Engineering D66N mutant using quick change site directed mutagenesis. Harkewal Singh 09/01/2010
|
|
- Rafe Walters
- 6 years ago
- Views:
Transcription
1 Engineering D66N mutant using quick change site directed mutagenesis Harkewal Singh 09/01/2010 1
2 1- What is quick change site directed mutagenesis? 2- An overview of the kit contents. 3- A brief information on the working conditions. 4- A general outline of the process. 5- Troubleshooting. 6- Examples from D66N mutation. 2
3 Quick change site directed mutagenesis is the process of introducing a site specific* mutation into double stranded plasmid. does not require any specialized vectors, unique restriction sites, or multiple transformation. site specific* D66N mutation [ V V A D L D E T ]- - [ V V A D L N E T ]- 3
4 Overview of the kit contents 1-10x reaction buffer - This is for the maximum/optimal activity of Pfu DNA polymerase. Contains ~ 25mM MgCl2,Triton X-100,100 mm Tris-HCl, 500mM KCl, ph Pfu Turbo DNA polymerase - It is a thermostable enzyme isolated from Pyrococcus furiosus. It catalyzes the plolymerization of nucleotides into double stranded DNA in the 5-3 direction. 3- Dpn1 restriction enzyme - recognizes methylated DNA bases. 4- dntp mix - deoxy ribose nucleotide triphosphate(dntp) 5- XL10 - Gold Ultracompetent cells 4
5 Overview of the working conditions 1- Thaw dntp only once, so prepare single use aliquots and store them at -20 C. 2- Thawing MUST be done at ice in case you have more than single use aliquots. 3- All the procedures which involve kit contents MUST be done on ice. 4-Take Pfu DNA polymerase LAST out of the kit and put it back as soon as you are done. 5- Water must be autoclaved and free of any debris or fungal/bacterial contaminants. 6- Use sterile tips for pipetting out any of the kit contents. 7- Always freeze XL10-Gold cells at -80 C. 8- Finally, use thin walled autoclaved PCR tubes for the experiment. 5
6 General outline of the procedure 6
7 7
8 Troubleshooting 1- Low transformation efficiency or low colony number - Make sure that DNA template is of good quality by running on a gel. Also check the quantity by measuring the concentration of your template DNA. 2- No colonies at all - Do an ethanol precipitation* of your PCR product and re-transform using XL10- Gold ultracompetent cells. 3- Low mutagenesis efficiency could be due the insufficient digest of parental DNA with dpn1 so increase the digest time from 1 hour to little longer e.g hours at 37 C. 4- Also AVOID multiple freeze thaw cycles of dntp mix, this could lead to low mutagenesis efficiency. 5- False positives - meaning you have great colonies but no mutants. Make sure your primers are correct. or wrong extension temperature. 8
9 Ethanol Precipitation 1. Add 1/10 volume of Sodium Acetate (3 M, ph 5.2). 2. Add times volume of 95% ethanol. 3. Incubate at either -20 C or -80 C overnight. 4. Centrifuge at > 14,000 x g for minutes at 4 C. 5. Discard supernatant being careful not to throw out DNA pellet which may or may not be visible. 6. Rinse with 70% Ethanol. 7. Centrifuge again for minutes at > 14,000 x g. 8. Discard supernatant and dissolve pellet in 10mM Tris ph Now you can use this DNA (~5ul) and retransform using XL10 Gold ultracompetent cells. 9
10 Engineering D66N mutant of P4 enzyme Requirements 1- Template DNA( wild type plasmid cloned into pet20b using nco1/xho1 restriction site. ~ 100 ng/ul ) 2- Primers (forward and reverse ) in this case D66N forward* and D66N reverse*. (make the concentration ~ 500 ng/ul) 3-10 X reaction buffer as supplied with the kit.(thaw on ICE) 4- dntp (thaw on ICE). 5- QuickSolution reagent. 6- Autoclaved Water. 7- Autoclaved thin walled tubes. 8- Autoclaved pipette tips 9 - Pfu DNA polymerase as supplied with the kit(at last) 10
11 Primer design guidelines 1- Both primers MUST have the same mutation. 2- Primers length should be between bases. 3- Tm should be 75 C or greater. 4- The desired mutation should be in the middle of the primer. 5- In general its good to have the GC content of a primer around %. 6- The primer should end in G or C. 7- Calculate Tm of the primer using either some webserver or this formula N - primer length % mismatch - change in the base used to make mutation. 8- Finally, make up your primer volume by adding either autoclaved10mm Tris ph 8.0 or autoclaved water, the former is recommended. 11
12 Wild type sequence Asp Leu Asp 5 GCG GTT GTG GCT GAT TTA GAT GAA ACT ATG TTA GAC AAC 3 Forward primer design Asp Leu Asn 5 GCG GTT GTG GCT GAT TTA AAT GAA ACT ATG TTA GAC AAC 3 fwd Reverse primer design Complement of sense strand 3 CGC CAA CAC CGA CTA AAT TTA CTT TGA TAC AAT CTG TTG 5 Final reverse primer 5 GTT GTC TAA CAT AGT TTC ATT TAA ATC AGC CAC AAC CGC 3 rev 12
13 wild type sequence CCA GTT GTA TTC ATG GAC ATT GAC GAA ACT GTG CTG CAG 13
14 wild type sequence CCA GTT GTA TTC ATG GAC ATT GAC GAA ACT GTG CTG CAG forward CCA GTT GTA TTC ATG GAC ATT AAC GAA ACT GTG CTG CAG 14
15 wild type sequence CCA GTT GTA TTC ATG GAC ATT GAC GAA ACT GTG CTG CAG forward CCA GTT GTA TTC ATG GAC ATT AAC GAA ACT GTG CTG CAG reverse CTG CAG CAC AGT TTC GTT AAT GTC CAT GAA TAC AAC TGG 15
16 PCR reaction setup for D66N mutation Component Volume 1 10 X reaction buffer 5 ul 2 DNA template (P4 wild type DNA) 0.25 ul or 10 ng 3 D66N forward primer 0.25 ul or 125 ng 4 D66N reverse primer 0.25 ul or 125 ng 5 dntp mix 1ul 6 QuickSolution reagent 3ul 7 Sterile water ul (mix well after this) 8 Pfu DNA polymerase 1ul(mix again) 9 Total 50 ul 16
17 Segment Cycles Temperature Time C 1 minute C 60 C 68 C 50 secs 50 secs 2 min/kb of plasmid length * C 7 minutes 4 4 C hold as little as possible * pet20b is ~ 5kb and P4 gene is ~ 1 kb so total length to amplify = ~6 kb hence I used 14 minutes for elongation time. Add 1ul dpn1 to the PCR tube when the reaction is complete, mix well, spin for two minutes at ~ rpm and incubate the PCR tube at 37 C between hours 17
18 1- Transform the PCR product (1-2 ul) in ul of XL10 Gold cells as usual. 2- Plate on LBagar supplemented with appropriate antibiotic. (Amp50 in my case) 3- Next day (Day 2), pick three - four single colonies and grow in LB broth supplemented with Amp50 or your AB. 4- Do plasmid prep and before submitting all your potential constructs for sequencing verify to check the success your PCR. 5- wild type P4 was cloned using nco1/xho1 into pet20b, so I digested the plasmids using nco1 and xho1 enzymes at 37 C and then ran % agarose gel. 6- The gel showed that I had a band around 1 Kb which suggest that the PCR was a success. 7- Now submit one or maximum two clones for DNA sequencing. 18
19 gene of interest 19
20 DNA sequencing result MAMGSHQMKSEEHANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAK VAKGKKKAVVADLNETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGA VEFNNYVNSHNGKVFYVTNRKDSTEKSGTIDDMKRLGFNGVEESAFYLKKDKSA KAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFI MLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGKLEHHHHHH 20
Add 5µl of 3N NaOH to DNA sample (final concentration 0.3N NaOH).
Bisulfite Treatment of DNA Dilute DNA sample to 2µg DNA in 50µl ddh 2 O. Add 5µl of 3N NaOH to DNA sample (final concentration 0.3N NaOH). Incubate in a 37ºC water bath for 30 minutes. To 55µl samples
More informationSupplement 1: Sequences of Capture Probes. Capture probes were /5AmMC6/CTG TAG GTG CGG GTG GAC GTA GTC
Supplementary Appendixes Supplement 1: Sequences of Capture Probes. Capture probes were /5AmMC6/CTG TAG GTG CGG GTG GAC GTA GTC ACG TAG CTC CGG CTG GA-3 for vimentin, /5AmMC6/TCC CTC GCG CGT GGC TTC CGC
More informationElectronic Supplementary Information
Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2017 Electronic Supplementary Information Dissecting binding of a β-barrel outer membrane
More informationTable S1. Bacterial strains (Related to Results and Experimental Procedures)
Table S1. Bacterial strains (Related to Results and Experimental Procedures) Strain number Relevant genotype Source or reference 1045 AB1157 Graham Walker (Donnelly and Walker, 1989) 2458 3084 (MG1655)
More informationSupplementary Information
Supplementary Information A general solution for opening double-stranded DNA for isothermal amplification Gangyi Chen, Juan Dong, Yi Yuan, Na Li, Xin Huang, Xin Cui* and Zhuo Tang* Supplementary Materials
More informationSupplemental Data. mir156-regulated SPL Transcription. Factors Define an Endogenous Flowering. Pathway in Arabidopsis thaliana
Cell, Volume 138 Supplemental Data mir156-regulated SPL Transcription Factors Define an Endogenous Flowering Pathway in Arabidopsis thaliana Jia-Wei Wang, Benjamin Czech, and Detlef Weigel Table S1. Interaction
More informationPolymerase Chain Reaction (PCR)
Laboratory for Environmental Pathogens Research Department of Environmental Sciences University of Toledo Polymerase Chain Reaction (PCR) Background information The polymerase chain reaction (PCR) is an
More informationMolecular Techniques Third-year Biology
PLANNING Genetics Lab practices Molecular Techniques. Genetics Lab practices protocol. 2015-16 PCR-DIRECTED MUTAGENESIS, MOLECULAR CLONING AND RESTRICTION ANALYSIS Sessions 1 & 2 (2x3 hours): PCR-directed
More informationstrain devoid of the aox1 gene [1]. Thus, the identification of AOX1 in the intracellular
Additional file 2 Identification of AOX1 in P. pastoris GS115 with a Mut s phenotype Results and Discussion The HBsAg producing strain was originally identified as a Mut s (methanol utilization slow) strain
More informationGateway Cloning Protocol (Clough Lab Edition) This document is a modification of the Gateway cloning protocol developed by Manju in Chris Taylor's lab
Gateway Cloning Protocol (Clough Lab Edition) This document is a modification of the Gateway cloning protocol developed by Manju in Chris Taylor's lab With the Gateway cloning system, a PCR fragment is
More informationSome types of Mutagenesis
Mutagenesis What Is a Mutation? Genetic information is encoded by the sequence of the nucleotide bases in DNA of the gene. The four nucleotides are: adenine (A), thymine (T), guanine (G), and cytosine
More informationSite-directed mutagenesis of proteins
IFM/Kemi Linköpings Universitet August 2013/LGM Labmanual Site-directed mutagenesis of proteins Figur 1: Flow-chart of the site-directed mutagenesis lab exercise 2 Site-specific mutagenesis Introduction
More informationKOD -Plus- Mutagenesis Kit
Instruction manual KOD -Plus- Mutagenesis Kit 0811 F0936K KOD -Plus- Mutagenesis Kit SMK-101 20 reactions Store at -20 C Contents [1] Introduction [2] Flow chart [3] Components [4] Notes [5] Protocol 1.
More informationSupplementary Information. Construction of Lasso Peptide Fusion Proteins
Supplementary Information Construction of Lasso Peptide Fusion Proteins Chuhan Zong 1, Mikhail O. Maksimov 2, A. James Link 2,3 * Departments of 1 Chemistry, 2 Chemical and Biological Engineering, and
More informationSAY IT WITH DNA: Protein Synthesis Activity by Larry Flammer
TEACHER S GUIDE SAY IT WITH DNA: Protein Synthesis Activity by Larry Flammer SYNOPSIS This activity uses the metaphor of decoding a secret message for the Protein Synthesis process. Students teach themselves
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/10/494/eaan6284/dc1 Supplementary Materials for Activation of master virulence regulator PhoP in acidic ph requires the Salmonella-specific protein UgtL Jeongjoon
More informationVector Linearization. igem TU/e 2015 Biomedical Engineering
igem TU/e 2015 Biomedical Engineering Eindhoven University of Technology Room: Ceres 0.04 Den Dolech 2, 5612 AZ Eindhoven The Netherlands Tel. no. +31 50 247 55 59 2015.igem.org/Team:TU_Eindhoven Vector
More informationLecture 11: Gene Prediction
Lecture 11: Gene Prediction Study Chapter 6.11-6.14 1 Gene: A sequence of nucleotides coding for protein Gene Prediction Problem: Determine the beginning and end positions of genes in a genome Where are
More informationG+C content. 1 Introduction. 2 Chromosomes Topology & Counts. 3 Genome size. 4 Replichores and gene orientation. 5 Chirochores.
1 Introduction 2 Chromosomes Topology & Counts 3 Genome size 4 Replichores and gene orientation 5 Chirochores 6 7 Codon usage 121 marc.bailly-bechet@univ-lyon1.fr Bacterial genome structures Introduction
More informationQuikChange Lightning Site-Directed Mutagenesis Kit
QuikChange Lightning Site-Directed Mutagenesis Kit INSTRUCTION MANUAL Catalog #210518 (10 reactions) and #210519 (30 reactions) Revision C For In Vitro Use Only 210518-12 LIMITED PRODUCT WARRANTY This
More informationSupporting Information. Trifluoroacetophenone-Linked Nucleotides and DNA for Studying of DNA-protein Interactions by 19 F NMR Spectroscopy
Supporting Information Trifluoroacetophenone-Linked Nucleotides and DNA for Studying of DNA-protein Interactions by 19 F NMR Spectroscopy Agata Olszewska, Radek Pohl and Michal Hocek # * Institute of Organic
More informationGuide-it Indel Identification Kit User Manual
Clontech Laboratories, Inc. Guide-it Indel Identification Kit User Manual Cat. No. 631444 (120114) Clontech Laboratories, Inc. A Takara Bio Company 1290 Terra Bella Avenue, Mountain View, CA 94043, USA
More informationSequence Design for DNA Computing
Sequence Design for DNA Computing 2004. 10. 16 Advanced AI Soo-Yong Shin and Byoung-Tak Zhang Biointelligence Laboratory DNA Hydrogen bonds Hybridization Watson-Crick Complement A single-stranded DNA molecule
More informationCat # Box1 Box2. DH5a Competent E. coli cells CCK-20 (20 rxns) 40 µl 40 µl 50 µl x 20 tubes. Choo-Choo Cloning TM Enzyme Mix
Molecular Cloning Laboratories User Manual Version 3.3 Product name: Choo-Choo Cloning Kits Cat #: CCK-10, CCK-20, CCK-096, CCK-384 Description: Choo-Choo Cloning is a highly efficient directional PCR
More informationIn-Fusion Advantage PCR Cloning Kit
User Manual In-Fusion Advantage PCR Cloning Kit User Manual United States/Canada 800.662.2566 Asia Pacific +1.650.919.7300 Europe +33.(0)1.3904.6880 Japan +81.(0)77.543.6116 Clontech Laboratories, Inc.
More informationCloning and Expression of a Haloacid Dehalogenase Enzyme. By: Skyler Van Senior Research Advisor: Dr. Anne Roberts
Cloning and Expression of a Haloacid Dehalogenase Enzyme By: Skyler Van Senior Research Advisor: Dr. Anne Roberts utline The gene being cloned is JHP1130 from Helicobacter pylori (H. pylori) JHP1130 is
More informationII 0.95 DM2 (RPP1) DM3 (At3g61540) b
Table S2. F 2 Segregation Ratios at 16 C, Related to Figure 2 Cross n c Phenotype Model e 2 Locus A Locus B Normal F 1 -like Enhanced d Uk-1/Uk-3 149 64 36 49 DM2 (RPP1) DM1 (SSI4) a Bla-1/Hh-0 F 3 111
More informationWet Lab Tutorial: Genelet Circuits
Wet Lab Tutorial: Genelet Circuits DNA 17 This tutorial will introduce the in vitro transcriptional circuits toolkit. The tutorial will focus on the design, synthesis, and experimental testing of a synthetic
More informationPCR Laboratory Exercise
PCR Laboratory Exercise Advance Protocol (updated 1/2018) Introduction Detection of TPA-25 Alu by PCR A Human DNA Fingerprinting Lab Protocol 1994 Cold Spring Harbor Laboratory DNA Learning Center In this
More informationFosmidMAX DNA Purification Kit
Cat. No. FMAX046 Connect with Epicentre on our blog (epicentral.blogspot.com), Facebook (facebook.com/epicentrebio), and Twitter (@EpicentreBio). www.epicentre.com Lit. # 204 10/2012 1 EPILIT204 Rev. A
More informationQuikChange Site-Directed Mutagenesis Kit
QuikChange Site-Directed Mutagenesis Kit Instruction Manual Catalog # 200518 (30 reactions) and 200519 (10 reactions) Revision C Research Use Only. Not for Use in Diagnostic Procedures. 200518-12 LIMITED
More informationBACMAX DNA Purification Kit
Cat. No. BMAX044 Connect with Epicentre on our blog (epicentral.blogspot.com), Facebook (facebook.com/epicentrebio), and Twitter (@EpicentreBio). www.epicentre.com Lit. # 212 10/2012 1 EPILIT212 Rev. A
More informationProtocol T45 Community Reference Laboratory for GM Food and Feed
EUROPEAN COMMISSION DIRECTORATE GENERAL JRC JOINT RESEARCH CENTRE INSTITUTE FOR HEALTH AND CONSUMER PROTECTION COMMUNITY REFERENCE LABORATORY FOR GM FOOD AND FEED Event-specific Method for the Quantification
More informationPRODUCT INFORMATION Long PCR Enzyme Mix #K0182 500 u Lot Exp. 00.0000 Store at -20 C. CERTIFICATE OF ANALYSIS Long PCR Enzyme Mix is functionally tested in PCR amplification of 47.4 kb fragment from lambda
More informationAmplified Analysis of DNA by the Autonomous Assembly of Polymers Consisting of DNAzyme Wires
Supporting information for the paper: Amplified Analysis of DNA by the Autonomous Assembly of Polymers Consisting of DNAzyme Wires Fuan Wang, Johann Elbaz, Ron Orbach, Nimrod Magen and Itamar Willner*
More informationManual: QuikChange Site-Directed Mutagenesis Kit
This is the html version of the file http://www.stratagene.com/manuals/200518.pdf. Google automatically generates html versions of documents as we crawl the web. Page 1 QuikChange Site-Directed Mutagenesis
More informationChapter 13 Chromatin Structure and its Effects on Transcription
Chapter 13 Chromatin Structure and its Effects on Transcription Students must be positive that they understand standard PCR. There is a resource on the web for this purpose. Warn them before this class.
More informationSearch for and Analysis of Single Nucleotide Polymorphisms (SNPs) in Rice (Oryza sativa, Oryza rufipogon) and Establishment of SNP Markers
DNA Research 9, 163 171 (2002) Search for and Analysis of Single Nucleotide Polymorphisms (SNPs) in Rice (Oryza sativa, Oryza rufipogon) and Establishment of SNP Markers Shinobu Nasu, Junko Suzuki, Rieko
More informationSupplemental Information. Target-Mediated Protection of Endogenous. MicroRNAs in C. elegans. Inventory of Supplementary Information
Developmental Cell, Volume 20 Supplemental Information Target-Mediated Protection of Endogenous MicroRNAs in C. elegans Saibal Chatterjee, Monika Fasler, Ingo Büssing, and Helge Großhans Inventory of Supplementary
More information1. COMPONENTS. PyroStart Fast PCR Master Mix (2X) (#K0211 for 250 reactions of 20µl) 2. STORAGE 3. DESCRIPTION
1 2 1 PyroStart Fast PCR Master Mix (2X) (#K0211 for 250 reactions of 20µl) TABLE OF CONTENTS 1. COMPONENTS... 2 2. STORAGE... 2 3. DESCRIPTION... 2 4. PROTOCOL FOR FAST PCR... 3 4.1. General Considerations...
More information2.5. Equipment and materials supplied by user Template preparation by cloning into plexsy_invitro-2 vector 4. 6.
Manual 15 Reactions LEXSY in vitro Translation Cell-free protein expression kit based on Leishmania tarentolae contains the vector plexsy_invitro-2 Cat. No. EGE-2002-15 FOR RESEARCH USE ONLY. NOT INTENDED
More informationGenomics and Gene Recognition Genes and Blue Genes
Genomics and Gene Recognition Genes and Blue Genes November 1, 2004 Prokaryotic Gene Structure prokaryotes are simplest free-living organisms studying prokaryotes can give us a sense what is the minimum
More informationDGGE FOR Symbiodinium
DGGE FOR Symbiodinium By Camila Granados Cifuentes, IMaGeS Lab (Modified from Dr. Todd LaJeunesse and Dr. Juan Armando Sanchez BIOMMAR ) This protocol explains the step by step process for running a DGGE
More informationCodon Bias with PRISM. 2IM24/25, Fall 2007
Codon Bias with PRISM 2IM24/25, Fall 2007 from RNA to protein mrna vs. trna aminoacid trna anticodon mrna codon codon-anticodon matching Watson-Crick base pairing A U and C G binding first two nucleotide
More informationDescription...1 Components...1 Storage... 1 Technical Information...1 Protocol...2 Examples using the kit...4 Troubleshooting...
QuickClean II Gel Extraction Kit Cat. No. L00418 Technical Manual No. TM0594 Version: 03042011 I II III IV V VI VII VIII Description......1 Components.....1 Storage.... 1 Technical Information....1 Protocol.....2
More informationPROTEIN SYNTHESIS Study Guide
PART A. Read the following: PROTEIN SYNTHESIS Study Guide Protein synthesis is the process used by the body to make proteins. The first step of protein synthesis is called Transcription. It occurs in the
More informationSupplemental Data. Lin28 Mediates the Terminal Uridylation. of let-7 Precursor MicroRNA. Molecular Cell, Volume 32
Molecular Cell, Volume 32 Supplemental Data Lin28 Mediates the Terminal Uridylation of let-7 Precursor MicroRNA Inha Heo, Chirlmin Joo, Jun Cho, Minju Ha, Jinju Han, and V. Narry Kim Figure S1. Endogenous
More informationMOLECULAR CLONING AND SEQUENCING OF FISH MPR 46
MOLECULAR CLONING AND SEQUENCING OF FISH MPR 46 INTRODUCTION The mammalian MPR 46 (human, mouse, bovine) sequences show extensive homologies. Among the non-mammalian vertebrates, only a partial sequence
More informationEvent-specific Method for the Quantification of Soybean Line A Using Real-time PCR. Protocol
Event-specific Method for the Quantification of Soybean Line A2704-12 Using Real-time PCR Protocol 14 May 2007 Directorate General-Joint Research Centre Institute for Health and Consumer Protection Biotechnology
More information2x PCR LongNova-RED PCR Master Mix
2x PCR LongNova-RED Components RP85L 100 reactions (50 μl) RP85L-10 1000 reactions (50 μl) 2x PCR LongNova-RED 2 x 1.25 ml 20 x 1.25 ml PCR grade water 2 x 1.5 ml 20 x 1.5 ml Storage & Shiing Storage conditions
More informationSexing Bovine Preimplantation Embryos by PCR
Sexing Bovine Preimplantation Embryos by PCR Katherine E.M. Hendricks 1, Leydson F. Martins 2, Justin M. Fear 1 and Peter J. Hansen 1 1 Dept. of Animal Sciences, University of Florida and Department of
More informationPlasmid Midiprep Plus Purification Kit. Cat. # : DP01MD-P10/ DP01MD-P50 Size : 10/50 Reactions Store at RT For research use only
Plasmid Midiprep Plus Purification Kit Cat. # : DP01MD-P10/ DP01MD-P50 Size : 10/50 Reactions Store at RT For research use only 1 Description: The Plasmid Midiprep Plus Purification Kit provides simple
More informationBacterial 16S rdna PCR Kit Fast (800)
Cat. # RR182A For Research Use Bacterial 16S rdna PCR Kit Fast (800) Product Manual Table of Contents I. Description... 3 II. Components... 3 III. Materials Required but not Provided... 4 IV. Storage...
More informationEngineering Escherichia coli for production of functionalized terpenoids using plant P450s
Supplementary Information for Engineering Escherichia coli for production of functionalized terpenoids using plant P450s Michelle C. Y. Chang, Rachel A. Eachus, William Trieu, Dae-Kyun Ro, and Jay D. Keasling*
More informationFungal rdna (D1/D2) PCR Kit Fast
Cat. # RR184A For Research Use Fungal rdna (D1/D2) PCR Kit Fast Product Manual Table of Contents I. Description... 3 II. Components... 3 III. Materials Required but not Provided... 4 IV. Storage... 4 V.
More informationTable of contents. I. Flowchart of blunt end cloning of PCR products...2. II. Description...3. III. Kit Components...3
Table of contents I. Flowchart of blunt end cloning of PCR products...2 II. Description...3 III. Kit Components...3 IV. Reagents and Instruments Required...3 V. Storage...3 VI. About puc118 Hinc II/BAP...4
More informationPurification and Characterization of a DNA Plasmid Part A CHEM 4581: Biochemistry Laboratory I Version: January 18, 2008
Purification and Characterization of a DNA Plasmid Part A CHEM 4581: Biochemistry Laboratory I Version: January 18, 2008 INTRODUCTION DNA Plasmids. A plasmid is a small double-stranded, circular DNA molecule
More informationBasic Protocol (v. 2.0, May, 2003)
Basic Protocol (v. 2.0, May, 2003) Preparation of RNA:DNA Handles For the two handles (called A and B), you will need the following oligos: Product 1 : Name=B_reverse : Synthesis=1 umole : Purification=HPLC
More informationSupplemental Data. Distinct Pathways for snorna and mrna Termination
Molecular Cell, Volume 24 Supplemental Data Distinct Pathways for snorna and mrna Termination Minkyu Kim, Lidia Vasiljeva, Oliver J. Rando, Alexander Zhelkovsky, Claire Moore, and Stephen Buratowski A
More informationInterpretation of sequence results
Interpretation of sequence results An overview on DNA sequencing: DNA sequencing involves the determination of the sequence of nucleotides in a sample of DNA. It use a modified PCR reaction where both
More informationNote: for laboratory research use only. RNA High-purity Total RNA Rapid Extraction Kit (Spin-column) Signalway Biotechnology
Note: for laboratory research use only RNA High-purity Total RNA Rapid Extraction Kit (Spin-column) Cat. #: RP1202 (50preps) Signalway Biotechnology I. Kit Content, Storage Condition and Stability Content
More informationDuraScribe T7 Transcription Kit
DuraScribe T7 Transcription Kit Cat. Nos. DS010910 and DS010925 Available exclusively thru Lucigen. lucigen.com/epibio www.lucigen.com MA170E DuraScribe T7 Transcription Kit 7/2017 1 1. Introduction The
More informationLaboratory #7 PCR PCR
1 Laboratory #7 Polymerase chain reaction () is DNA replication in a test tube. In vitro enzymatic amplification of a specific segment of DNA. Many Applications. direct cloning from DNA or cdna. Mutagenesis
More informationQuant One Step RT-PCR Kit
1. Quant One Step RT-PCR Kit For fast and sensitive one-step RT-PCR www.tiangen.com/en RT121221 Quant One Step RT-PCR Kit Kit Contents Cat. no. KR113 Contents Hotmaster Taq Polymerase (2.5 U/μl) Quant
More informationConversion of plasmids into Gateway compatible cloning
Conversion of plasmids into Gateway compatible cloning Rafael Martinez 14072011 Overview: 1. Select the right Gateway cassette (A, B or C). 2. Design primers to amplify the right Gateway cassette from
More informationLow cost and non-toxic genomic DNA extraction for use in molecular marker studies.
Low cost and non-toxic genomic DNA extraction for use in molecular marker studies. Version 1.4, February 28 th, 2013. Prepared by Bernhard Hofinger, Owen Huynh and Brad Till. 1. OBJECTIVE To develop and
More informationReviewed: Davis, Oseroff
Microarray Core UCSF Comprehensive Cancer Center Standard Operating Procedure Title: Preparation of Spotting Solutions from BAC DNA SOP No.: MC010 Version: 1 Date: 11-04-03 Page No.: 1 of 14 Authors: Albertson,
More informationQIAfilter Plasmid Midi Kit (Cat #: 12243)
QIAfilter Plasmid Midi Kit (Cat #: 12243) Things to do before starting Add the provided RNase A solution to Buffer P1 before use. Use one vial of RNase A (centrifuge briefly before use) per bottle of Buffer
More informationGuidelines for Preventing Contamination of PCR Reference Guidelines for Primer Design Estimation of Primer Melting Temperature
Guidelines for Preventing Contamination of PCR During PCR more than 10 million copies of a template DNA are generated. Therefore, care must be taken to avoid contamination with other templates and amplicons
More information3'-Full RACE Core Set
Table of Contents Description... 2 Principle... 4 Preparation of RNA Sample... 5 Note... 5 Protocol 1. General Protocol... 6 2. Application example... 8 Also available from Takara PCR related products
More informationTaKaRa PCR Amplification Kit
Cat. # R011 For Research Use TaKaRa PCR Amplification Kit Product Manual Table of Contents I. Description... 3 II. Components... 3 III. Storage... 4 IV. Materials Required but not Provided... 4 V. Principle...
More informationLezione 10. Bioinformatica. Mauro Ceccanti e Alberto Paoluzzi
Lezione 10 Bioinformatica Mauro Ceccanti e Alberto Paoluzzi Dip. Informatica e Automazione Università Roma Tre Dip. Medicina Clinica Università La Sapienza Lezione 10: Sintesi proteica Synthesis of proteins
More informationReadyAmp Genomic DNA Purification System INSTRUCTIONS FOR USE OF PRODUCTS A7710.
Technical Bulletin ReadyAmp Genomic DNA Purification System INSTRUCTIONS FOR USE OF PRODUCTS A7710. PRINTED IN USA. Revised 4/11 ReadyAmp Genomic DNA Purification System All technical literature is available
More informationVDL100.2 CLONING TRANSGENE INTO padenox
1. Purpose 1.1. The purpose of this protocol is to transfer a transgene from the pshuttlex plasmid to padenox. 1.2. The starting material is 10 μg plasmid DNA. 1.3. This procedure is routinely performed
More informationTaKaRa LA PCR Kit Ver. 2.1
Cat. # RR013A For Research Use TaKaRa LA PCR Kit Ver. 2.1 Product Manual Table of Contents I. Description... 3 II. Components... 3 III. Materials Required but not Provided... 4 IV. Storage... 5 V. Protocol
More informationGeNei TM Transformation Teaching Kit Manual
Teaching Kit Manual Cat No. New Cat No. KT07 107385 KT07A 106220 Revision No.: 00060505 CONTENTS Page No. Objective 3 Principle 3 Kit Description 6 Materials Provided 7 Procedure 9 Observation & Interpretation
More informationSupplementary Material and Methods
Supplementary Material and Methods Synaptosomes preparation and RT-PCR analysis. Synaptoneurosome fractions were prepared as previously described in 1. Briefly, rat total brain was homogenized in ice-cold
More informationMgCl 2 (25 mm) 1.6 ml 1.6 ml 1.6 ml 1.6 ml
Technical Data Sheet KAPA2G Fast PCR Kit Kit components KK 5008 Product codes KK 5010 KK 5009 KK 5011 KAPA2G Fast DNA polymerase (5 U/μl) 100 U 100 U 250 U 250 U 1. Production Description The KAPA2G Fast
More informationFor in vitro Veterinary Diagnostics only. DNA Extraction and PCR Detection Kit for Pasteurella multocida.
For in vitro Veterinary Diagnostics only. DNA Extraction and PCR Detection Kit for Pasteurella multocida www.kylt.eu DIRECTION FOR USE Art. No. 31058 / 31059 Kylt Pasteurella multocida DNA Extraction and
More informationNRAS Codon 61 Mutation Analysis Reagents
NRAS Codon 61 Mutation Analysis Reagents User Manual V1.0 Cat No. GP19 32 reactions 1 CONTENTS Introduction 4 Overview of Mutector TM Assay 5 Materials Provided 6 Materials Required 7 Equipment Required
More informationSite-Directed Mutagenesis of the Integrin-Linked Kinase (ILK) Promoter Azeem Ahamed Biochemistry 600 Fall 2001
Site-Directed Mutagenesis of the Integrin-Linked Kinase (ILK) Promoter Azeem Ahamed Biochemistry 600 Fall 2001 Table of Contents Abstract.. pg 1 Introduction.. pg 1 Procedure.. pg 3 Results.. pg 8 Discussion..
More informationEZ-10 SPIN COLUMN GENOMIC DNA MINIPREPS KIT HANDBOOK
EZ-0 SPIN COLUMN GENOMIC DNA MINIPREPS KIT HANDBOOK (Bacteria, Plant, Animal, Blood) Version 8 Rev 05/0/03 EZ-0 Genomic DNA Kit Handbook Table of Contents Introduction Limitations of Use Features Applications
More informationLambda DNA Purification Kit
Lambda DNA Purification Kit INSTRUCTION MANUAL Catalog #200391 and #200392 Revision A For In Vitro Use Only 200391-12 LIMITED PRODUCT WARRANTY This warranty limits our liability to replacement of this
More informationGateway Vectors for BiFC
Gateway Vectors for BiFC 1. The enhanced YFP (EYFP) are used (Split EYFP). 2. The Fusion fusion gene is expressed by CaMV35S promoter. 3. The N- or C-terminal fragments of EYFP are fused subsequent to
More informationWorm Genomic DNA Prep
Worm Genomic DNA Prep CONTENTS: p2 Hawaiian Mapping Method (pooled samples) p4 Non-mapped samples (not pooled) p5 Genomic Prep from a few hundred worms (e.g. homozygous recessive lethal mutants) p6 Genomic
More informationAlkaline Lysis Large Scale Plasmid Preparation
Alkaline Lysis Large Scale Plasmid Preparation 1. Set up 10 ml overnight culture. 2. Add overnight to 500 mls of sterile LB with appropriate selective agent (e.g amp, tet...) 3. Incubate at 37 C with shaking
More informationElectronic Supplementary Information
Electronic Supplementary Information Ultrasensitive and Selective DNA Detection Based on Nicking Endonuclease Assisted Signal Amplification and Its Application in Cancer Cells Detection Sai Bi, Jilei Zhang,
More information3 Designing Primers for Site-Directed Mutagenesis
3 Designing Primers for Site-Directed Mutagenesis 3.1 Learning Objectives During the next two labs you will learn the basics of site-directed mutagenesis: you will design primers for the mutants you designed
More informationQ5 Site-Directed Mutagenesis Kit
DNA MODIFYING ENZYMES Q5 Site-Directed Mutagenesis Kit Instruction Manual NEB #E0554S 10 reactions Version 1.0 1/13 be INSPIRED drive DISCOVERY stay GENUINE This product is intended for research purposes
More informationSupplemental Data. Short Article. Transcriptional Regulation of Adipogenesis by KLF4. Kıvanç Birsoy, Zhu Chen, and Jeffrey Friedman
Cell Metabolism, Volume 7 Supplemental Data Short Article Transcriptional Regulation of Adipogenesis by KLF4 Kıvanç Birsoy, Zhu Chen, and Jeffrey Friedman Supplemental Experimental Procedures Plasmids
More informationFMF NIRCA PROTOCOL STEP 1.
FMF NIRCA PROTOCOL STEP 1. After you have isolated patient s DNA and DNA from a healthy donor (wild type), you perform a nested PCR. The primers used to amplify exon 2 and exon 10 of the mefv gene are
More informationQuikChange II XL Site-Directed Mutagenesis Kit
QuikChange II XL Site-Directed Mutagenesis Kit Instruction Manual Catalog #200521 (10 reactions) and #200522 (30 reactions) Revision F.0 For Research Use Only. Not for use in diagnostic procedures. 200521-12
More informationPrimeScript RT Master Mix (Perfect Real Time)
Cat. # RR036A For Research Use PrimeScript RT Master Mix (Perfect Real Time) Product Manual Table of Contents I. Description... 3 II. Kit Components... 3 III. Materials Required but not Provided... 3 IV.
More informationRotavirus Detection and Typing
Appendix ii Rotavirus Detection and Typing Nucleic acid extraction and reverse transcription Virus Detection by PCR Rotavirus VP7, VP4, VP6 and NSP4 genotyping Version 4 01.10.2009 Contents 1. Specimen
More informationChIP-chip protocol adapted for the mod-encode project
ChIP-chip protocol adapted for the mod-encode project Version 1.2 : August 2007 Nicolas Nègre, Xiaochun Ni, Sergey Lavrov, Giacomo Cavalli and Kevin P. White University of Chicago, Department of Human
More informationAdnaTest ProstateCancerDetect
AdnaTest ProstateCancerDetect RT-PCR Kit for detection of prostate cancer associated gene expression in enriched tumor cells For diagnostic use Manual T-1-521 Contents Order Information... 3 Purpose...
More informationUltraClean Midi Plasmid Prep Kit
UltraClean Midi Plasmid Prep Kit Catalog No. Quantity 12700-20 20 Preps Instruction Manual Please recycle Version: 05232014 1 Table of Contents Introduction... 3 Protocol Overview... 3 Flow Chart... 4
More informationPureSpin DNA Clean Up Kit
PureSpin DNA Clean Up Kit Micro Columns INSTRUCTION MANUAL KIT COMPONENTS For Research Use Only PureSpin DNA Clean Up Kit, Micro Columns w/out Caps (Kit Size) OD2080 (50 Preps.) OD2080-2 (200 Preps.) Storage
More informationFOR RESEARCH USE ONLY. NOT FOR HUMAN OR DIAGNOSTIC USE.
Instruction manual KOD -Plus- 1207 F0934K KOD -Plus- Contents [1] Introduction [2] Components [3] Quality testing [4] Primer design [5] Cloning of PCR products [6] Protocol 1. Standard reaction setup 2.
More informationPrimeScript RT reagent Kit (Perfect Real Time)
Cat. # RR037A For Research Use PrimeScript RT reagent Kit (Perfect Real Time) Product Manual Table of Contents I. Description... 3 II. Components... 3 III. Storage... 3 IV. Features... 4 V. Precautions...
More information