-45, an Extended-Spectrum Class 2d -Lactamase in Pseudomonas aeruginosa
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Sept. 2003, p. 2859 2863 Vol. 47, No. 9 0066-4804/03/$08.00 0 DOI: 10.1128/AAC.47.9.2859 2863.2003 Copyright 2003, American Society for Microbiology. All Rights Reserved.
More informationCARBAPENEM-RESISTANT ENTEROBACTERIACEAE (CRE) LABORATORY CAPACITY SURVEY. Summary Data Report
CARBAPENEM-RESISTANT ENTEROBACTERIACEAE (CRE) LABORATORY CAPACITY SURVEY June 2015 Introduction The rise of antimicrobial-resistant organisms represents a serious threat to public health. In 2013, CDC
More informationESBLs and KPCs: Impact of Revised CLSI Breakpoints on testing and Reporting Algorithms
ESBLs and KPCs: Impact of Revised CLSI Breakpoints on testing and Reporting Algorithms Stephen G. Jenkins, Ph.D. Director, Clinical Microbiology Laboratories New York/Presbyterian Hospital Weill Cornell
More informationOccurrence and Detection of AmpC β-lactamases among Enterobacteriaceae in a Tertiary Care Centre in Trivandrum, India
International Journal of Current Microbiology and Applied Sciences ISSN: 2319-7706 Volume 7 Number 08 (2018) Journal homepage: http://www.ijcmas.com Original Research Article https://doi.org/10.20546/ijcmas.2018.708.023
More informationChromosome-Encoded Extended-Spectrum Class A β-lactamase MIN-1. from Minibacterium massiliensis
AAC Accepts, published online ahead of print on 23 April 2012 Antimicrob. Agents Chemother. doi:10.1128/aac.06401-11 Copyright 2012, American Society for Microbiology. All Rights Reserved. 1 2 Chromosome-Encoded
More informationRuning title: identification of a new carbapenem-hydrolyzing class D β-lactamase
AAC Accepts, published online ahead of print on 25 July 2011 Antimicrob. Agents Chemother. doi:10.1128/aac.00522-11 Copyright 2011, American Society for Microbiology and/or the Listed Authors/Institutions.
More informationEMERGENCE OF NDM-1-PRODUCING ESCHERICHIA COLI IN THE SHANDONG PROVINCE OF CHINA
Acta Medica Mediterranea, 2018, 34: 457 EMERGENCE OF NDM-1-PRODUCING ESCHERICHIA COLI IN THE SHANDONG PROVINCE OF CHINA MAO-LI YI 1, JIANG-DONG DU 1, LI-HUA JIANG 1, QIAN LI 1, JING-YING WU 1, CHENG-MING
More informationTitle: Isolation of VIM-2-producing Pseudomonas monteilii clinical strains Disseminated in a Tertiary Hospital in Northern Spain.
AAC Accepts, published online ahead of print on 24 November 2014 Antimicrob. Agents Chemother. doi:10.1128/aac.04639-14 Copyright 2014, American Society for Microbiology. All Rights Reserved. 1 2 Title:
More informationantibiotic resistance blakpc
Techne qpcr test antibiotic resistance blakpc Carbepenem-hydrolyzing beta-lactamase KPC-1 (blakpc) gene 150 tests For general laboratory and research use only 1 Introduction to antibiotic resistance blakpc
More informationSME-Type Carbapenem-Hydrolyzing Class A -Lactamases from Geographically Diverse Serratia marcescens Strains
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Nov. 2000, p. 3035 3039 Vol. 44, No. 11 0066-4804/00/$04.00 0 Copyright 2000, American Society for Microbiology. All Rights Reserved. SME-Type Carbapenem-Hydrolyzing
More informationReceived 5 June 2010/Returned for modification 27 June 2010/Accepted 6 August 2010
ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, Nov. 2010, p. 4575 4581 Vol. 54, No. 11 0066-4804/10/$12.00 doi:10.1128/aac.00764-10 Copyright 2010, American Society for Microbiology. All Rights Reserved. Emergence
More informationInvestigational New Drug - Groundwork for in vitro antimicrobial susceptibility testing
Investigational New Drug - Groundwork for in vitro antimicrobial susceptibility testing Erika Matuschek, Ph D Lead Scientist/Operational Manager EUCAST Development Laboratory (EDL) Växjö, Sweden ASM/ESCMID
More informationEvaluation of the Carba NP Test for the Detection of Carbapenemase Activity in Bacteroides Species
Polish Journal of Microbiology 2018, Vol. 67, No 1, 97 101 SHORT COMMUNICATION Evaluation of the Carba NP Test for the Detection of Carbapenemase Activity in Bacteroides Species ISIN AKYAR 1, 2, *, MELTEM
More informationThe GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity
Promega Notes Magazine Number 62, 1997, p. 02 The GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity By Christine Andrews and Scott Lesley Promega
More informationSupplementary appendix
Supplementary appendix This appendix formed part of the original submission and has been peer reviewed. We post it as supplied by the authors. Supplement to: Quan J, Li X, Chen Y, et al. Prevalence of
More informationJournal of Experimental Microbiology and Immunology (JEMI) Vol. 6:20-25 Copyright December 2004, M&I UBC
Preparing Plasmid Constructs to Investigate the Characteristics of Thiol Reductase and Flavin Reductase With Regard to Solubilizing Insoluble Proteinase Inhibitor 2 in Bacterial Protein Overexpression
More information