Protein NMR II. Lecture 5

Size: px
Start display at page:

Download "Protein NMR II. Lecture 5"

Transcription

1 Protein NMR II Lecture 5

2 Standard and NMR chemical shifts in proteins Residue N A A B O Ala ys Asp Glu Phe Gly is Ile Lys Leu Met Asn Pro Gln Arg Ser Thr Val Trp Tyr

3

4 N 3 O 3 OSY Magnetization is transferred by scalar coupling (bonds). Protons that are more than three chemical bonds apart ( 3 J) give no cross peaks because the higher coupling constants ( 4 J, 5 J, etc) are close to 0. Therefore, only signals of protons which are two or three bonds apart are visible in a OSY spectrum. TOSY Magnetization is dispersed over a complete spinsystem by successive scalar coupling. The TOSY experiment correlates all protons of a spin system.

5 N 3 O 3

6 N O N N O O O O N 2 O Asp Gly Asn i-1 i i+1

7 3D SQ-NOESY and SQ-TOSY Resolved N frequencies 15 N planes Aliphatic frequencies 1 1 N 15 N

8 1 15 N 1 Amide

9 3D SQ-TOSY Only protons of groups attached to amide group (N) will give rise to cross-peaks. δ1 δ2 N O γ β2 β1 3 3 α N

10 NOESY TOSY Leu Ala Asn Gly Leu Ala Asn Gly (N) (N)

11 (9.15,125.5) 2D 1-15 N SQ

12 NOA NA NOAB NAB 13

13 i N A B i i+1 Gln Val Asn

14 SQ-NOESY SQ-TOSY 1

15 N O N N O O 3 3 +N 3 Lys Gly Leu i-1 i i+1

16

17

18 2D 1-15 N SQ

19 4D 15 N, 13 -edited NOESY (NNOE) Indirect dimensions ( 1 N, 15 N) Direct dimensions ( 1, 13 ) O N 15 N N

20 4D 15 N, 13 -edited NOESY (NNOE) 117.hb/cb 116.hg/cg 116.hd2/cd2 116.ha/ca 117.ha/ca 117.hg2/cg2 116.hd1/cd1

21 4D 13, 13 -edited NOESY (NOE) O N

22 4D 13, 13 -edited NOESY (NOE) 117.hb/cb 117.ha/ca 117.hg2/cg2

23 Brief introduction to molecular modeling Now we have all (almost all ) the information pertaining structure that we could extract from our sample: NOE tables with all the different intensities, angle ranges, and orientations. We will try to see how these parameters are employed to obtain the picture of the molecule in solution. As opposed to X-ray, in which we actually see the electron density from atoms in the molecule and can be considered as a direct method, with NMR we only get indirect information on atoms. Therefore, we will have to rely on some form of theoretical model to represent the structure of the protein. Usually this means a computer-generated molecular model. Since we are dealing with proteins (thousands of atoms), we use a molecular mechanics (MM) approach. The center of MM is the force field, or equations that describe the energy of the system as a function of <xyz> coordinates. In general, it is a sum of different energy terms.

24 Using NMR data Strong NOE Å Medium NOE Å Weak NOE Å E total = E vdw + E bs + E ab + E torsion + E elctrostatics + ab initio - atomic/molecular orbitals Each term depends on the geometry of the system. E bs, the bond stretching energy of the system.

25 Simulated annealing: We heat the system to an obscene temperature (1000 K), and then we allow it to cool slowly. This will hopefully let the system fall into preferred conformations: ot conformers T Time (usually ps) ool conformers

26 What you need Software: yana (ombined assignment and dynamics algorithm for NMR applications) YANA is a program for automated structure calculation of biological macromolecules on the basis of conformational constraints from NMR. The combination of automated NOESY cross peak assignment, structure calculation with a fast torsion angle dynamics algorithm Files: A cyana script to perform the calculation steps test.upl test.seq

27 Script to calculate structures set expand=1 set swap=0 set tf_type=2 set weight_vdw=1.0 set weight_upl=1.0 set weight_lol=1.0 set weight_aco=5.0 set cut_upl=0.1 set cut_lol=0.1 set cut_vdw=0.1 set cut_aco=1.0 read seq../test.seq read upl../test-nohb.upl read lol../test-nohb.lol set seed= calc_all structures=200 command=anneal steps=40000 overview best structures=20 range= ang if (master) wrtpdb test- struct=20

28 # N(i)-N(i+2) 10 GLY 12 GLU E GLY 13 LEU E GLU 14 ASP E LEU 15 LYS E ASP 16 TRP E LYS 17 GLU E+00 # N(i)-N(i+3) 13 LEU 16 TRP E ASP 17 GLU E+00 # a(i)-n(i+1) 9 SER A 10 GLY E GLY A3 11 GLY E+00 # a(i)-n(i+2) 10 GLY A2 12 GLU E GLY A2 13 LEU E GLU A 14 ASP E LEU A 15 LYS E ASP A 16 TRP E LYS A 17 GLU E TRP A 18 LYS E GLU A 19 ILE E+00

29 #Sequential NOEs 19 ILE A 20 ARG E ARG A 21 LEU E LEU 22 ARG E ARG A 23 PRO D E ARG A 23 PRO D E GLY 25 GLY E GLY A2 26 LYS E GLY A3 26 LYS E LYS 27 LYS E LYS A 28 GLN E GLN A 29 TYR E TYR A 30 LYS E+00 # a(i)-a(j) 17 GLU A 29 TYR A E GLU A 30 LYS A E ARG A 28 GLN A E+00 # a(i)-n(j) 17 GLU A 29 TYR E LYS A 29 TYR E ARG A 29 TYR E LEU 28 GLN A E ARG 25 GLY A E PRO A 25 GLY E+00 # N(i)-N(j) 19 ILE 29 TYR E ARG 97 TR E LEU 27 LYS E ARG 25 GLY E+00

30

31

32

CFSSP: Chou and Fasman Secondary Structure Prediction server

CFSSP: Chou and Fasman Secondary Structure Prediction server Wide Spectrum, Vol. 1, No. 9, (2013) pp 15-19 CFSSP: Chou and Fasman Secondary Structure Prediction server T. Ashok Kumar Department of Bioinformatics, Noorul Islam College of Arts and Science, Kumaracoil

More information

Virtual bond representation

Virtual bond representation Today s subjects: Virtual bond representation Coordination number Contact maps Sidechain packing: is it an instrumental way of selecting and consolidating a fold? ASA of proteins Interatomic distances

More information

Structural bioinformatics

Structural bioinformatics Structural bioinformatics Why structures? The representation of the molecules in 3D is more informative New properties of the molecules are revealed, which can not be detected by sequences Eran Eyal Plant

More information

Packing of Secondary Structures

Packing of Secondary Structures 7.88 Lecture Notes - 5 7.24/7.88J/5.48J The Protein Folding and Human Disease Packing of Secondary Structures Packing of Helices against sheets Packing of sheets against sheets Parallel Orthogonal Table:

More information

11 questions for a total of 120 points

11 questions for a total of 120 points Your Name: BYS 201, Final Exam, May 3, 2010 11 questions for a total of 120 points 1. 25 points Take a close look at these tables of amino acids. Some of them are hydrophilic, some hydrophobic, some positive

More information

466 Asn (N) to Ala (A) Generate beta dimer Interface

466 Asn (N) to Ala (A) Generate beta dimer Interface Table S1: Amino acid changes to the HexA α-subunit to convert the dimer interface from α to β and to introduce the putative GM2A binding surface from β- onto the α- subunit Residue position (α-numbering)

More information

6-Foot Mini Toober Activity

6-Foot Mini Toober Activity Big Idea The interaction between the substrate and enzyme is highly specific. Even a slight change in shape of either the substrate or the enzyme may alter the efficient and selective ability of the enzyme

More information

Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005

Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005 Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 9 September 005 Focus concept Purification of a novel seed storage protein allows sequence analysis and

More information

Problem Set Unit The base ratios in the DNA and RNA for an onion (Allium cepa) are given below.

Problem Set Unit The base ratios in the DNA and RNA for an onion (Allium cepa) are given below. Problem Set Unit 3 Name 1. Which molecule is found in both DNA and RNA? A. Ribose B. Uracil C. Phosphate D. Amino acid 2. Which molecules form the nucleotide marked in the diagram? A. phosphate, deoxyribose

More information

Structure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München

Structure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Structure formation and association of biomolecules Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Motivation Many biomolecules are chemically synthesized

More information

Problem: The GC base pairs are more stable than AT base pairs. Why? 5. Triple-stranded DNA was first observed in 1957. Scientists later discovered that the formation of triplestranded DNA involves a type

More information

DNA.notebook March 08, DNA Overview

DNA.notebook March 08, DNA Overview DNA Overview Deoxyribonucleic Acid, or DNA, must be able to do 2 things: 1) give instructions for building and maintaining cells. 2) be copied each time a cell divides. DNA is made of subunits called nucleotides

More information

Chapter 8. One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model. Sebastian Kmiecik and Andrzej Kolinski.

Chapter 8. One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model. Sebastian Kmiecik and Andrzej Kolinski. Chapter 8 One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model Abstract Despite the significant increase in computational power, molecular modeling of protein structure using

More information

Thr Gly Tyr. Gly Lys Asn

Thr Gly Tyr. Gly Lys Asn Your unique body characteristics (traits), such as hair color or blood type, are determined by the proteins your body produces. Proteins are the building blocks of life - in fact, about 45% of the human

More information

7.013 Problem Set 3 FRIDAY October 8th, 2004

7.013 Problem Set 3 FRIDAY October 8th, 2004 MIT Biology Department 7.012: Introductory Biology - Fall 2004 Instructors: Professor Eric Lander, Professor Robert. Weinberg, Dr. laudette ardel Name: T: 7.013 Problem Set 3 FRIDY October 8th, 2004 Problem

More information

Fundamentals of Protein Structure

Fundamentals of Protein Structure Outline Fundamentals of Protein Structure Yu (Julie) Chen and Thomas Funkhouser Princeton University CS597A, Fall 2005 Protein structure Primary Secondary Tertiary Quaternary Forces and factors Levels

More information

Protein Structure Prediction by Constraint Logic Programming

Protein Structure Prediction by Constraint Logic Programming MPRI C2-19 Protein Structure Prediction by Constraint Logic Programming François Fages, Constraint Programming Group, INRIA Rocquencourt mailto:francois.fages@inria.fr http://contraintes.inria.fr/ Molecules

More information

Cristian Micheletti SISSA (Trieste)

Cristian Micheletti SISSA (Trieste) Cristian Micheletti SISSA (Trieste) michelet@sissa.it Mar 2009 5pal - parvalbumin Calcium-binding protein HEADER CALCIUM-BINDING PROTEIN 25-SEP-91 5PAL 5PAL 2 COMPND PARVALBUMIN (ALPHA LINEAGE) 5PAL 3

More information

Alpha-helices, beta-sheets and U-turns within a protein are stabilized by (hint: two words).

Alpha-helices, beta-sheets and U-turns within a protein are stabilized by (hint: two words). 1 Quiz1 Q1 2011 Alpha-helices, beta-sheets and U-turns within a protein are stabilized by (hint: two words) Value Correct Answer 1 noncovalent interactions 100% Equals hydrogen bonds (100%) Equals H-bonds

More information

Introduction to Proteins

Introduction to Proteins Introduction to Proteins Lecture 4 Module I: Molecular Structure & Metabolism Molecular Cell Biology Core Course (GSND5200) Matthew Neiditch - Room E450U ICPH matthew.neiditch@umdnj.edu What is a protein?

More information

Using DNA sequence, distinguish species in the same genus from one another.

Using DNA sequence, distinguish species in the same genus from one another. Species Identification: Penguins 7. It s Not All Black and White! Name: Objective Using DNA sequence, distinguish species in the same genus from one another. Background In this activity, we will observe

More information

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,

More information

Daily Agenda. Warm Up: Review. Translation Notes Protein Synthesis Practice. Redos

Daily Agenda. Warm Up: Review. Translation Notes Protein Synthesis Practice. Redos Daily Agenda Warm Up: Review Translation Notes Protein Synthesis Practice Redos 1. What is DNA Replication? 2. Where does DNA Replication take place? 3. Replicate this strand of DNA into complimentary

More information

Supplementary Materials. Figure S1 Chemical structures of cisplatin and carboplatin.

Supplementary Materials. Figure S1 Chemical structures of cisplatin and carboplatin. Supplementary Materials Figure S1 Chemical structures of cisplatin and carboplatin. Figure S2 (a) RMS difference plot between the RT and 100K structures for the carboplatin_dmso case after 13 months of

More information

Residue Contact Prediction for Protein Structure using 2-Norm Distances

Residue Contact Prediction for Protein Structure using 2-Norm Distances Residue Contact Prediction for Protein Structure using 2-Norm Distances Nikita V Mahajan Department of Computer Science &Engg GH Raisoni College of Engineering, Nagpur LGMalik Department of Computer Science

More information

MOLEBIO LAB #3: Electrophoretic Separation of Proteins

MOLEBIO LAB #3: Electrophoretic Separation of Proteins MOLEBIO LAB #3: Electrophoretic Separation of Proteins Introduction: Proteins occupy a central position in the structure and function of all living organisms. Some proteins serve as structural components

More information

Dynamic Programming Algorithms

Dynamic Programming Algorithms Dynamic Programming Algorithms Sequence alignments, scores, and significance Lucy Skrabanek ICB, WMC February 7, 212 Sequence alignment Compare two (or more) sequences to: Find regions of conservation

More information

Zool 3200: Cell Biology Exam 3 3/6/15

Zool 3200: Cell Biology Exam 3 3/6/15 Name: Trask Zool 3200: Cell Biology Exam 3 3/6/15 Answer each of the following questions in the space provided; circle the correct answer or answers for each multiple choice question and circle either

More information

36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L-

36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L- 36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L- 37. The essential fatty acids are A. palmitic acid B. linoleic acid C. linolenic

More information

Name: TOC#. Data and Observations: Figure 1: Amino Acid Positions in the Hemoglobin of Some Vertebrates

Name: TOC#. Data and Observations: Figure 1: Amino Acid Positions in the Hemoglobin of Some Vertebrates Name: TOC#. Comparing Primates Background: In The Descent of Man, the English naturalist Charles Darwin formulated the hypothesis that human beings and other primates have a common ancestor. A hypothesis

More information

Level 2 Biology, 2017

Level 2 Biology, 2017 91159 911590 2SUPERVISOR S Level 2 Biology, 2017 91159 Demonstrate understanding of gene expression 2.00 p.m. Wednesday 22 November 2017 Credits: Four Achievement Achievement with Merit Achievement with

More information

Folding simulation: self-organization of 4-helix bundle protein. yellow = helical turns

Folding simulation: self-organization of 4-helix bundle protein. yellow = helical turns Folding simulation: self-organization of 4-helix bundle protein yellow = helical turns Protein structure Protein: heteropolymer chain made of amino acid residues R + H 3 N - C - COO - H φ ψ Chain of amino

More information

Bioinformatics. ONE Introduction to Biology. Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012

Bioinformatics. ONE Introduction to Biology. Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012 Bioinformatics ONE Introduction to Biology Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012 Biology Review DNA RNA Proteins Central Dogma Transcription Translation

More information

C. Tight Turns. = -30, φ 3. = 0, and type II approximately = 120, φ 3. = -60, ψ 2. = -90, ψ 3. = +90, ψ 3

C. Tight Turns. = -30, φ 3. = 0, and type II approximately = 120, φ 3. = -60, ψ 2. = -90, ψ 3. = +90, ψ 3 Tight turns (also known as reverse turns, β turns, β bends, hairpin bends, 310 bends, kinks, widgets, etc.) are the first and most prevalent type of nonrepetitive structure that has been recognized. While

More information

X-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction

X-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction X-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction Tomohisa Shimasaki 1, Hiromi Yoshida 2, Shigehiro Kamitori 2 & Koji

More information

Biomolecules: lecture 6

Biomolecules: lecture 6 Biomolecules: lecture 6 - to learn the basics on how DNA serves to make RNA = transcription - to learn how the genetic code instructs protein synthesis - to learn the basics on how proteins are synthesized

More information

www.lessonplansinc.com Topic: Gene Mutations WS Summary: Students will learn about frame shift mutations and base substitution mutations. Goals & Objectives: Students will be able to demonstrate how mutations

More information

Supporting Online Material. Av1 and Av2 were isolated and purified under anaerobic conditions according to

Supporting Online Material. Av1 and Av2 were isolated and purified under anaerobic conditions according to Supporting Online Material Materials and Methods Av1 and Av2 were isolated and purified under anaerobic conditions according to published protocols (S1). Crystals of nf-, pcp- and adp-av2:av1 complexes

More information

Purification: Step 1. Lecture 11 Protein and Peptide Chemistry. Cells: Break them open! Crude Extract

Purification: Step 1. Lecture 11 Protein and Peptide Chemistry. Cells: Break them open! Crude Extract Purification: Step 1 Lecture 11 Protein and Peptide Chemistry Cells: Break them open! Crude Extract Total contents of cell Margaret A. Daugherty Fall 2003 Big Problem: Crude extract is not the natural

More information

Purification: Step 1. Protein and Peptide Chemistry. Lecture 11. Big Problem: Crude extract is not the natural environment. Cells: Break them open!

Purification: Step 1. Protein and Peptide Chemistry. Lecture 11. Big Problem: Crude extract is not the natural environment. Cells: Break them open! Lecture 11 Protein and Peptide Chemistry Margaret A. Daugherty Fall 2003 Purification: Step 1 Cells: Break them open! Crude Extract Total contents of cell Big Problem: Crude extract is not the natural

More information

Examining the components of your peptide sample with AccuPep QC. Lauren Lu, Ph.D. October 29, 2015, 9:00-10:00 AM EST

Examining the components of your peptide sample with AccuPep QC. Lauren Lu, Ph.D. October 29, 2015, 9:00-10:00 AM EST Examining the components of your peptide sample with AccuPep QC Lauren Lu, Ph.D. October 29, 2015, 9:00-10:00 AM EST When do I need custom peptides? Custom peptides play an important role in many research

More information

Lecture 11: Gene Prediction

Lecture 11: Gene Prediction Lecture 11: Gene Prediction Study Chapter 6.11-6.14 1 Gene: A sequence of nucleotides coding for protein Gene Prediction Problem: Determine the beginning and end positions of genes in a genome Where are

More information

Disease and selection in the human genome 3

Disease and selection in the human genome 3 Disease and selection in the human genome 3 Ka/Ks revisited Please sit in row K or forward RBFD: human populations, adaptation and immunity Neandertal Museum, Mettman Germany Sequence genome Measure expression

More information

BIL 256 Cell and Molecular Biology Lab Spring, 2007 BACKGROUND INFORMATION I. PROTEIN COMPOSITION AND STRUCTURE: A REVIEW OF THE BASICS

BIL 256 Cell and Molecular Biology Lab Spring, 2007 BACKGROUND INFORMATION I. PROTEIN COMPOSITION AND STRUCTURE: A REVIEW OF THE BASICS BIL 256 Cell and Molecular Biology Lab Spring, 2007 BACKGROUND INFORMATION I. PROTEIN COMPOSITION AND STRUCTURE: A REVIEW OF THE BASICS Proteins occupy a central position in the structure and function

More information

ENZYMES AND METABOLIC PATHWAYS

ENZYMES AND METABOLIC PATHWAYS ENZYMES AND METABOLIC PATHWAYS This document is licensed under the Attribution-NonCommercial-ShareAlike 2.5 Italy license, available at http://creativecommons.org/licenses/by-nc-sa/2.5/it/ 1. Enzymes build

More information

Supplementary Table 1: List of CH3 domain interface residues in the first chain (A) and

Supplementary Table 1: List of CH3 domain interface residues in the first chain (A) and Supplementary Tables Supplementary Table 1: List of CH3 domain interface residues in the first chain (A) and their side chain contacting residues in the second chain (B) a Interface Res. in Contacting

More information

The study of protein secondary structure and stability at equilibrium ABSTRACT

The study of protein secondary structure and stability at equilibrium ABSTRACT The study of protein secondary structure and stability at equilibrium Michelle Planicka Dept. of Physics, North Georgia College and State University, Dahlonega, GA REU, Dept. of Physics, University of

More information

Cambridge International Examinations Cambridge International Advanced Subsidiary and Advanced Level

Cambridge International Examinations Cambridge International Advanced Subsidiary and Advanced Level ambridge International Examinations ambridge International Advanced Subsidiary and Advanced Level *8744875516* BIOLOGY 9700/22 Paper 2 AS Level Structured Questions October/November 2016 1 hour 15 minutes

More information

Protein Structure and Function! Lecture 4: ph, pka and pi!

Protein Structure and Function! Lecture 4: ph, pka and pi! Protein Structure and Function! Lecture 4: ph, pka and pi! Definition of ph and pk a! ph is a measure of the concentration of H +.! + ph = log 10[H ] For a weak acid,! HA #!!"! H + + A!, K a = [H + ][A!

More information

1. Introduction. 2. Materials and Method

1. Introduction. 2. Materials and Method American Journal of Pharmacological Sciences, 2016, Vol. 4, No. 1, 1-6 Available online at http://pubs.sciepub.com/ajps/4/1/1 Science and Education Publishing DOI:10.12691/ajps-4-1-1 In-silico Designing

More information

1. DNA, RNA structure. 2. DNA replication. 3. Transcription, translation

1. DNA, RNA structure. 2. DNA replication. 3. Transcription, translation 1. DNA, RNA structure 2. DNA replication 3. Transcription, translation DNA and RNA are polymers of nucleotides DNA is a nucleic acid, made of long chains of nucleotides Nucleotide Phosphate group Nitrogenous

More information

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,

More information

(a) Which enzyme(s) make 5' - 3' phosphodiester bonds? (c) Which enzyme(s) make single-strand breaks in DNA backbones?

(a) Which enzyme(s) make 5' - 3' phosphodiester bonds? (c) Which enzyme(s) make single-strand breaks in DNA backbones? EXAMPLE QUESTIONS AND ANSWERS 1. Topoisomerase does which one of the following? (a) Makes new DNA strands. (b) Unties knots in DNA molecules. (c) Joins the ends of double-stranded DNA molecules. (d) Is

More information

This is the knowledge that you should understand upon completing this section:

This is the knowledge that you should understand upon completing this section: DN 11 Syllabus hecklist This is the knowledge that you should understand upon completing this section: 11.1 DN DN occurs bound to proteins in chromosomes in the nucs and as unbound DN in the mitochondria.

More information

Honors Research in Molecular Genetics Part 1

Honors Research in Molecular Genetics Part 1 Third Base Honors Research in Molecular enetics Part 1 ll bout ene Expression How do cells synthesize polypeptides and convert them to functional proteins? The message in your DN of who you are and how

More information

DATA. mrna CODON CHART

DATA. mrna CODON CHART Alien Encounters! Background: In the year 2050, an incredible archeological discovery was made in the middle of a remote area of South America. It was an area where a large meteor had struck Earth. A pile

More information

7.014 Quiz II 3/18/05. Write your name on this page and your initials on all the other pages in the space provided.

7.014 Quiz II 3/18/05. Write your name on this page and your initials on all the other pages in the space provided. 7.014 Quiz II 3/18/05 Your Name: TA's Name: Write your name on this page and your initials on all the other pages in the space provided. This exam has 10 pages including this coversheet. heck that you

More information

Study of the influence of ethanol on basic fibroblast growth factor structure

Study of the influence of ethanol on basic fibroblast growth factor structure G.H. Brancaleoni et al. 350 Study of the influence of ethanol on basic fibroblast growth factor structure G.H. Brancaleoni, M.R. Lourenzoni and L. Degrève Departamento de Química, Faculdade de Filosofia

More information

Phosphoserine-rich Protein from Phragmatopoma californica. Leila Jirari Mentor: Chengjun Sun Herbert Waite NIH, NSF, NASA

Phosphoserine-rich Protein from Phragmatopoma californica. Leila Jirari Mentor: Chengjun Sun Herbert Waite NIH, NSF, NASA Phosphoserine-rich Protein from Phragmatopoma californica Leila Jirari Mentor: Chengjun Sun Herbert Waite NIH, NSF, NASA Why Study This Worm? Underwater adhesive Glue adheres to eggs shells, glass, teeth

More information

Amino Acid Distribution Rules Predict Protein Fold: Protein Grammar for Beta-Strand Sandwich-Like Structures

Amino Acid Distribution Rules Predict Protein Fold: Protein Grammar for Beta-Strand Sandwich-Like Structures Biomolecules 2015, 5, 41-59; doi:10.3390/biom5010041 Article OPEN ACCESS biomolecules ISSN 2218-273X www.mdpi.com/journal/biomolecules/ Amino Acid Distribution Rules Predict Protein Fold: Protein Grammar

More information

Protein 3D Structure Prediction

Protein 3D Structure Prediction Protein 3D Structure Prediction Michael Tress CNIO ?? MREYKLVVLGSGGVGKSALTVQFVQGIFVDE YDPTIEDSYRKQVEVDCQQCMLEILDTAGTE QFTAMRDLYMKNGQGFALVYSITAQSTFNDL QDLREQILRVKDTEDVPMILVGNKCDLEDER VVGKEQGQNLARQWCNCAFLESSAKSKINVN

More information

Gene Expression Translation U C A G A G

Gene Expression Translation U C A G A G Why? ene Expression Translation How do cells synthesize polypeptides and convert them to functional proteins? The message in your DN of who you are and how your body works is carried out by cells through

More information

Ligand immobilization using thiol-disulphide exchange

Ligand immobilization using thiol-disulphide exchange A P P L I C A T I T E 9 Ligand immobilization using thiol-disulphide exchange Abstract This Application ote describes an immobilization procedure based on thioldisulphide exchange, providing a valuable

More information

Protein Synthesis. Application Based Questions

Protein Synthesis. Application Based Questions Protein Synthesis Application Based Questions MRNA Triplet Codons Note: Logic behind the single letter abbreviations can be found at: http://www.biology.arizona.edu/biochemistry/problem_sets/aa/dayhoff.html

More information

Mutagenesis. Classification of mutation. Spontaneous Base Substitution. Molecular Mutagenesis. Limits to DNA Pol Fidelity.

Mutagenesis. Classification of mutation. Spontaneous Base Substitution. Molecular Mutagenesis. Limits to DNA Pol Fidelity. Mutagenesis 1. Classification of mutation 2. Base Substitution 3. Insertion Deletion 4. s 5. Chromosomal Aberration 6. Repair Mechanisms Classification of mutation 1. Definition heritable change in DNA

More information

CHAPTER 1. DNA: The Hereditary Molecule SECTION D. What Does DNA Do? Chapter 1 Modern Genetics for All Students S 33

CHAPTER 1. DNA: The Hereditary Molecule SECTION D. What Does DNA Do? Chapter 1 Modern Genetics for All Students S 33 HPER 1 DN: he Hereditary Molecule SEION D What Does DN Do? hapter 1 Modern enetics for ll Students S 33 D.1 DN odes For Proteins PROEINS DO HE nitty-gritty jobs of every living cell. Proteins are the molecules

More information

Degenerate Code. Translation. trna. The Code is Degenerate trna / Proofreading Ribosomes Translation Mechanism

Degenerate Code. Translation. trna. The Code is Degenerate trna / Proofreading Ribosomes Translation Mechanism Translation The Code is Degenerate trna / Proofreading Ribosomes Translation Mechanism Degenerate Code There are 64 possible codon triplets There are 20 naturally-encoding amino acids Several codons specify

More information

DNA stands for deoxyribose nucleic acid

DNA stands for deoxyribose nucleic acid 1 DNA 2 DNA stands for deoxyribose nucleic acid This chemical substance is present in the nucleus of all cells in all living organisms DNA controls all the chemical changes which take place in cells The

More information

Name Date of Data Collection. Class Period Lab Days/Period Teacher

Name Date of Data Collection. Class Period Lab Days/Period Teacher Comparing Primates (adapted from Comparing Primates Lab, page 431-438, Biology Lab Manual, by Miller and Levine, Prentice Hall Publishers, copyright 2000, ISBN 0-13-436796-0) Background: One of the most

More information

Zwitterion Chromatography ZIC

Zwitterion Chromatography ZIC Zwitterion Chromatography ZIC A novel technique, with unique selectivity, suitable for preparative scale separations? PhD Einar Pontén What is Zwitterion Chromatography? Our definition: Liquid chromatography

More information

CS 4491/CS 7990 SPECIAL TOPICS IN BIOINFORMATICS

CS 4491/CS 7990 SPECIAL TOPICS IN BIOINFORMATICS 1 CS 4491/CS 7990 SPECIAL TOPICS IN BIOINFORMATICS * Some contents are adapted from Dr. Jean Gao at UT Arlington Mingon Kang, PhD Computer Science, Kennesaw State University 2 Genetics The discovery of

More information

Introduction to Protein Purification

Introduction to Protein Purification Introduction to Protein Purification 1 Day 1) Introduction to Protein Purification. Input for Purification Protocol Development - Guidelines for Protein Purification Day 2) Sample Preparation before Chromatography

More information

Aipotu I & II: Genetics & Biochemistry

Aipotu I & II: Genetics & Biochemistry Aipotu I & II: Genetics & Biochemistry Objectives: To reinforce your understanding of Genetics, Biochemistry, and Molecular Biology To show the connections between these three disciplines To show how these

More information

Addison Ault, Department of Chemistry, Cornell College, Mount Vernon, IA. The isoelectric point is a point on the ph scale. It is the ph at which the

Addison Ault, Department of Chemistry, Cornell College, Mount Vernon, IA. The isoelectric point is a point on the ph scale. It is the ph at which the 1 Isoelectric Points On the Back of the Envelope Addison Ault, Department of Chemistry, Cornell College, Mount Vernon, IA The isoelectric point is a point on the ph scale. It is the ph at which the average

More information

AOCS/SQT Amino Acid Round Robin Study

AOCS/SQT Amino Acid Round Robin Study AOCS/SQT Amino Acid Round Robin Study J. V. Simpson and Y. Zhang National Corn-to-Ethanol Research Center Edwardsville, IL Richard Cantrill Technical Director AOCS, Urbana, IL Amy Johnson Soybean Quality

More information

Codon Bias with PRISM. 2IM24/25, Fall 2007

Codon Bias with PRISM. 2IM24/25, Fall 2007 Codon Bias with PRISM 2IM24/25, Fall 2007 from RNA to protein mrna vs. trna aminoacid trna anticodon mrna codon codon-anticodon matching Watson-Crick base pairing A U and C G binding first two nucleotide

More information

G+C content. 1 Introduction. 2 Chromosomes Topology & Counts. 3 Genome size. 4 Replichores and gene orientation. 5 Chirochores.

G+C content. 1 Introduction. 2 Chromosomes Topology & Counts. 3 Genome size. 4 Replichores and gene orientation. 5 Chirochores. 1 Introduction 2 Chromosomes Topology & Counts 3 Genome size 4 Replichores and gene orientation 5 Chirochores 6 7 Codon usage 121 marc.bailly-bechet@univ-lyon1.fr Bacterial genome structures Introduction

More information

Middle Amino Acid in Proteins: Comparison of Predicted and

Middle Amino Acid in Proteins: Comparison of Predicted and Proc. Nat. Acad. Sci. USA Vol. 70, No. 5, pp. 1473-1477, May 1973 The Influence of Nearest-Neighbor Amino Acids on the Conformation of the Middle Amino Acid in Proteins: Comparison of Predicted and Experimental

More information

Globins. The Backbone structure of Myoglobin 2. The Heme complex in myoglobin. Lecture 10/01/2009. Role of the Globin.

Globins. The Backbone structure of Myoglobin 2. The Heme complex in myoglobin. Lecture 10/01/2009. Role of the Globin. Globins Lecture 10/01/009 The Backbone structure of Myoglobin Myoglobin: 44 x 44 x 5 Å single subunit 153 amino acid residues 11 residues are in an a helix. Helices are named A, B, C, F. The heme pocket

More information

BIOLOGY/HUMAN BIOLOGY BY1

BIOLOGY/HUMAN BIOLOGY BY1 andidate Name entre Number andidate Number 2 GE AS/A level 1071/01 BILGY/UMAN BILGY BY1 A.M. TUESDAY, 12 January 2010 1 1 2 hours For s use Question Maximum Mark 1 6 2 6 3 11 4 11 5 12 6 14 7 10 Total

More information

Welcome to Genome 371!

Welcome to Genome 371! Genome 371, 4 Jan 2010, Lecture 1 Welcome to Genome 371! If you are not registered - please don t take a seat! (class is full) - see Anne Paul (outside) to get on the wait list If you are registered and

More information

1. DNA replication. (a) Why is DNA replication an essential process?

1. DNA replication. (a) Why is DNA replication an essential process? ame Section 7.014 Problem Set 3 Please print out this problem set and record your answers on the printed copy. Answers to this problem set are to be turned in to the box outside 68120 by 5:00pm on Friday

More information

IOWA End-of-Course Assessment Programs. Released Items BIOLOGY. Copyright 2010 by The University of Iowa.

IOWA End-of-Course Assessment Programs. Released Items BIOLOGY. Copyright 2010 by The University of Iowa. IOW End-of-ourse ssessment Programs Released Items opyright 2010 by The University of Iowa. IOLOGY First mrn base 1 ased on the table, which of the following sequences in a template N strand would be transcribed

More information

NOTES Nucleotide Sequences of the Genes for Two Distinct Cephalosporin Acylases from a Pseudomonas Strain

NOTES Nucleotide Sequences of the Genes for Two Distinct Cephalosporin Acylases from a Pseudomonas Strain JOURNAL OF BACTERIOLOGY, Dec. 1987, p. 5821-5826 0021-9193/87/125821-06$02.00/0 Copyright 1987, American Society for Microbiology Vol. 169, No. 12 NOTES Nucleotide Sequences of the Genes for Two Distinct

More information

Aipotu I: Genetics & Biochemistry

Aipotu I: Genetics & Biochemistry Aipotu I: Genetics & Biochemistry Objectives: To reinforce your understanding of Genetics, Biochemistry, and Molecular Biology To show the connections between these three disciplines To show how these

More information

Virtual Screening of compounds to 1-deoxy-Dxylulose 5-phosphate reductoisomerase (DXR) from Plasmodium falciparum

Virtual Screening of compounds to 1-deoxy-Dxylulose 5-phosphate reductoisomerase (DXR) from Plasmodium falciparum www.bioinformation.net Hypothesis Volume 10(6) Virtual Screening of compounds to 1-deoxy-Dxylulose 5-phosphate reductoisomerase (DXR) from Plasmodium falciparum Kamal Kumar Chaudhary & C.V.S. Siva Prasad*

More information

Comparative Simulation Studies of Native and Single-Site Mutant Human Beta-Defensin-1 Peptides

Comparative Simulation Studies of Native and Single-Site Mutant Human Beta-Defensin-1 Peptides Comparative Simulation Studies of Native and Single-Site Mutant Human Beta-Defensin-1 Peptides Rabab A. Toubar, Artem Zhmurov, Valeri Barsegov, * and Kenneth A. Marx * Department of Chemistry, University

More information

The Structure Lectures

The Structure Lectures The Structure Lectures Boris Steipe boris.steipe@utoronto.ca http://biochemistry.utoronto.ca/steipe Departments of Biochemistry and Molecular and Medical Genetics Program in Proteomics and Bioinformatics

More information

A Zero-Knowledge Based Introduction to Biology

A Zero-Knowledge Based Introduction to Biology A Zero-Knowledge Based Introduction to Biology Konstantinos (Gus) Katsiapis 25 Sep 2009 Thanks to Cory McLean and George Asimenos Cells: Building Blocks of Life cell, membrane, cytoplasm, nucleus, mitochondrion

More information

Integrated reactor feeding system amino acid feedback control via online HPLC for productivity gains

Integrated reactor feeding system amino acid feedback control via online HPLC for productivity gains Integrated reactor feeding system amino acid feedback control via online HPLC for productivity gains Application Note Biopharmaceuticals Author George Barringer, PhD David Lau, PhD Groton Biosystems Boxborough,

More information

DNA and the Double Helix in the Fifties: Papers Published in Nature which mention DNA and the Double Helix

DNA and the Double Helix in the Fifties: Papers Published in Nature which mention DNA and the Double Helix DNA and the Double Helix in the Fifties: Papers Published in Nature 1950-1960 which mention DNA and the Double Helix DNA paper Mention double helix 50 40 30 20 10 1950 1951 1952 1953 1954 1955 1956 1957

More information

Proteins. Amino Acids (APK) Peptides (APK) 5/23/2012. Peptide bond. Acid. Amino

Proteins. Amino Acids (APK) Peptides (APK) 5/23/2012. Peptide bond. Acid. Amino Proteins Amino Acids (APK) Acid Amino Image courtesy of Biotech (biotech.chem.indiana.edu/pages/ protein_intro.html) Peptides (APK) Peptide bond 1 Proteins (polypeptides) Segment of a protein Peptide bonds

More information

Reversed Phase Solutions for the Analysis of Proteins, Peptides, and Oligonucleotides

Reversed Phase Solutions for the Analysis of Proteins, Peptides, and Oligonucleotides Reversed Phase Solutions for the Analysis of Proteins, Peptides, and Oligonucleotides The line, which includes and Proteo, offers various reversed phase solutions for biochromatography. With these two

More information

7.013 Spring 2005 Practice Quiz Practice Quiz 1

7.013 Spring 2005 Practice Quiz Practice Quiz 1 MIT Department of Biology 7.013: Introductory Biology Spring 2005 Instructors: Professor azel Sive, Professor Tyler Jacks, Dr. laudette Gardel 7.013 Spring 2005 Practice Quiz 1 7.013 Practice Quiz 1 Question

More information

Life+ 12 ENV/IT GreenWoolF: Green hydrolysis conversion of Wool wastes into organic nitrogen Fertilisers

Life+ 12 ENV/IT GreenWoolF: Green hydrolysis conversion of Wool wastes into organic nitrogen Fertilisers Life+ 12 ENV/IT000439 GreenWoolF: Green hydrolysis conversion of Wool wastes into organic nitrogen Fertilisers 2nd INTERNATIONAL CONFERENCE on Sustainable Solid Waste Management 12th 14th June 2014 M.

More information

Figure S1 Alpha-carbon backbones of components from FSH-FSHRHB complex. a, Stereo view of FSHRHB (red) with every 10 th residue marked.

Figure S1 Alpha-carbon backbones of components from FSH-FSHRHB complex. a, Stereo view of FSHRHB (red) with every 10 th residue marked. a 230 80 80 130 110 230 110 180 60 180 130 60 210 200160 40 210 200 160 40 90 20 90 20 250 150 150 190 100 250 50 30 100 220 140 220 190 140 50 30 240 240 120 70 120 70 170 170 b 70 70 60 60 20 20 50 50

More information

Main-Chain Conformational Tendencies of Amino Acids

Main-Chain Conformational Tendencies of Amino Acids PROTEINS: Structure, Function, and Bioinformatics 60:679 689 (2005) Main-Chain Conformational Tendencies of Amino Acids Robert J. Anderson, 1,2 Zhiping Weng, 2 Robert K. Campbell, 1 and Xuliang Jiang 1

More information

Cambridge International Examinations Cambridge International Advanced Subsidiary and Advanced Level

Cambridge International Examinations Cambridge International Advanced Subsidiary and Advanced Level Cambridge International Examinations Cambridge International Advanced Subsidiary and Advanced Level *2249654089* BIOLOGY 9700/21 Paper 2 AS Level Structured Questions October/November 2016 1 hour 15 minutes

More information

JBC Papers in Press. Published on December 3, 2009 as Manuscript M

JBC Papers in Press. Published on December 3, 2009 as Manuscript M JBC Papers in Press. Published on December 3, 2009 as Manuscript M109.087932 The latest version is at http://www.jbc.org/cgi/doi/10.1074/jbc.m109.087932 INTERRUPTED H/D EXCHANGE REVEALS THE STABLE CORE

More information