Proteins. Amino Acids (APK) Peptides (APK) 5/23/2012. Peptide bond. Acid. Amino
|
|
- Priscilla Barber
- 6 years ago
- Views:
Transcription
1 Proteins Amino Acids (APK) Acid Amino Image courtesy of Biotech (biotech.chem.indiana.edu/pages/ protein_intro.html) Peptides (APK) Peptide bond 1
2 Proteins (polypeptides) Segment of a protein Peptide bonds Amino acids in foods Aliphatic amino acids gly, ala, leu Hydroxyl-containing amino acids ser, thr Sulfur-containing amino acids cys, met Acidic amino acids asp, glu Amino acids in foods Basic amino acids lys, his Aromatic amino acids phe, tyr Imino acids pro 2
3 Levels of protein structure (APK) Primary Secondary Tertiary Quaternary Primary (APK) Aa1-aa2-aa3-aa4-aa5-aa6-aa7-.aan A list of the amino acids from one end of the protein to the other. Secondary (APK) Alpha helix Beta pleated sheet 3
4 Alpha helix chirality (APK) Alpha helix Examples Myosin - a muscle protein Epidermin - skin protein Fibrinogen - blood clotting protein Sheep s wool - most alpha helix These proteins are very flexible and extensible but not too strong Kinemage Beta pleated sheet (APK) 4
5 Beta pleated sheet Examples Bird feathers Silk These proteins are very strong but not very extensible Kinemage Tertiary (APK) Tertiary (hexokinase) Image courtesy of MIT Biology Hypertextbook (esg- edu:8001/esgbio/7001main.html 5
6 Quaternary structure Active Inactive Quaternary structure (hemoglobin) Four subunits Heme group Image courtesy of MIT Biology Hypertextbook (esg- edu:8001/esgbio/7001main.html Stabilizing forces in protein structure Hydrogen bond Dipole interaction Hydrophobic interaction Disulfide linkage Ionic interaction 6
7 Hydrogen bond C O H N Dipole interaction OH HCH HCH OH Hydrophobic interaction Two interacting aromatic phenyl (benzene) rings 7
8 Disulfide linkage RSH HSR Disulfide linkage RS SR Ionic interaction H NH H OOC 8
9 Hydrophobic interaction and protein folding water Conjugated proteins Glycoproteins--contain CHO s Ovomucoid in egg white Lipoproteins--contain fatty acids Good emulsifiers Provide mechanism for lipid transport Occur in membranes Metalloproteins Hemoglobin Myoglobin Conjugated proteins Phosphoproteins Casein Pepsin Protein + prosthetic group = holoenzyme 9
10 Functions of proteins Surface active agents (surfactants) Good as emulsifiers High water binding capacity Gelatin Coagulation Milk into cheese Enzymatic activity Many examples Proteins in dispersion Forms a sol Generally increases dispersion viscosity This may be due to denaturation of the secondary and tertiary structures of the protein Protein sol viscosity Assuming similar molecular weights, it depends on the tertiary structure (molecular shape) Fibrous higher viscosity Globular lower viscosity 10
11 Denaturation Denaturing agent Native state Denatured The protein depicted here is crambin, a plant seed protein. Denaturation Denaturing agents Heat Cooking (sol to a gel) Change in ph Add acid (sol to a gel) Enzymes Rennin (sol to a gel) 11
12 Denaturing agents Mechanical shearing Beating egg whites or whipping cream (sol to a foam) Change in ionic strength Presence of detergents The last two are primarily of interest in laboratory investigation of proteins. Possible results of denaturation Decrease in protein solubility Increase in dispersion viscosity Increased reactivity of R groups Loss of enzymatic activity Increased digestibility of proteins Coagulation/gel formation Gel structure Denaturation 12
13 Gel structure Association and formation of junction zones This is a gel! Denaturation and gelation This is available from the web site on the PowerPoint animation page Isoelectric point protein protein protein Isoelectric point (zero net charge) Proteins dispersions are least stable (most likely to form a gel) at their isoelectric point, due to the absence of electrical repulsion. 13
14 Proteins as structure forming agents in foods Casein - in cheese making Egg proteins - thickening agents, sauces, custards Grains - gluten formation 14
MOLEBIO LAB #3: Electrophoretic Separation of Proteins
MOLEBIO LAB #3: Electrophoretic Separation of Proteins Introduction: Proteins occupy a central position in the structure and function of all living organisms. Some proteins serve as structural components
More information6- Important Molecules of Living Systems. Proteins Nucleic Acids Taft College Human Physiology
6- Important Molecules of Living Systems Proteins Nucleic Acids Taft College Human Physiology Proteins Proteins- made from: C, H, O, N, and S. Proteins are very large molecules composed of long chains
More informationProteins Higher Order Structures
Proteins Higher Order Structures Dr. Mohammad Alsenaidy Department of Pharmaceutics College of Pharmacy King Saud University Office: AA 101 msenaidy@ksu.edu.sa Previously on PHT 426!! Protein Structures
More informationZool 3200: Cell Biology Exam 3 3/6/15
Name: Trask Zool 3200: Cell Biology Exam 3 3/6/15 Answer each of the following questions in the space provided; circle the correct answer or answers for each multiple choice question and circle either
More informationIntroduction to Proteins
Introduction to Proteins Lecture 4 Module I: Molecular Structure & Metabolism Molecular Cell Biology Core Course (GSND5200) Matthew Neiditch - Room E450U ICPH matthew.neiditch@umdnj.edu What is a protein?
More informationCase 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005
Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 9 September 005 Focus concept Purification of a novel seed storage protein allows sequence analysis and
More informationPurification: Step 1. Lecture 11 Protein and Peptide Chemistry. Cells: Break them open! Crude Extract
Purification: Step 1 Lecture 11 Protein and Peptide Chemistry Cells: Break them open! Crude Extract Total contents of cell Margaret A. Daugherty Fall 2003 Big Problem: Crude extract is not the natural
More informationPurification: Step 1. Protein and Peptide Chemistry. Lecture 11. Big Problem: Crude extract is not the natural environment. Cells: Break them open!
Lecture 11 Protein and Peptide Chemistry Margaret A. Daugherty Fall 2003 Purification: Step 1 Cells: Break them open! Crude Extract Total contents of cell Big Problem: Crude extract is not the natural
More informationChapter 3 Nucleic Acids, Proteins, and Enzymes
3 Nucleic Acids, Proteins, and Enzymes Chapter 3 Nucleic Acids, Proteins, and Enzymes Key Concepts 3.1 Nucleic Acids Are Informational Macromolecules 3.2 Proteins Are Polymers with Important Structural
More informationNanobiotechnology. Place: IOP 1 st Meeting Room Time: 9:30-12:00. Reference: Review Papers. Grade: 50% midterm, 50% final.
Nanobiotechnology Place: IOP 1 st Meeting Room Time: 9:30-12:00 Reference: Review Papers Grade: 50% midterm, 50% final Midterm: 5/15 History Atom Earth, Air, Water Fire SEM: 20-40 nm Silver 66.2% Gold
More informationFrom DNA to Protein Structure and Function
STO-106 From DNA to Protein Structure and Function Teacher information Summary: Students model how information in the DNA base sequences is transcribed and translated to produce a protein molecule. They
More informationNucleic Acids, Proteins, and Enzymes
3 Nucleic Acids, Proteins, and Enzymes Chapter 3 Nucleic Acids, Proteins, and Enzymes Key Concepts 3.1 Nucleic Acids Are Informational Macromolecules 3.2 Proteins Are Polymers with Important Structural
More informationBi 8 Lecture 7. Ellen Rothenberg 26 January Reading: Ch. 3, pp ; panel 3-1
Bi 8 Lecture 7 PROTEIN STRUCTURE, Functional analysis, and evolution Ellen Rothenberg 26 January 2016 Reading: Ch. 3, pp. 109-134; panel 3-1 (end with free amine) aromatic, hydrophobic small, hydrophilic
More informationPacking of Secondary Structures
7.88 Lecture Notes - 5 7.24/7.88J/5.48J The Protein Folding and Human Disease Packing of Secondary Structures Packing of Helices against sheets Packing of sheets against sheets Parallel Orthogonal Table:
More informationFolding simulation: self-organization of 4-helix bundle protein. yellow = helical turns
Folding simulation: self-organization of 4-helix bundle protein yellow = helical turns Protein structure Protein: heteropolymer chain made of amino acid residues R + H 3 N - C - COO - H φ ψ Chain of amino
More informationStructure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München
Structure formation and association of biomolecules Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Motivation Many biomolecules are chemically synthesized
More information11 questions for a total of 120 points
Your Name: BYS 201, Final Exam, May 3, 2010 11 questions for a total of 120 points 1. 25 points Take a close look at these tables of amino acids. Some of them are hydrophilic, some hydrophobic, some positive
More informationThr Gly Tyr. Gly Lys Asn
Your unique body characteristics (traits), such as hair color or blood type, are determined by the proteins your body produces. Proteins are the building blocks of life - in fact, about 45% of the human
More information1. DNA, RNA structure. 2. DNA replication. 3. Transcription, translation
1. DNA, RNA structure 2. DNA replication 3. Transcription, translation DNA and RNA are polymers of nucleotides DNA is a nucleic acid, made of long chains of nucleotides Nucleotide Phosphate group Nitrogenous
More informationAdvanced Level Biology BRIDGING WORK
Advanced Level Biology BRIDGING WORK The bridging work MUST be completed for each of your Advanced Level subjects by the time you start your course. Your work will be assessed in September. Anyone not
More informationRead and take notes on pages
Protein Synthesis Read and take notes on pages 336-340 What is protein? Proteins Polypeptide chains of amino acids Are enzymes that catalyze biochemical reactions and are vital to metabolism. They have
More informationLife+ 12 ENV/IT GreenWoolF: Green hydrolysis conversion of Wool wastes into organic nitrogen Fertilisers
Life+ 12 ENV/IT000439 GreenWoolF: Green hydrolysis conversion of Wool wastes into organic nitrogen Fertilisers 2nd INTERNATIONAL CONFERENCE on Sustainable Solid Waste Management 12th 14th June 2014 M.
More informationYour Name: MID TERM ANSWER SHEET SIN: ( )
MIDTERM EXAMINATION (October 23, 2008) BIOE150. Introduction to Bio-Nanoscience & Bio-Nanotechnology Professor Seung-Wuk Lee Fall Semester, 2008 0. Write down your name and the last digit of your SIN in
More information7.013 Problem Set 3 FRIDAY October 8th, 2004
MIT Biology Department 7.012: Introductory Biology - Fall 2004 Instructors: Professor Eric Lander, Professor Robert. Weinberg, Dr. laudette ardel Name: T: 7.013 Problem Set 3 FRIDY October 8th, 2004 Problem
More informationVirtual bond representation
Today s subjects: Virtual bond representation Coordination number Contact maps Sidechain packing: is it an instrumental way of selecting and consolidating a fold? ASA of proteins Interatomic distances
More informationDaily Agenda. Warm Up: Review. Translation Notes Protein Synthesis Practice. Redos
Daily Agenda Warm Up: Review Translation Notes Protein Synthesis Practice Redos 1. What is DNA Replication? 2. Where does DNA Replication take place? 3. Replicate this strand of DNA into complimentary
More informationCSE : Computational Issues in Molecular Biology. Lecture 19. Spring 2004
CSE 397-497: Computational Issues in Molecular Biology Lecture 19 Spring 2004-1- Protein structure Primary structure of protein is determined by number and order of amino acids within polypeptide chain.
More information36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L-
36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L- 37. The essential fatty acids are A. palmitic acid B. linoleic acid C. linolenic
More informationAmino Acids Structural Features. Chapter 3 Amino Acids, Peptides and Proteins. Amino Acids Structural Features
Chapter 3, Peptides and Proteins Amino acids can be formed from inorganic compounds under prebiotic conditions These compounds are the monomeric units that are joined to form polypeptides (aka. Proteins)
More informationWhat can you tell me about this picture?
What can you tell me about this picture? ENZYMES A protein with catalytic properties due to its power of specific activation 1. Anabolic reactions: Define the following terms: Reactions that build up molecules
More informationOverview. Secondary Structure. Tertiary Structure
Protein Structure Disclaimer: All information and images were taken from outside sources and the author claims no legal ownership of any material. Sources for images are linked on each slide and the information
More informationSerine Proteases and their Inhibitors
ugo Kubinyi, www.kubinyi.de Serine Proteases and their Inhibitors ugo Kubinyi Germany E-Mail kubinyi@t-online.de omepage www.kubinyi.de ugo Kubinyi, www.kubinyi.de Serine Proteases of Physiological Importance
More informationCHAPTER 1. DNA: The Hereditary Molecule SECTION D. What Does DNA Do? Chapter 1 Modern Genetics for All Students S 33
HPER 1 DN: he Hereditary Molecule SEION D What Does DN Do? hapter 1 Modern enetics for ll Students S 33 D.1 DN odes For Proteins PROEINS DO HE nitty-gritty jobs of every living cell. Proteins are the molecules
More informationGene Expression Translation U C A G A G
Why? ene Expression Translation How do cells synthesize polypeptides and convert them to functional proteins? The message in your DN of who you are and how your body works is carried out by cells through
More informationAddison Ault, Department of Chemistry, Cornell College, Mount Vernon, IA. The isoelectric point is a point on the ph scale. It is the ph at which the
1 Isoelectric Points On the Back of the Envelope Addison Ault, Department of Chemistry, Cornell College, Mount Vernon, IA The isoelectric point is a point on the ph scale. It is the ph at which the average
More informationInformation Readout: Transcription and Post-transcriptional Processing Translation
Information Readout: Transcription and Post-transcriptional Processing Translation Copyright 2013 Pearson Canada Inc. 27-1 DNA as the Template for RNA Synthesis Enzymology of RNA Synthesis: RNA Polymerase
More informationChapter 2 - DNA MC [37 marks]
Chapter 2 - N MC [37 marks] 1. The image shows a N nucleotide. Which correctly identifies the parts labelled I and II? C 2. Which model represents transcription? 3. Which sequence represents the order
More informationMULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question.
Exam Chapter 17 Genes to Proteins Name MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question. The following questions refer to Figure 17.1, a simple metabolic
More informationNotes to accompany the slidecast on theory of SDS PAGE and Western blotting
S317 Biological science: from genes to species Notes to accompany the slidecast on theory of SDS PAGE and Western blotting SDS PAGE SDS PAGE is a standard technique for determining the molecular size of
More informationGenes and Proteins in Health. and Disease
Genes and Health and I can describe the structure of proteins All proteins contain the chemical elements Carbon, Hydrogen, Oxygen and Nitrogen. Some also contain sulphur. Proteins are built from subunits
More information1. DNA replication. (a) Why is DNA replication an essential process?
ame Section 7.014 Problem Set 3 Please print out this problem set and record your answers on the printed copy. Answers to this problem set are to be turned in to the box outside 68120 by 5:00pm on Friday
More informationBasic Biology. Gina Cannarozzi. 28th October Basic Biology. Gina. Introduction DNA. Proteins. Central Dogma.
Cannarozzi 28th October 2005 Class Overview RNA Protein Genomics Transcriptomics Proteomics Genome wide Genome Comparison Microarrays Orthology: Families comparison and Sequencing of Transcription factor
More informationDiversity of proteins
BCMB 3100: Partial notes Chapter 4 (Part 1) Diversity of proteins 3D structure of proteins Fibrous vs globular proteins Conformation vs configuration 1, 2, 3 and 4 structure Peptide groups in polypeptide
More informationChapter 2 Molecules to enzymes - Short answer [72 marks]
Chapter 2 Molecules to enzymes - Short answer [72 marks] 1a. Outline primary and quaternary protein structures. Primary protein structure: Quaternary protein structure: a. (primary structure) is sequence
More informationProtein Synthesis Notes
Protein Synthesis Notes Protein Synthesis: Overview Transcription: synthesis of mrna under the direction of DNA. Translation: actual synthesis of a polypeptide under the direction of mrna. Transcription
More informationSpecificity of Proteolysis
Borivoj Keil Specificity of Proteolysis With 17 Figures and 20 Tables Springer-Verlag Berlin Heidelberg New York London Paris Tokyo Hong Kong Barcelona Budapest Prof. Dr. Borivoj Keil Institut Pasteur
More informationCambridgeSoft Solutions
CambridgeSoft Solutions BioDraw Ultra 11.0 High Quality Sequence and Pathway Drawing Jesse Gordon Director, Biology Marketing jgordon@cambridgesoft.com 617-320-6989 Skype; jessegordon BioDraw Ultra 11.0
More informationAll Rights Reserved. U.S. Patents 6,471,520B1; 5,498,190; 5,916, North Market Street, Suite CC130A, Milwaukee, WI 53202
Secondary Structure In the previous protein folding activity, you created a hypothetical 15-amino acid protein and learned that basic principles of chemistry determine how each protein spontaneously folds
More informationHomology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen
Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,
More informationZwitterion Chromatography ZIC
Zwitterion Chromatography ZIC A novel technique, with unique selectivity, suitable for preparative scale separations? PhD Einar Pontén What is Zwitterion Chromatography? Our definition: Liquid chromatography
More informationSTRUCTURAL BIOLOGY. α/β structures Closed barrels Open twisted sheets Horseshoe folds
STRUCTURAL BIOLOGY α/β structures Closed barrels Open twisted sheets Horseshoe folds The α/β domains Most frequent domain structures are α/β domains: A central parallel or mixed β sheet Surrounded by α
More informationProtein Synthesis & Gene Expression
DNA provides the instructions for how to build proteins Each gene dictates how to build a single protein in prokaryotes The sequence of nucleotides (AGCT) in DNA dictates the order of amino acids that
More informationExamining the components of your peptide sample with AccuPep QC. Lauren Lu, Ph.D. October 29, 2015, 9:00-10:00 AM EST
Examining the components of your peptide sample with AccuPep QC Lauren Lu, Ph.D. October 29, 2015, 9:00-10:00 AM EST When do I need custom peptides? Custom peptides play an important role in many research
More informationBIOLOGY. Chapter 15 Genes & Proteins
BIOLOGY Chapter 15 Genes & Proteins CMPBELL BIOLOGY TENTH EDITION Reece Urry Cain Wasserman Minorsky Jackson 17 Protein Synthesis 2014 Pearson Education, Inc. Fig. 17-1 Figure 17.1a n albino racoon Condition
More informationStructural bioinformatics
Structural bioinformatics Why structures? The representation of the molecules in 3D is more informative New properties of the molecules are revealed, which can not be detected by sequences Eran Eyal Plant
More informationBiomolecules: lecture 6
Biomolecules: lecture 6 - to learn the basics on how DNA serves to make RNA = transcription - to learn how the genetic code instructs protein synthesis - to learn the basics on how proteins are synthesized
More informationDNA Begins the Process
Biology I D N A DNA contains genes, sequences of nucleotide bases These Genes code for polypeptides (proteins) Proteins are used to build cells and do much of the work inside cells DNA Begins the Process
More informationProtein Synthesis. Application Based Questions
Protein Synthesis Application Based Questions MRNA Triplet Codons Note: Logic behind the single letter abbreviations can be found at: http://www.biology.arizona.edu/biochemistry/problem_sets/aa/dayhoff.html
More informationFrom Gene to Protein Transcription and Translation i
How do genes influence our characteristics? From Gene to Protein Transcription and Translation i A gene is a segment of DNA that provides the instructions for making a protein. Proteins have many different
More informationMATH 5610, Computational Biology
MATH 5610, Computational Biology Lecture 2 Intro to Molecular Biology (cont) Stephen Billups University of Colorado at Denver MATH 5610, Computational Biology p.1/24 Announcements Error on syllabus Class
More informationProtein Structure Databases, cont. 11/09/05
11/9/05 Protein Structure Databases (continued) Prediction & Modeling Bioinformatics Seminars Nov 10 Thurs 3:40 Com S Seminar in 223 Atanasoff Computational Epidemiology Armin R. Mikler, Univ. North Texas
More informationHow Do You Clone a Gene?
S-20 Edvo-Kit #S-20 How Do You Clone a Gene? Experiment Objective: The objective of this experiment is to gain an understanding of the structure of DNA, a genetically engineered clone, and how genes are
More informationProSEC 300S. Protein Characterization columns
ProSEC 300S Protein Characterization columns Agilent s ProSEC 300S is a silica-based material specifically designed for the analysis of proteins by aqueous size exclusion chromatography. With a proprietary
More informationHomology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen
Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,
More informationProtein Structure Prediction by Constraint Logic Programming
MPRI C2-19 Protein Structure Prediction by Constraint Logic Programming François Fages, Constraint Programming Group, INRIA Rocquencourt mailto:francois.fages@inria.fr http://contraintes.inria.fr/ Molecules
More informationUV Fluorescence Polarization as a Means to Investigate Protein Conformational and Mass Change
A p p l i c a t i o n N o t e UV Fluorescence Polarization as a Means to Investigate Protein Conformational and Mass Change Using Intrinsic Tryptophan Fluorescence in Conjunction with UV-capable Polarizers
More informationFrom Gene to Protein Transcription and Translation
Name: Hour: From Gene to Protein Transcription and Translation Introduction: In this activity you will learn how the genes in our DNA influence our characteristics. For example, how can a gene cause albinism
More informationTopic 7: Nucleic acids and proteins
Topic 7: Nucleic acids and proteins Topic 7: Nucleic acids and proteins 7.1 DNA structure Assessment Statement IBO Notes Student Notes 7.1.1 7.1.2 7.1.3 7.1.4 7.1.5 Describe the structure of DNA, including
More informationFrom Gene to Protein via Transcription and Translation i
How do genes influence our characteristics? From Gene to Protein via Transcription and Translation i A gene is a segment of DNA that provides the instructions for making a protein. Proteins have many different
More informationX-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction
X-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction Tomohisa Shimasaki 1, Hiromi Yoshida 2, Shigehiro Kamitori 2 & Koji
More informationTropomyosin and S-peptide
7.88 Lecture Notes - 7 7.24/7.88J/5.48J The Protein Folding and Human Disease Tropomyosin and S-peptide Sequence determinants of Coiled Coil Structure Tropomyosin Circular Dichroism Tropomyosin thermal
More informationIntroduction to Protein Purification
Introduction to Protein Purification 1 Day 1) Introduction to Protein Purification. Input for Purification Protocol Development - Guidelines for Protein Purification Day 2) Sample Preparation before Chromatography
More informationtest 7 3. What is the main function of a vacuole in a cell?
test 7 Name: Date: 1. ase your answer(s) to the following question(s) on the diagram below and on your knowledge of biology. The diagram represents a model cell setup. The locations of three different
More informationCristian Micheletti SISSA (Trieste)
Cristian Micheletti SISSA (Trieste) michelet@sissa.it Mar 2009 5pal - parvalbumin Calcium-binding protein HEADER CALCIUM-BINDING PROTEIN 25-SEP-91 5PAL 5PAL 2 COMPND PARVALBUMIN (ALPHA LINEAGE) 5PAL 3
More informationAnfinsen Experiments
Lecture Notes - 2 7.24/7.88J/5.48J The Protein Folding and Human Disease Handouts: An Anfinsen paper Reading List Anfinsen Experiments The Problem of the title refers to how the amino acid sequence of
More informationElectro refers to electron flow or current. Thus Electrophoresis is movement under electric current.
ELECTROPHORESIS Electrophoresis Electro refers to electron flow or current. Phoresis refers to movement. Thus Electrophoresis is movement under electric current. This technique therefore can separate molecules
More informationGene mutation and DNA polymorphism
Gene mutation and DNA polymorphism Outline of this chapter Gene Mutation DNA Polymorphism Gene Mutation Definition Major Types Definition A gene mutation is a change in the nucleotide sequence that composes
More informationAmino Acid Distribution Rules Predict Protein Fold: Protein Grammar for Beta-Strand Sandwich-Like Structures
Biomolecules 2015, 5, 41-59; doi:10.3390/biom5010041 Article OPEN ACCESS biomolecules ISSN 2218-273X www.mdpi.com/journal/biomolecules/ Amino Acid Distribution Rules Predict Protein Fold: Protein Grammar
More informationDNA & Protein Synthesis UNIT D & E
DNA & Protein Synthesis UNIT D & E How this Unit is broken down Chapter 10.1 10.3 The structure of the genetic material Chapter 10.4 & 10.5 DNA replication Chapter 10.6 10.15 The flow of genetic information
More informationC. Tight Turns. = -30, φ 3. = 0, and type II approximately = 120, φ 3. = -60, ψ 2. = -90, ψ 3. = +90, ψ 3
Tight turns (also known as reverse turns, β turns, β bends, hairpin bends, 310 bends, kinks, widgets, etc.) are the first and most prevalent type of nonrepetitive structure that has been recognized. While
More informationBETA STRAND Prof. Alejandro Hochkoeppler Department of Pharmaceutical Sciences and Biotechnology University of Bologna
Prof. Alejandro Hochkoeppler Department of Pharmaceutical Sciences and Biotechnology University of Bologna E-mail: a.hochkoeppler@unibo.it C-ter NH and CO groups: right, left, right (plane of the slide)
More informationProtein 3D Structure Prediction
Protein 3D Structure Prediction Michael Tress CNIO ?? MREYKLVVLGSGGVGKSALTVQFVQGIFVDE YDPTIEDSYRKQVEVDCQQCMLEILDTAGTE QFTAMRDLYMKNGQGFALVYSITAQSTFNDL QDLREQILRVKDTEDVPMILVGNKCDLEDER VVGKEQGQNLARQWCNCAFLESSAKSKINVN
More informationAipotu I & II: Genetics & Biochemistry
Aipotu I & II: Genetics & Biochemistry Objectives: To reinforce your understanding of Genetics, Biochemistry, and Molecular Biology To show the connections between these three disciplines To show how these
More informationFinal Exam Practice BRING PICTURE I.D.
MIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. laudette Gardel Final Exam Practice BRING PITURE I.D. Spring 2005 Final
More informationNucleic acids deoxyribonucleic acid (DNA) ribonucleic acid (RNA) nucleotide
Nucleic Acids Nucleic acids are molecules that store information for cellular growth and reproduction There are two types of nucleic acids: - deoxyribonucleic acid (DNA) and ribonucleic acid (RNA) These
More information24.5. Lesson 24.5 Nucleic Acids. Overview. In this lesson, you will cover the topics of DNA replication, gene mutation, and DNA technologies.
24.5 Lesson 24.5 Nucleic Acids Objectives 24.5.1 Identify the functions of DNA and RNA. 24.5.2 Identify the number of bases of DNA required to specify one amino acid in a peptide chain. 24.5.3 Explain
More informationRheological and biochemical analyses on blood coagulation ~ Discovery of a new pathway under stagnant flow conditions ~
Rheological and biochemical analyses on blood coagulation ~ Discovery of a new pathway under stagnant flow conditions ~ Computer and Information Division, RIKEN Hiroki Iwata Supramolecular Science Laboratory,
More information14 Gene Expression: From Gene to Protein
CMPBELL BIOLOY IN FOCS rry Cain Wasserman Minorsky Jackson Reece 14 ene Expression: From ene to Protein Lecture Presentations by Kathleen Fitzpatrick and Nicole Tunbridge Overview: The Flow of enetic Information
More informationGreen Fluorescent Protein. Avinash Bayya Varun Maturi Nikhileswar Reddy Mukkamala Aravindh Subhramani
Green Fluorescent Protein Avinash Bayya Varun Maturi Nikhileswar Reddy Mukkamala Aravindh Subhramani Introduction The Green fluorescent protein (GFP) was first isolated from the Jellyfish Aequorea victoria,
More informationKinetics Review. Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets)
Quiz 1 Kinetics Review Tonight at 7 PM Phys 204 We will do two problems on the board (additional ones than in the problem sets) I will post the problems with solutions on Toolkit for those that can t make
More informationGenetic Engineering Challenge How can scientists develop a type of rice that could prevent vitamin A deficiency? 1
Genetic Engineering Challenge How can scientists develop a type of rice that could prevent vitamin A deficiency? 1 Vitamin A deficiency can result in blindness, severe infectious diseases, and even death,
More informationQ1 (1 point): Explain why a lettuce leaf wilts when it is placed in a concentrated salt solution.
Short questions 1 point per question. Q1 (1 point): Explain why a lettuce leaf wilts when it is placed in a concentrated salt solution. Answer: Water is sucked out of the cells by osmosis (this reduces
More informationDATA. mrna CODON CHART
Alien Encounters! Background: In the year 2050, an incredible archeological discovery was made in the middle of a remote area of South America. It was an area where a large meteor had struck Earth. A pile
More information7.014 Quiz II 3/18/05. Write your name on this page and your initials on all the other pages in the space provided.
7.014 Quiz II 3/18/05 Your Name: TA's Name: Write your name on this page and your initials on all the other pages in the space provided. This exam has 10 pages including this coversheet. heck that you
More informationFlow of Genetic Information
Flow of Genetic Information Transcription and Translation Links to the Next Generation Standards Scientific and Engineering Practices: Asking Questions (for science) and Defining Problems (for engineering)
More informationHow antimicrobial agents work
Physical and Chemical Control of Microbes Physical Agents heat or radiation Chemical Agents disinfectants or antiseptics Important Terms 1. Sterilization process of killing all viable microbes 2. Bactericide
More informationFrom Gene to Phenotype- part 3. Lecture Outline 11/9/05. The genetic code. Translation: overview
DN mrn From ene to Phenotype- part 3 TRNSRIPTION DN 1 RN is transcribed from a DN template. 5 RN RN transcript polymerase RN PROESSIN Exon 2 In eukaryotes, the RN transcript RN transcript (premrn) is spliced
More information