Protein Structure Databases, cont. 11/09/05

Size: px
Start display at page:

Download "Protein Structure Databases, cont. 11/09/05"

Transcription

1 11/9/05 Protein Structure Databases (continued) Prediction & Modeling Bioinformatics Seminars Nov 10 Thurs 3:40 Com S Seminar in 223 Atanasoff Computational Epidemiology Armin R. Mikler, Univ. North Texas Nov 10 Thurs 4:10 EEOB Seminar in 210 Bessey Diversity and Evolution of Plant Immunity Genes: Insights from Molecular Population Genetics Peter Tiffin, Univ. of Minnesota CORRECTION: Bioinformatics Seminars Next week - Baker Center/BCB Seminars: (seminar abstracts available at above link) Nov 14 Mon 1:10 PM Doug Brutlag, Stanford Discovering transcription factor binding sites Nov 15 Tues 1:10 PM Ilya Vakser, Univ Kansas Modeling protein-protein interactions both seminars will be in Howe Hall Auditorium Protein Structure & Function: Analysis & Prediction Mon Protein structure: basics; classification,databases, visualization Wed Protein structure databases - cont. Thurs Lab Protein structure databases Protein structure analysis & prediction Fri Protein structure prediction Protein-nucleic acid interactions 3 4 Reading Assignment (for Mon-Fri) Mount Bioinformatics Chp 10 Protein classification & structure prediction pp Ck Errata: Review last lecture: Protein Structure: Basics Additional reading assignments for BCB 544: Gene Prediction: Burge & Karlin 1997 JMB 268:78 Prediction of complete gene structures in human genomic DNA Structure Prediction: Schueler-Furman Baker, Science 310:638 Progress in modeling of protein structures and interactions 5 6 D Dobbs ISU - BCB 444/544X 1

2 Protein Structure & Function Amino Acids Amino acids characteristics Structural classes & motifs Protein functions & functional families (not much - more on this later) Classification Databases Visualization Each of 20 different amino acids has different "R-Group," side chain attached to Cα 7 8 Peptide bond is rigid and planar Hydrophobic Amino Acids 9 10 Charged Amino Acids Polar Amino Acids D Dobbs ISU - BCB 444/544X 2

3 Certain side-chain configurations are energetically favored (rotamers) Glycine is smallest amino acid R group = H atom Ramachandran plot: "Allowable" psi & phi angles Glycine residues increase backbone flexibility because they have no R group Proline is cyclic Proline residues reduce flexibility of polypeptide chain Proline cis-trans isomerization is often a rate-limiting step in protein folding Recent work suggests it also may also regulate ligand binding in native proteins -Andreotti 15 Cysteines can form disulfide bonds Disulfide bonds (covalent) stabilize 3-D structures In eukaryotes, disulfide bonds are found only in secreted proteins or extracellular domains 16 Globular proteins have a compact hydrophobic core Packing of hydrophobic side chains into interior is main driving force for folding Problem? Polypeptide backbone is highly polar (hydrophilic) due to polar -NH and C=O in each peptide unit; these polar groups must be neutralized Solution? Form regular secondary structures, e.g., α-helix, β-sheet, stabilized by H-bonds Exterior surface of globular proteins is generally hydrophilic Hydrophobic core formed by packed secondary structural elements provides compact, stable core "Functional groups" of protein are attached to this framework; exterior has more flexible regions (loops) and polar/charged residues Hydrophobic "patches" on protein surface are often involved in protein-protein interactions D Dobbs ISU - BCB 444/544X 3

4 Protein Secondary Structures α Helices β Sheets Loops Coils α helix: stabilized by H-bonds between every ~ 4th residue in backbone C = black O = red N = blue Certain amino acids are "preferred" & others are rare in α helices Ala, Glu, Leu, Met = good helix formers Pro, Gly Tyr, Ser = very poor Amino acid composition & distribution varies, depending on on location of helix in 3-D structure β-sheets - also stabilized by H-bonds between back bone atoms Anti-parallel Parallel Connect helices and sheets Vary in length and 3-D configurations Are located on surface of structure Loops Are more "tolerant" of mutations Are more flexible and can adopt multiple conformations Tend to have charged and polar amino acids Are frequently components of active sites Some fall into distinct structural families (e.g., hairpin loops, reverse turns) Coils Regions of 2' structure that are not helices, sheets, or recognizable turns Intrinsically disordered regions appear to play important functional roles D Dobbs ISU - BCB 444/544X 4

5 Globular proteins are built from recurring structural patterns Simple motifs combine to form domains Motifs or supersecondary structures = combinations of 2' structural elements Domains = combinations of motifs Independently folding unit (foldon) Functional unit main classes of protein structure 1) α Domains 2) β Domains 3) α/β Domains Bundles of helices connected by loops Mainly antiparallel sheets, usually with 2 sheets forming sandwich Mainly parallel sheets with intervening helices, also mixed sheets 4) α+β Domains Mainly segregated helices and sheets 5) Multidomain (α & β) Containing domains from more than one class 6) Membrane & cell-surface proteins α-domain structures: 4-helix bundles β-sheets: up-and-down sheets & barrels α/β-domains: leucine-rich motifs can form horseshoes D Dobbs ISU - BCB 444/544X 5

6 New today: Protein Structure Databases Classification Visualization Protein Structure Prediction Secondary structure Tertiary structure Protein sequence databases UniProt (SwissProt, PIR, EBI) NCBI Protein More on these later: protein function prediction Protein sequence & structure: analysis Diamond STING Millennium - many useful structure analysis tools, including Protein Dossier SwissProt (UniProt) protein knowledgebase InterPRO sequence analysis tools Protein structure databases PDB Protein Data Bank MMDB (RCSB) - THE protein structure database Molecular Modeling Database (NCBI Entrez) - has "added" value MSD Molecular Structure Database Especially good for interactions, binding sites Protein structure classification SCOP = Structural Classification of Proteins Levels reflect both evolutionary and structural relationships CATH = Classification by Class, Architecture, Topology & Homology DALI/FSSP (recently moved to EBI & reorganized) fully automated structure alignments DALI server DALI Database (fold classification) 35 Protein structure visualization Molecular Visualization Freeware: MolviZ.Org Protein Explorer RASMOL (& many decendents: Protein Explorer,PyMol, MolMol, etc.) CHIME Cn3D Deep View = Swiss-PDB Viewer 36 D Dobbs ISU - BCB 444/544X 6

7 Protein Structure Databases, cont. PDB (RCSB) RCSB PDB - Beta site MMDB D Dobbs ISU - BCB 444/544X NCBI Structure RCSB PDB - New Tutorial Cn3D

8 MMDB: Molecular Modeling Data Base Searching MMDB Derived PDB structure records Value added to PDB records including: Integration with other ENTREZ databases & tools Conversion to parseable ASN.1 data description language Correction of numbering discrepancies in structure vs sequence Validation Addition of explicit chemical graph information Structure neighbors determined by Vector Alignment Search Tool (VAST) 1CET MMDB Structure Summary Cn3D : Displaying 2' Structures BLAST neighbors VAST neighbors Cn3D viewer Chloroquine Cn3D : Displaying 3' Structures Cn3D: Structural Alignments Chloroquine NADH Chloroquine D Dobbs ISU - BCB 444/544X 8

9 Protein Explorer (RasMol/Chime) Protein Explorer SCOP - Structure Classification CATH - Structure Classification Structural Genomics ~ 30,000 "traditional" genes in human genome (not counting:???) ~ 3,000 proteins in a typical cell > 2 million sequences in UniProt > 33,000 protein structures in the PDB Experimental determination of protein structure lags far behind sequence determination! Goal: Determine structures of "all" protein folds in nature, using combination of experimental structure determination methods (X-ray crystallography, NMR, mass spectrometry) & structure prediction Structural Genomics Projects TargetDB: database of structural genomics targets Protein Structure Prediction? D Dobbs ISU - BCB 444/544X 9

10 Protein Folding "Major unsolved problem in molecular biology" In cells: spontaneous assisted by enzymes assisted by chaperones Steps in Protein Folding 1- "Collapse"- driving force is burial of hydrophobic aa s (fast - msecs) 2- Molten globule - helices & sheets form, but "loose" (slow - secs) 3- "Final" native folded state - compaction, some 2' structures rearranged In vitro: many proteins fold spontaneously & many do not! Native state? - assumed to be lowest free energy - may be an ensemble of structures Protein Dynamics Protein in native state is NOT static Function of many proteins depends on conformational changes, sometimes large, sometimes small Globular proteins are inherently "unstable" (NOT evolved for maximum stability) Energy difference between native and denatured state is very small (5-15 kcal/mol) (this is equivalent to 1 or 2 H-bonds!) Folding involves changes in both entropy & enthalpy Protein Structure Prediction Structure is largely determined by sequence BUT: Similar sequences can assume different structures Dissimilar sequences can assume similar structures Many proteins are multi-functional Protein folding: determination of folding pathways prediction of tertiary structure still largely unsolved problems D Dobbs ISU - BCB 444/544X 10

Protein Folding Problem I400: Introduction to Bioinformatics

Protein Folding Problem I400: Introduction to Bioinformatics Protein Folding Problem I400: Introduction to Bioinformatics November 29, 2004 Protein biomolecule, macromolecule more than 50% of the dry weight of cells is proteins polymer of amino acids connected into

More information

Introduction to Proteins

Introduction to Proteins Introduction to Proteins Lecture 4 Module I: Molecular Structure & Metabolism Molecular Cell Biology Core Course (GSND5200) Matthew Neiditch - Room E450U ICPH matthew.neiditch@umdnj.edu What is a protein?

More information

Structure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München

Structure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Structure formation and association of biomolecules Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Motivation Many biomolecules are chemically synthesized

More information

Programme Good morning and summary of last week Levels of Protein Structure - I Levels of Protein Structure - II

Programme Good morning and summary of last week Levels of Protein Structure - I Levels of Protein Structure - II Programme 8.00-8.10 Good morning and summary of last week 8.10-8.30 Levels of Protein Structure - I 8.30-9.00 Levels of Protein Structure - II 9.00-9.15 Break 9.15-11.15 Exercise: Building a protein model

More information

Protein structure. Wednesday, October 4, 2006

Protein structure. Wednesday, October 4, 2006 Protein structure Wednesday, October 4, 2006 Introduction to Bioinformatics Johns Hopkins School of Public Health 260.602.01 J. Pevsner pevsner@jhmi.edu Copyright notice Many of the images in this powerpoint

More information

CS273: Algorithms for Structure Handout # 5 and Motion in Biology Stanford University Tuesday, 13 April 2004

CS273: Algorithms for Structure Handout # 5 and Motion in Biology Stanford University Tuesday, 13 April 2004 CS273: Algorithms for Structure Handout # 5 and Motion in Biology Stanford University Tuesday, 13 April 2004 Lecture #5: 13 April 2004 Topics: Sequence motif identification Scribe: Samantha Chui 1 Introduction

More information

BIOLOGY 200 Molecular Biology Students registered for the 9:30AM lecture should NOT attend the 4:30PM lecture.

BIOLOGY 200 Molecular Biology Students registered for the 9:30AM lecture should NOT attend the 4:30PM lecture. BIOLOGY 200 Molecular Biology Students registered for the 9:30AM lecture should NOT attend the 4:30PM lecture. Midterm date change! The midterm will be held on October 19th (likely 6-8PM). Contact Kathy

More information

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748

Giri Narasimhan. CAP 5510: Introduction to Bioinformatics. ECS 254; Phone: x3748 CAP 5510: Introduction to Bioinformatics Giri Narasimhan ECS 254; Phone: x3748 giri@cis.fiu.edu www.cis.fiu.edu/~giri/teach/bioinfs07.html 2/19/07 CAP5510 1 HMM for Sequence Alignment 2/19/07 CAP5510 2

More information

Proteins Higher Order Structures

Proteins Higher Order Structures Proteins Higher Order Structures Dr. Mohammad Alsenaidy Department of Pharmaceutics College of Pharmacy King Saud University Office: AA 101 msenaidy@ksu.edu.sa Previously on PHT 426!! Protein Structures

More information

CSE : Computational Issues in Molecular Biology. Lecture 19. Spring 2004

CSE : Computational Issues in Molecular Biology. Lecture 19. Spring 2004 CSE 397-497: Computational Issues in Molecular Biology Lecture 19 Spring 2004-1- Protein structure Primary structure of protein is determined by number and order of amino acids within polypeptide chain.

More information

ONLINE BIOINFORMATICS RESOURCES

ONLINE BIOINFORMATICS RESOURCES Dedan Githae Email: d.githae@cgiar.org BecA-ILRI Hub; Nairobi, Kenya 16 May, 2014 ONLINE BIOINFORMATICS RESOURCES Introduction to Molecular Biology and Bioinformatics (IMBB) 2014 The larger picture.. Lower

More information

Bi 8 Lecture 7. Ellen Rothenberg 26 January Reading: Ch. 3, pp ; panel 3-1

Bi 8 Lecture 7. Ellen Rothenberg 26 January Reading: Ch. 3, pp ; panel 3-1 Bi 8 Lecture 7 PROTEIN STRUCTURE, Functional analysis, and evolution Ellen Rothenberg 26 January 2016 Reading: Ch. 3, pp. 109-134; panel 3-1 (end with free amine) aromatic, hydrophobic small, hydrophilic

More information

Visualizing proteins with PyMol

Visualizing proteins with PyMol Visualizing proteins with PyMol Structural Bioinformatics GENOME 541 Spring 2018 Lecture 1: Protein Structure Frank DiMaio (dimaio@uw.edu) Obtaining PyMOL We will use an educational build of PyMOL that

More information

Fundamentals of Protein Structure

Fundamentals of Protein Structure Outline Fundamentals of Protein Structure Yu (Julie) Chen and Thomas Funkhouser Princeton University CS597A, Fall 2005 Protein structure Primary Secondary Tertiary Quaternary Forces and factors Levels

More information

BIRKBECK COLLEGE (University of London)

BIRKBECK COLLEGE (University of London) BIRKBECK COLLEGE (University of London) SCHOOL OF BIOLOGICAL SCIENCES M.Sc. EXAMINATION FOR INTERNAL STUDENTS ON: Postgraduate Certificate in Principles of Protein Structure MSc Structural Molecular Biology

More information

STRUCTURAL BIOLOGY. α/β structures Closed barrels Open twisted sheets Horseshoe folds

STRUCTURAL BIOLOGY. α/β structures Closed barrels Open twisted sheets Horseshoe folds STRUCTURAL BIOLOGY α/β structures Closed barrels Open twisted sheets Horseshoe folds The α/β domains Most frequent domain structures are α/β domains: A central parallel or mixed β sheet Surrounded by α

More information

Protein Structure/Function Relationships

Protein Structure/Function Relationships Protein Structure/Function Relationships W. M. Grogan, Ph.D. OBJECTIVES 1. Describe and cite examples of fibrous and globular proteins. 2. Describe typical tertiary structural motifs found in proteins.

More information

Protein Structure. Protein Structure Tertiary & Quaternary

Protein Structure. Protein Structure Tertiary & Quaternary Lecture 4 Protein Structure Protein Structure Tertiary & Quaternary Dr. Sameh Sarray Hlaoui Primary structure: The linear sequence of amino acids held together by peptide bonds. Secondary structure: The

More information

CFSSP: Chou and Fasman Secondary Structure Prediction server

CFSSP: Chou and Fasman Secondary Structure Prediction server Wide Spectrum, Vol. 1, No. 9, (2013) pp 15-19 CFSSP: Chou and Fasman Secondary Structure Prediction server T. Ashok Kumar Department of Bioinformatics, Noorul Islam College of Arts and Science, Kumaracoil

More information

Lecture 9 (10/2/17) Lecture 9 (10/2/17)

Lecture 9 (10/2/17) Lecture 9 (10/2/17) Lecture 9 (10/2/17) Reading: Ch4; 119-122, 125-126, 131-133 (a-helix) Ch4; 123-124, 130-131, 133, 137-138 (b-sheets) Problems: Ch4 (text); 2, 3, 4, 8, 13, 14 NEXT Reading: Ch4; 125, 138-141, 141-142 Problems:

More information

Virtual bond representation

Virtual bond representation Today s subjects: Virtual bond representation Coordination number Contact maps Sidechain packing: is it an instrumental way of selecting and consolidating a fold? ASA of proteins Interatomic distances

More information

Sequence Analysis '17 -- lecture Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction

Sequence Analysis '17 -- lecture Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction Sequence Analysis '17 -- lecture 16 1. Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction Alpha helix Right-handed helix. H-bond is from the oxygen at i to the nitrogen

More information

If you wish to have extra practice with swiss pdb viewer or to familiarize yourself with how to use the program here is a tutorial:

If you wish to have extra practice with swiss pdb viewer or to familiarize yourself with how to use the program here is a tutorial: Name (s): Swiss PDB viewer assignment chapter 4. If you wish to have extra practice with swiss pdb viewer or to familiarize yourself with how to use the program here is a tutorial: http://spdbv.vital-it.ch/themolecularlevel/spvtut/index.html

More information

Overview. Secondary Structure. Tertiary Structure

Overview. Secondary Structure. Tertiary Structure Protein Structure Disclaimer: All information and images were taken from outside sources and the author claims no legal ownership of any material. Sources for images are linked on each slide and the information

More information

Protein Bioinformatics Part I: Access to information

Protein Bioinformatics Part I: Access to information Protein Bioinformatics Part I: Access to information 260.655 April 6, 2006 Jonathan Pevsner, Ph.D. pevsner@kennedykrieger.org Outline [1] Proteins at NCBI RefSeq accession numbers Cn3D to visualize structures

More information

Molecular Modeling 9. Protein structure prediction, part 2: Homology modeling, fold recognition & threading

Molecular Modeling 9. Protein structure prediction, part 2: Homology modeling, fold recognition & threading Molecular Modeling 9 Protein structure prediction, part 2: Homology modeling, fold recognition & threading The project... Remember: You are smarter than the program. Inspecting the model: Are amino acids

More information

Molecular Modeling Lecture 8. Local structure Database search Multiple alignment Automated homology modeling

Molecular Modeling Lecture 8. Local structure Database search Multiple alignment Automated homology modeling Molecular Modeling 2018 -- Lecture 8 Local structure Database search Multiple alignment Automated homology modeling An exception to the no-insertions-in-helix rule Actual structures (myosin)! prolines

More information

Algorithms in Bioinformatics ONE Transcription Translation

Algorithms in Bioinformatics ONE Transcription Translation Algorithms in Bioinformatics ONE Transcription Translation Sami Khuri Department of Computer Science San José State University sami.khuri@sjsu.edu Biology Review DNA RNA Proteins Central Dogma Transcription

More information

Molecular Structures

Molecular Structures Molecular Structures 1 Molecular structures 2 Why is it important? Answers to scientific questions such as: What does the structure of protein X look like? Can we predict the binding of molecule X to Y?

More information

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,

More information

Bioinformatics & Protein Structural Analysis. Bioinformatics & Protein Structural Analysis. Learning Objective. Proteomics

Bioinformatics & Protein Structural Analysis. Bioinformatics & Protein Structural Analysis. Learning Objective. Proteomics The molecular structures of proteins are complex and can be defined at various levels. These structures can also be predicted from their amino-acid sequences. Protein structure prediction is one of the

More information

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,

More information

Translation. Protein Synthesis

Translation. Protein Synthesis Protein Structure Translation Protein Synthesis Size and Shape Comparison of Proteins Levels of Protein Structure 1 o 2 o 3 o 4 o Amino Acids Peptide Bonds Proteins are formed by creating peptide bonds

More information

Structural Bioinformatics (C3210) Conformational Analysis Protein Folding Protein Structure Prediction

Structural Bioinformatics (C3210) Conformational Analysis Protein Folding Protein Structure Prediction Structural Bioinformatics (C3210) Conformational Analysis Protein Folding Protein Structure Prediction Conformational Analysis 2 Conformational Analysis Properties of molecules depend on their three-dimensional

More information

Molecular Structures

Molecular Structures Molecular Structures 1 Molecular structures 2 Why is it important? Answers to scientific questions such as: What does the structure of protein X look like? Can we predict the binding of molecule X to Y?

More information

KEMM15 Lecture note in structural bioinformatics: A practical guide. S Al-Karadaghi, Biochemistry & Structural Biology, Lund University

KEMM15 Lecture note in structural bioinformatics: A practical guide. S Al-Karadaghi, Biochemistry & Structural Biology, Lund University KEMM15 Lecture note in structural bioinformatics: A practical guide S Al-Karadaghi, Biochemistry & Structural Biology, Lund University 1 BASICS OF PROTEIN STRUCTURE 3 SOME DEFINITIONS 3 THE 20 AMINO ACIDS

More information

Bioinformatics. ONE Introduction to Biology. Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012

Bioinformatics. ONE Introduction to Biology. Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012 Bioinformatics ONE Introduction to Biology Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012 Biology Review DNA RNA Proteins Central Dogma Transcription Translation

More information

6-Foot Mini Toober Activity

6-Foot Mini Toober Activity Big Idea The interaction between the substrate and enzyme is highly specific. Even a slight change in shape of either the substrate or the enzyme may alter the efficient and selective ability of the enzyme

More information

Textbook Reading Guidelines

Textbook Reading Guidelines Understanding Bioinformatics by Marketa Zvelebil and Jeremy Baum Last updated: May 1, 2009 Textbook Reading Guidelines Preface: Read the whole preface, and especially: For the students with Life Science

More information

Proteins the primary biological macromolecules of living organisms

Proteins the primary biological macromolecules of living organisms Proteins the primary biological macromolecules of living organisms Protein structure and folding Primary Secondary Tertiary Quaternary structure of proteins Structure of Proteins Protein molecules adopt

More information

BMB/Bi/Ch 170 Fall 2017 Problem Set 1: Proteins I

BMB/Bi/Ch 170 Fall 2017 Problem Set 1: Proteins I BMB/Bi/Ch 170 Fall 2017 Problem Set 1: Proteins I Please use ray-tracing feature for all the images you are submitting. Use either the Ray button on the right side of the command window in PyMOL or variations

More information

Basic concepts of molecular biology

Basic concepts of molecular biology Basic concepts of molecular biology Gabriella Trucco Email: gabriella.trucco@unimi.it Life The main actors in the chemistry of life are molecules called proteins nucleic acids Proteins: many different

More information

Protein Sequence Analysis. BME 110: CompBio Tools Todd Lowe April 19, 2007 (Slide Presentation: Carol Rohl)

Protein Sequence Analysis. BME 110: CompBio Tools Todd Lowe April 19, 2007 (Slide Presentation: Carol Rohl) Protein Sequence Analysis BME 110: CompBio Tools Todd Lowe April 19, 2007 (Slide Presentation: Carol Rohl) Linear Sequence Analysis What can you learn from a (single) protein sequence? Calculate it s physical

More information

This practical aims to walk you through the process of text searching DNA and protein databases for sequence entries.

This practical aims to walk you through the process of text searching DNA and protein databases for sequence entries. PRACTICAL 1: BLAST and Sequence Alignment The EBI and NCBI websites, two of the most widely used life science web portals are introduced along with some of the principal databases: the NCBI Protein database,

More information

MATH 5610, Computational Biology

MATH 5610, Computational Biology MATH 5610, Computational Biology Lecture 2 Intro to Molecular Biology (cont) Stephen Billups University of Colorado at Denver MATH 5610, Computational Biology p.1/24 Announcements Error on syllabus Class

More information

Amino Acids. Amino Acid Structure

Amino Acids. Amino Acid Structure Amino Acids Pratt & Cornely Chapter 4 Alpha carbon Sidechain Proteins peptides Amino Acid Structure 1 L amino acids Glycine R/S vs D/L L isoleucine racemization Stereochemisty Common Amino Acids 2 Which

More information

Fundamentals of Biochemistry

Fundamentals of Biochemistry Donald Voet Judith G. Voet Charlotte W. Pratt Fundamentals of Biochemistry Second Edition Chapter 6: Proteins: Three-Dimensional Structure Copyright 2006 by John Wiley & Sons, Inc. 1958, John Kendrew Any

More information

Collagen. 7.88J Protein Folding. Prof. David Gossard October 20, 2003

Collagen. 7.88J Protein Folding. Prof. David Gossard October 20, 2003 Collagen 7.88J Protein Folding Prof. David Gossard October 20, 2003 PDB Acknowledgements The Protein Data Bank (PDB - http://www.pdb.org/) is the single worldwide repository for the processing and distribution

More information

Protein Folding BIBC 100

Protein Folding BIBC 100 Protein Folding BIBC 100 The Folding Problem How Proteins Fold? Consider a protein with 100 a.a. 10 100 possible conformations (avg. of 10 conformations/a.a.) If it converts from one conformation to another

More information

Ch Biophysical Chemistry

Ch Biophysical Chemistry Ch 247.53. Biophysical Chemistry Nina Rosario L. Rojas 2012-2013 sem 1 Review of Protein Structure Why structure? Primary, secondary, tertiary structure Disulfide bonds scheme 2 STRUCTURE- REGULAR STRUCTURE

More information

Problem: The GC base pairs are more stable than AT base pairs. Why? 5. Triple-stranded DNA was first observed in 1957. Scientists later discovered that the formation of triplestranded DNA involves a type

More information

Chapter 1 -- Life. Chapter 2 -- Atoms, Molecules and Bonds. Chapter 3 -- Water

Chapter 1 -- Life. Chapter 2 -- Atoms, Molecules and Bonds. Chapter 3 -- Water Chapter 1 -- Life In the beginning... Molecular evolution Heirarchy and organization levels of organization Form follows function Language in science Cell and Molecular Biology -- Biology 20A Chapter Outlines

More information

Protein Structure Prediction

Protein Structure Prediction Homology Modeling Protein Structure Prediction Ingo Ruczinski M T S K G G G Y F F Y D E L Y G V V V V L I V L S D E S Department of Biostatistics, Johns Hopkins University Fold Recognition b Initio Structure

More information

Zool 3200: Cell Biology Exam 3 3/6/15

Zool 3200: Cell Biology Exam 3 3/6/15 Name: Trask Zool 3200: Cell Biology Exam 3 3/6/15 Answer each of the following questions in the space provided; circle the correct answer or answers for each multiple choice question and circle either

More information

Nucleic Acids, Proteins, and Enzymes

Nucleic Acids, Proteins, and Enzymes 3 Nucleic Acids, Proteins, and Enzymes Chapter 3 Nucleic Acids, Proteins, and Enzymes Key Concepts 3.1 Nucleic Acids Are Informational Macromolecules 3.2 Proteins Are Polymers with Important Structural

More information

STRUCTURE, DYNAMICS AND INTERACTIONS OF PROTEINS BY NMR SPECTROSCOPY

STRUCTURE, DYNAMICS AND INTERACTIONS OF PROTEINS BY NMR SPECTROSCOPY STRUCTURE, DYNAMICS AND INTERACTIONS OF PROTEINS BY NMR SPECTROSCOPY Constantin T. Craescu INSERM & Institut Curie - Recherche Orsay, France A SHORT INTRODUCTION TO PROTEIN STRUCTURE Chemical composition

More information

EE550 Computational Biology

EE550 Computational Biology EE550 Computational Biology Week 1 Course Notes Instructor: Bilge Karaçalı, PhD Syllabus Schedule : Thursday 13:30, 14:30, 15:30 Text : Paul G. Higgs, Teresa K. Attwood, Bioinformatics and Molecular Evolution,

More information

Amino Acids and Proteins

Amino Acids and Proteins Various Functions of Proteins SB203 Amino Acids and Proteins Jirundon Yuvaniyama, Ph.D. Department of Biochemistry Faculty of Science Mahidol University Enzymes Transport proteins utrient and storage proteins

More information

Biochem Fall Sample Exam I Protein Structure. Vasopressin: CYFQNCPRG Oxytocin: CYIQNCPLG

Biochem Fall Sample Exam I Protein Structure. Vasopressin: CYFQNCPRG Oxytocin: CYIQNCPLG Biochem Fall 2011 1. Primary Structure and amino acid chemistry Sample Exam I Protein Structure The peptide hormones vasopressin (ADH) and oxytocin each contain only nine amino acids. Vasopressin is an

More information

Basic concepts of molecular biology

Basic concepts of molecular biology Basic concepts of molecular biology Gabriella Trucco Email: gabriella.trucco@unimi.it What is life made of? 1665: Robert Hooke discovered that organisms are composed of individual compartments called cells

More information

Solutions to Problem Set 1

Solutions to Problem Set 1 MIT Department of Biology 7.014 Introductory Biology, Spring 004 Question 1 Solutions to 7.014 Problem Set 1 a) Describe the conditions of the atmosphere on prebiotic earth and how these conditions differ

More information

Bioinformatics Prof. M. Michael Gromiha Department of Biotechnology Indian Institute of Technology, Madras. Lecture - 5a Protein sequence databases

Bioinformatics Prof. M. Michael Gromiha Department of Biotechnology Indian Institute of Technology, Madras. Lecture - 5a Protein sequence databases Bioinformatics Prof. M. Michael Gromiha Department of Biotechnology Indian Institute of Technology, Madras Lecture - 5a Protein sequence databases In this lecture, we will mainly discuss on Protein Sequence

More information

Bioinformatics Tools. Stuart M. Brown, Ph.D Dept of Cell Biology NYU School of Medicine

Bioinformatics Tools. Stuart M. Brown, Ph.D Dept of Cell Biology NYU School of Medicine Bioinformatics Tools Stuart M. Brown, Ph.D Dept of Cell Biology NYU School of Medicine Bioinformatics Tools Stuart M. Brown, Ph.D Dept of Cell Biology NYU School of Medicine Overview This lecture will

More information

PROTEINS & NUCLEIC ACIDS

PROTEINS & NUCLEIC ACIDS Chapter 3 Part 2 The Molecules of Cells PROTEINS & NUCLEIC ACIDS Lecture by Dr. Fernando Prince 3.11 Nucleic Acids are the blueprints of life Proteins are the machines of life We have already learned that

More information

Comparative Modeling Part 1. Jaroslaw Pillardy Computational Biology Service Unit Cornell Theory Center

Comparative Modeling Part 1. Jaroslaw Pillardy Computational Biology Service Unit Cornell Theory Center Comparative Modeling Part 1 Jaroslaw Pillardy Computational Biology Service Unit Cornell Theory Center Function is the most important feature of a protein Function is related to structure Structure is

More information

Proteins and folding

Proteins and folding Proteins and folding October 8th, 2013. Kinga Futó Biopolymers Mitotic spindle of a dividing cell Actin filament network in the epidermal cell of Tobacco leaf. DNA strand released from bacteriophage 1

More information

1-D Predictions. Prediction of local features: Secondary structure & surface exposure

1-D Predictions. Prediction of local features: Secondary structure & surface exposure Programme 8.00-8.30 Last week s quiz results 8.30-9.00 Prediction of secondary structure & surface exposure 9.00-9.20 Protein disorder prediction 9.20-9.30 Break get computers upstairs 9.30-11.00 Ex.:

More information

G4120: Introduction to Computational Biology

G4120: Introduction to Computational Biology ICB Fall 2004 G4120: Computational Biology Oliver Jovanovic, Ph.D. Columbia University Department of Microbiology Copyright 2004 Oliver Jovanovic, All Rights Reserved. Analysis of Protein Sequences Coding

More information

An insilico Approach: Homology Modelling and Characterization of HSP90 alpha Sangeeta Supehia

An insilico Approach: Homology Modelling and Characterization of HSP90 alpha Sangeeta Supehia 259 Journal of Pharmaceutical, Chemical and Biological Sciences ISSN: 2348-7658 Impact Factor (SJIF): 2.092 December 2014-February 2015; 2(4):259-264 Available online at http://www.jpcbs.info Online published

More information

BETA STRAND Prof. Alejandro Hochkoeppler Department of Pharmaceutical Sciences and Biotechnology University of Bologna

BETA STRAND Prof. Alejandro Hochkoeppler Department of Pharmaceutical Sciences and Biotechnology University of Bologna Prof. Alejandro Hochkoeppler Department of Pharmaceutical Sciences and Biotechnology University of Bologna E-mail: a.hochkoeppler@unibo.it C-ter NH and CO groups: right, left, right (plane of the slide)

More information

(Refer Slide Time: 00:15)

(Refer Slide Time: 00:15) (Refer Slide Time: 00:15) Proteins and Gel-Based Proteomics Professor Sanjeeva Srivastava Department of Biosciences and Bioengineering Indian Institute of Technology, Bombay Mod 02 Lecture Number 3 Let

More information

Nucleic acid and protein Flow of genetic information

Nucleic acid and protein Flow of genetic information Nucleic acid and protein Flow of genetic information References: Glick, BR and JJ Pasternak, 2003, Molecular Biotechnology: Principles and Applications of Recombinant DNA, ASM Press, Washington DC, pages.

More information

Diversity of proteins

Diversity of proteins BCMB 3100: Partial notes Chapter 4 (Part 1) Diversity of proteins 3D structure of proteins Fibrous vs globular proteins Conformation vs configuration 1, 2, 3 and 4 structure Peptide groups in polypeptide

More information

Diversity of proteins

Diversity of proteins BCMB 3100: Partial notes Chapter 4 (Part 1) Diversity of proteins 3D structure of proteins Fibrous vs globular proteins Conformation vs configuration 1, 2, 3 and 4 structure Peptide groups in polypeptide

More information

Learning to Use PyMOL (includes instructions for PS #2)

Learning to Use PyMOL (includes instructions for PS #2) Learning to Use PyMOL (includes instructions for PS #2) To begin, download the saved PyMOL session file, 4kyz.pse from the Chem 391 Assignments web page: http://people.reed.edu/~glasfeld/chem391/assign.html

More information

Chapter 17. Prediction, Engineering, and Design of Protein Structures

Chapter 17. Prediction, Engineering, and Design of Protein Structures Chapter 17. Prediction, Engineering, and Design of Protein Structures Homologous proteins have similar structure and function Branden & Tooze (1998), Introduction to protein structure, 2 nd ed., p.349.

More information

CS612 - Algorithms in Bioinformatics

CS612 - Algorithms in Bioinformatics Spring 2012 Class 6 February 9, 2012 Backbone and Sidechain Rotational Degrees of Freedom Protein 3-D Structure The 3-dimensional fold of a protein is called a tertiary structure. Many proteins consist

More information

Dr. R. Sankar, BSE 631 (2018)

Dr. R. Sankar, BSE 631 (2018) Pauling, Corey and Branson Diffraction of DNA http://www.nature.com/scitable/topicpage/dna-is-a-structure-that-encodes-biological-6493050 In short, stereochemistry is important in determining which helices

More information

Sequence Databases and database scanning

Sequence Databases and database scanning Sequence Databases and database scanning Marjolein Thunnissen Lund, 2012 Types of databases: Primary sequence databases (proteins and nucleic acids). Composite protein sequence databases. Secondary databases.

More information

Structural Bioinformatics (C3210) DNA and RNA Structure

Structural Bioinformatics (C3210) DNA and RNA Structure Structural Bioinformatics (C3210) DNA and RNA Structure Importance of DNA/RNA 3D Structure Nucleic acids are essential materials found in all living organisms. Their main function is to maintain and transmit

More information

BCH222 - Greek Key β Barrels

BCH222 - Greek Key β Barrels BCH222 - Greek Key β Barrels Reading C.I. Branden and J. Tooze (1999) Introduction to Protein Structure, Second Edition, pp. 77-78 & 335-336 (look at the color figures) J.S. Richardson (1981) "The Anatomy

More information

Textbook Reading Guidelines

Textbook Reading Guidelines Understanding Bioinformatics by Marketa Zvelebil and Jeremy Baum Last updated: January 16, 2013 Textbook Reading Guidelines Preface: Read the whole preface, and especially: For the students with Life Science

More information

The mechanism(s) of protein folding. What is meant by mechanism. Experimental approaches

The mechanism(s) of protein folding. What is meant by mechanism. Experimental approaches The mechanism(s) of protein folding What is meant by mechanism Computational approaches Experimental approaches Questions: What events occur and in what time sequence when a protein folds Is there a specified

More information

Protein Structure Analysis

Protein Structure Analysis BINF 731 Protein Structure Analysis http://binf.gmu.edu/vaisman/binf731/ Secondary Structure: Computational Problems Secondary structure characterization Secondary structure assignment Secondary structure

More information

Gene Regulation 10/19/05

Gene Regulation 10/19/05 10/19/05 Gene Regulation (formerly Gene Prediction - 2) Gene Prediction & Regulation Mon - Overview & Gene structure review: Eukaryotes vs prokaryotes Wed - Regulatory regions: Promoters & enhancers -

More information

Protein 3D Structure Prediction

Protein 3D Structure Prediction Protein 3D Structure Prediction Michael Tress CNIO ?? MREYKLVVLGSGGVGKSALTVQFVQGIFVDE YDPTIEDSYRKQVEVDCQQCMLEILDTAGTE QFTAMRDLYMKNGQGFALVYSITAQSTFNDL QDLREQILRVKDTEDVPMILVGNKCDLEDER VVGKEQGQNLARQWCNCAFLESSAKSKINVN

More information

Promoter Prediction (really) 10/26/05

Promoter Prediction (really) 10/26/05 10/26/05 Promoter Prediction (really!) Announcements BCB Link for Seminar Schedules (updated) http://www.bcb.iastate.edu/seminars/inde.html Seminar (Fri Oct 28) 12:10 PM BCB Faculty Seminar in E164 Lagomarcino

More information

Immune system IgGs. Carla Cortinas, Eva Espigulé, Guillem Lopez-Grado, Margalida Roig, Valentina Salas. Group 2

Immune system IgGs. Carla Cortinas, Eva Espigulé, Guillem Lopez-Grado, Margalida Roig, Valentina Salas. Group 2 Immune system IgGs Carla Cortinas, Eva Espigulé, Guillem Lopez-Grado, Margalida Roig, Valentina Salas Group 2 Index 1. Introduction 1.1. 1.2. 1.3. 1.4. 2. Immunoglobulins IgG formation IgG subclasses Structural

More information

Proteins: Wide range of func2ons. Polypep2des. Amino Acid Monomers

Proteins: Wide range of func2ons. Polypep2des. Amino Acid Monomers Proteins: Wide range of func2ons Proteins coded in DNA account for more than 50% of the dry mass of most cells Protein func9ons structural support storage transport cellular communica9ons movement defense

More information

AP Biology Book Notes Chapter 3 v Nucleic acids Ø Polymers specialized for the storage transmission and use of genetic information Ø Two types DNA

AP Biology Book Notes Chapter 3 v Nucleic acids Ø Polymers specialized for the storage transmission and use of genetic information Ø Two types DNA AP Biology Book Notes Chapter 3 v Nucleic acids Ø Polymers specialized for the storage transmission and use of genetic information Ø Two types DNA Encodes hereditary information Used to specify the amino

More information

Structural bioinformatics

Structural bioinformatics Structural bioinformatics Why structures? The representation of the molecules in 3D is more informative New properties of the molecules are revealed, which can not be detected by sequences Eran Eyal Plant

More information

Structure & Function. Ulf Leser

Structure & Function. Ulf Leser Proteins: Structure & Function Ulf Leser This Lecture Introduction Structure Function Databases Predicting Protein Secondary Structure Many figures from Zvelebil, M. and Baum, J. O. (2008). "Understanding

More information

LIST OF ACRONYMS & ABBREVIATIONS

LIST OF ACRONYMS & ABBREVIATIONS LIST OF ACRONYMS & ABBREVIATIONS ALA ARG ASN ATD CRD CYS GLN GLU GLY GPCR HIS hstr ILE LEU LYS MET mglur1 NHDC PDB PHE PRO SER T1R2 T1R3 TMD TRP TYR THR 7-TM VFTM ZnSO 4 Alanine, A Arginine, R Asparagines,

More information

Suppl. Figure 1: RCC1 sequence and sequence alignments. (a) Amino acid

Suppl. Figure 1: RCC1 sequence and sequence alignments. (a) Amino acid Supplementary Figures Suppl. Figure 1: RCC1 sequence and sequence alignments. (a) Amino acid sequence of Drosophila RCC1. Same colors are for Figure 1 with sequence of β-wedge that interacts with Ran in

More information

Solutions to 7.02 Quiz II 10/27/05

Solutions to 7.02 Quiz II 10/27/05 Solutions to 7.02 Quiz II 10/27/05 Class Average = 83 Standard Deviation = 9 Range Grade % 87-100 A 43 74-86 B 39 55-73 C 17 > 54 D 1 Question 1 (56 points) While studying deep sea bacteria, you discover

More information

Chapter 8. One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model. Sebastian Kmiecik and Andrzej Kolinski.

Chapter 8. One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model. Sebastian Kmiecik and Andrzej Kolinski. Chapter 8 One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model Abstract Despite the significant increase in computational power, molecular modeling of protein structure using

More information

NCBI web resources I: databases and Entrez

NCBI web resources I: databases and Entrez NCBI web resources I: databases and Entrez Yanbin Yin Most materials are downloaded from ftp://ftp.ncbi.nih.gov/pub/education/ 1 Homework assignment 1 Two parts: Extract the gene IDs reported in table

More information

SECONDARY STRUCTURE AND OTHER 1D PREDICTION MICHAEL TRESS, CNIO

SECONDARY STRUCTURE AND OTHER 1D PREDICTION MICHAEL TRESS, CNIO SECONDARY STRUCTURE AND OTHER 1D PREDICTION MICHAEL TRESS, CNIO Amino acids have characteristic local features Protein structures have limited room for manoeuvre because the peptide bond is planar, there

More information

Introduction to Cellular Biology and Bioinformatics. Farzaneh Salari

Introduction to Cellular Biology and Bioinformatics. Farzaneh Salari Introduction to Cellular Biology and Bioinformatics Farzaneh Salari Outline Bioinformatics Cellular Biology A Bioinformatics Problem What is bioinformatics? Computer Science Statistics Bioinformatics Mathematics...

More information

Introduction to Bioinformatics Online Course: IBT

Introduction to Bioinformatics Online Course: IBT Introduction to Bioinformatics Online Course: IBT Multiple Sequence Alignment Building Multiple Sequence Alignment Lec6:Interpreting Your Multiple Sequence Alignment Interpreting Your Multiple Sequence

More information