Protein Sequence Analysis. BME 110: CompBio Tools Todd Lowe April 19, 2007 (Slide Presentation: Carol Rohl)

Size: px
Start display at page:

Download "Protein Sequence Analysis. BME 110: CompBio Tools Todd Lowe April 19, 2007 (Slide Presentation: Carol Rohl)"

Transcription

1 Protein Sequence Analysis BME 110: CompBio Tools Todd Lowe April 19, 2007 (Slide Presentation: Carol Rohl)

2 Linear Sequence Analysis What can you learn from a (single) protein sequence? Calculate it s physical properties Molecular weight (MW), isoelectric point (pi), amino acid content, hydropathy (hydrophilic v. hydrophobic regions) Does not take into account post-translational modifications of protein, so are usually not 100% accurate Identify sequence motifs and families Signal sequences, transmembrane domains, coiled-coils, posttranslational modification sites, secondary structure (nonhomologous) Domains, functional motifs (homologous)

3 3-D Structure Analysis Visualization Domain structure, global fold, active sites, point mutations, SNPs, splice sites Evaluate structure quality Calculate physical properties Surface areas, distances, side-chain conformations, contact maps Structural alignment (ie similarity to other structures) Prediction Physical properties: binding affinity, pka s stability, specificity 3D structure (homology modeling, fold recognition, de novo) Advanced: protein design, docking of two proteins, active site modeling

4 Sequence Databases SwissProt (ExPASy) Highly curated, updated less frequently TrEMBL (ExPASy) Translated nucleotide sequences Automatic translation, fast but less info UniProt (EBI) Unified Protein Resource Combines SwissProt, TrEMBL, PIR sequences

5 Sequence Analysis Sites For protein sequences and tools to analyze them, the two major centers are: ExPASy : Expert Protein Analysis System Many tools: Databases: SwissProt, TrEMBL NCBI : Entrez Protein and Domains PIR: Protein Information Resource (folded into UniProt consortium; no longer major resource site)

6 More Sequence Databases Non-redundant NR (NCBI), UniRef (PIR/EBI) Reference RefSeq (NCBI) re-annotated by NCBI Domains/Families Pfam protein families (Sanger Center + 4 mirror sites) SMART Simple Modular Architecture Research Tool CDD Conserved protein Domain Database (NCBI), combines Pfam, SMART, and COGs databases InterPro (based on UniProt, at EMBL-EBI) Many others

7 Structure Databases Experimental: PDB: Protein Data Bank Families: SCOP, CATH, Dali database, Homstrad Models/Predictions ModBase SwissModel NOTE: All these databases are described in January Database issue of Nucleic Acids Research (plus other kinds of databases). Also, links to them

8 Protein Sequence Analysis Tools ExPASy Proteomics Tools Calculate physical properties Predict sequence motifs what ExPASy calls Topology : localization, TM domains Signal sequences, postranslational modifications Search pattern and profile collections PredictProtein and Meta-PP A meta-server providing access to many servers with one submission form

9 Secondary Structure Prediction Three good methods: Psipred Sam-T02/T04/T06 PhD (PredictProtein) Compare a couple methods Use the three-state predictions

10 SEQUENCE <--> STRUCTURE <--> FUNCTION Evolutionary selection operates on function Structure is more closely linked to function than is sequence, so structure tends to be more conserved than sequence. Need to search farther in sequence space to find proteins with related structures and functions.

11 Detecting Remote Similarities Remote similarities can more easily be detected by comparing protein sequences DNA sequences change faster than protein sequences (wobble position, redundant codons) 4 letter DNA code vs. 20 letter amino acid code means that matches by chance are more likely in DNA; The protein code has more information in it!

12 Detecting Homology NEAR Evolutionary Distance FAR DNA Sequence Protein Sequence SIMILARITY Protein Structure BLASTn BLASTp PSIBLAST Fold Recognition METHODS

13 Similar Sequences Share Similar Structures Compare all pairs of proteins in the same family (pairs for which homology is very probable) Homologs do not necessarily share much sequence similarity. Proteins with >30% sequence identity almost always share the same fold More structurally similar All other immunoglobulins Sauder et al., (2000) Proteins 40:6

14 BLASTP Heuristics Most sequences will be unrelated Related sequences are likely to have short stretches of identities Use identical (or closely related) short words as seeds for local alignment Like BLASTn with shorter words Will return global alignment if proteins similar over whole length

15 BLASTp Scoring Matrices less divergent BLOSUM 80 BLOSUM62 BLOSUM45 PAM1 PAM120 PAM250 more divergent BLOcks amino acid SUbstitution Matrices Calculated directly from substitution frequencies in local, ungapped alignments of biochemically related sequences Number indicates the highest sequence similarity between sequences used. Percent Accepted Mutations Derived from global alignments of closely related sequences (85% identity) using an evolutionary model to extrapolate to lower identities Number indicates evolutionary distance If in doubt, use BLOSUM. More suited to searching databases using local alignment. No assumed model of evolutionary divergence.

16 Other BLASTp Parameters Gap penalties The harder it is to open/extend a gap, the fewer will be made. If you re looking for close sequences, gap penalties should be higher. Databases NR (non-redundant, translated gene sequences) SwissProt PDB Phylogenetically specific (i.e. Archaea only)

17 PSIBLAST Position-Specific Iterated BLAST Creates a scoring matrix specialized for your sequence Allows more distantly related sequences to be identified Steps 1. Use BLASTp and identify related sequences (E-value threshold) 2. Create a profile from related sequences 3. Search for related sequences using this profile 4. Repeat

18 BLASTing The Protein Universe BLOSUM45 BLOSUM80

19 Evolution And The Protein Universe

20 PSIBLASTing The Protein Universe Iteration 1 Iteration 2

21 Sequence Profiles Align all sequences and count how often each amino acid occurs at every position. Combine with prior information about substitution frequencies using pseudocounts from BLOSUM62 Convert to log odds score to give a Position-Specific Scoring Matrix (PSSM)

22 A Sample PSSM A R N D C Q E G H I L K M F P S T W Y V 1 M K W V W A L L L L A A W A A A S G T W Y A From Pevsner, Bioinformatics and Functional Genomics (ISBN ) John Wiley & Sons, Inc.

23 PSSM Corruption False positives can occur in a PSIBLAST search of the PSSM becomes corrupted. How do PSSMs become corrupted? One sequence that is not homologous to the query gets included in the alignment used to make the PSSM. The PSSM now looks a bit like this spurious sequence and will match well to other similar spurious sequences. These additional spurious sequences that are detected are included in the new alignment, amplifying the corrupting signal. Once a bad sequence is included in the PSSM, the search veers of course, and cannot be corrected.

24 Preventing PSSM Corruption Apply filtering of biased composition regions. (Low complexity filter) Use better methods to estimate the E-value (compositionbased statistics) Increase threshold for judging two sequences to be similar: adjust E value from (default) to a lower value such as E = Manually inspect the output from each iteration and remove suspicious hits.

25 PHI-BLAST: Pattern-Hit-Initiated BLAST Combines matching of regular expressions with local alignments surrounding the match. What other proteins contain a particular sequence pattern and are similar in the vicinity of this pattern? May filter out cases where pattern matches randomly and doesn t indicate homology Pattern matching uses ScanProsite syntax Sequence similarity search is like PSIBLAST

26 Syntax Rules for Patterns [ ] any one of the listed characters allowed { } any character except the listed ones allowed x(n) n positions in which any residue is allowed x(n,m) n to m positions in which any residue is allowed (n,m) Examples: GXW[YF][EA][IVLM] Matches: GTWFEL GKWYAI Does not match: GGWYFEI GWYEI E[LIV]X(0,3)PP[STG] Matches: ELPPS ELPPPSTG EVIPPG Does not match: ELIVPPPPG

27 Gene Discovery with BLAST Start with the sequence of a known protein tblastn Search a DNA database (e.g. HTGS, dbest, or genomic sequence from a specific organism) inspect Search your DNA or protein against a protein database (nr) to confirm you have identified a novel gene blastx or blastp nr Find matches [1] to DNA encoding known proteins [2] to DNA encoding related (novel!) proteins [3] to false positives

Outline. Evolution. Adaptive convergence. Common similarity problems. Chapter 7: Similarity searches on sequence databases

Outline. Evolution. Adaptive convergence. Common similarity problems. Chapter 7: Similarity searches on sequence databases Chapter 7: Similarity searches on sequence databases All science is either physics or stamp collection. Ernest Rutherford Outline Why is similarity important BLAST Protein and DNA Interpreting BLAST Individualizing

More information

BLAST. compared with database sequences Sequences with many matches to high- scoring words are used for final alignments

BLAST. compared with database sequences Sequences with many matches to high- scoring words are used for final alignments BLAST 100 times faster than dynamic programming. Good for database searches. Derive a list of words of length w from query (e.g., 3 for protein, 11 for DNA) High-scoring words are compared with database

More information

Sequence Databases and database scanning

Sequence Databases and database scanning Sequence Databases and database scanning Marjolein Thunnissen Lund, 2012 Types of databases: Primary sequence databases (proteins and nucleic acids). Composite protein sequence databases. Secondary databases.

More information

Why learn sequence database searching? Searching Molecular Databases with BLAST

Why learn sequence database searching? Searching Molecular Databases with BLAST Why learn sequence database searching? Searching Molecular Databases with BLAST What have I cloned? Is this really!my gene"? Basic Local Alignment Search Tool How BLAST works Interpreting search results

More information

Protein Bioinformatics Part I: Access to information

Protein Bioinformatics Part I: Access to information Protein Bioinformatics Part I: Access to information 260.655 April 6, 2006 Jonathan Pevsner, Ph.D. pevsner@kennedykrieger.org Outline [1] Proteins at NCBI RefSeq accession numbers Cn3D to visualize structures

More information

Sequence Based Function Annotation. Qi Sun Bioinformatics Facility Biotechnology Resource Center Cornell University

Sequence Based Function Annotation. Qi Sun Bioinformatics Facility Biotechnology Resource Center Cornell University Sequence Based Function Annotation Qi Sun Bioinformatics Facility Biotechnology Resource Center Cornell University Usage scenarios for sequence based function annotation Function prediction of newly cloned

More information

The String Alignment Problem. Comparative Sequence Sizes. The String Alignment Problem. The String Alignment Problem.

The String Alignment Problem. Comparative Sequence Sizes. The String Alignment Problem. The String Alignment Problem. Dec-82 Oct-84 Aug-86 Jun-88 Apr-90 Feb-92 Nov-93 Sep-95 Jul-97 May-99 Mar-01 Jan-03 Nov-04 Sep-06 Jul-08 May-10 Mar-12 Growth of GenBank 160,000,000,000 180,000,000 Introduction to Bioinformatics Iosif

More information

ELE4120 Bioinformatics. Tutorial 5

ELE4120 Bioinformatics. Tutorial 5 ELE4120 Bioinformatics Tutorial 5 1 1. Database Content GenBank RefSeq TPA UniProt 2. Database Searches 2 Databases A common situation for alignment is to search through a database to retrieve the similar

More information

Introduction to Bioinformatics CPSC 265. What is bioinformatics? Textbooks

Introduction to Bioinformatics CPSC 265. What is bioinformatics? Textbooks Introduction to Bioinformatics CPSC 265 Thanks to Jonathan Pevsner, Ph.D. Textbooks Johnathan Pevsner, who I stole most of these slides from (thanks!) has written a textbook, Bioinformatics and Functional

More information

FACULTY OF BIOCHEMISTRY AND MOLECULAR MEDICINE

FACULTY OF BIOCHEMISTRY AND MOLECULAR MEDICINE FACULTY OF BIOCHEMISTRY AND MOLECULAR MEDICINE BIOMOLECULES COURSE: COMPUTER PRACTICAL 1 Author of the exercise: Prof. Lloyd Ruddock Edited by Dr. Leila Tajedin 2017-2018 Assistant: Leila Tajedin (leila.tajedin@oulu.fi)

More information

ONLINE BIOINFORMATICS RESOURCES

ONLINE BIOINFORMATICS RESOURCES Dedan Githae Email: d.githae@cgiar.org BecA-ILRI Hub; Nairobi, Kenya 16 May, 2014 ONLINE BIOINFORMATICS RESOURCES Introduction to Molecular Biology and Bioinformatics (IMBB) 2014 The larger picture.. Lower

More information

VL Algorithmische BioInformatik (19710) WS2013/2014 Woche 3 - Mittwoch

VL Algorithmische BioInformatik (19710) WS2013/2014 Woche 3 - Mittwoch VL Algorithmische BioInformatik (19710) WS2013/2014 Woche 3 - Mittwoch Tim Conrad AG Medical Bioinformatics Institut für Mathematik & Informatik, Freie Universität Berlin Vorlesungsthemen Part 1: Background

More information

BLAST. Basic Local Alignment Search Tool. Optimized for finding local alignments between two sequences.

BLAST. Basic Local Alignment Search Tool. Optimized for finding local alignments between two sequences. BLAST Basic Local Alignment Search Tool. Optimized for finding local alignments between two sequences. An example could be aligning an mrna sequence to genomic DNA. Proteins are frequently composed of

More information

Evolutionary Genetics. LV Lecture with exercises 6KP

Evolutionary Genetics. LV Lecture with exercises 6KP Evolutionary Genetics LV 25600-01 Lecture with exercises 6KP HS2017 >What_is_it? AATGATACGGCGACCACCGAGATCTACACNNNTC GTCGGCAGCGTC 2 NCBI MegaBlast search (09/14) 3 NCBI MegaBlast search (09/14) 4 Submitted

More information

Creation of a PAM matrix

Creation of a PAM matrix Rationale for substitution matrices Substitution matrices are a way of keeping track of the structural, physical and chemical properties of the amino acids in proteins, in such a fashion that less detrimental

More information

Comparative Bioinformatics. BSCI348S Fall 2003 Midterm 1

Comparative Bioinformatics. BSCI348S Fall 2003 Midterm 1 BSCI348S Fall 2003 Midterm 1 Multiple Choice: select the single best answer to the question or completion of the phrase. (5 points each) 1. The field of bioinformatics a. uses biomimetic algorithms to

More information

Dynamic Programming Algorithms

Dynamic Programming Algorithms Dynamic Programming Algorithms Sequence alignments, scores, and significance Lucy Skrabanek ICB, WMC February 7, 212 Sequence alignment Compare two (or more) sequences to: Find regions of conservation

More information

Database Searching and BLAST Dannie Durand

Database Searching and BLAST Dannie Durand Computational Genomics and Molecular Biology, Fall 2013 1 Database Searching and BLAST Dannie Durand Tuesday, October 8th Review: Karlin-Altschul Statistics Recall that a Maximal Segment Pair (MSP) is

More information

Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 2. Bioinformatics 1: Biology, Sequences, Phylogenetics

Bioinformatics 1. Sepp Hochreiter. Biology, Sequences, Phylogenetics Part 2. Bioinformatics 1: Biology, Sequences, Phylogenetics Bioinformatics 1 Biology, Sequences, Phylogenetics Part 2 Sepp Hochreiter gene Central Dogma nucleus DNA 1. transcription (mrna) 2. transport mrna protein 3. translation (ribosom, trna) 4. folding (protein)

More information

Introduction to BIOINFORMATICS

Introduction to BIOINFORMATICS Introduction to BIOINFORMATICS Antonella Lisa CABGen Centro di Analisi Bioinformatica per la Genomica Tel. 0382-546361 E-mail: lisa@igm.cnr.it http://www.igm.cnr.it/pagine-personali/lisa-antonella/ What

More information

Files for this Tutorial: All files needed for this tutorial are compressed into a single archive: [BLAST_Intro.tar.gz]

Files for this Tutorial: All files needed for this tutorial are compressed into a single archive: [BLAST_Intro.tar.gz] BLAST Exercise: Detecting and Interpreting Genetic Homology Adapted by W. Leung and SCR Elgin from Detecting and Interpreting Genetic Homology by Dr. J. Buhler Prequisites: None Resources: The BLAST web

More information

Basic Bioinformatics: Homology, Sequence Alignment,

Basic Bioinformatics: Homology, Sequence Alignment, Basic Bioinformatics: Homology, Sequence Alignment, and BLAST William S. Sanders Institute for Genomics, Biocomputing, and Biotechnology (IGBB) High Performance Computing Collaboratory (HPC 2 ) Mississippi

More information

Types of Databases - By Scope

Types of Databases - By Scope Biological Databases Bioinformatics Workshop 2009 Chi-Cheng Lin, Ph.D. Department of Computer Science Winona State University clin@winona.edu Biological Databases Data Domains - By Scope - By Level of

More information

Modern BLAST Programs

Modern BLAST Programs Modern BLAST Programs Jian Ma and Louxin Zhang Abstract The Basic Local Alignment Search Tool (BLAST) is arguably the most widely used program in bioinformatics. By sacrificing sensitivity for speed, it

More information

MATH 5610, Computational Biology

MATH 5610, Computational Biology MATH 5610, Computational Biology Lecture 2 Intro to Molecular Biology (cont) Stephen Billups University of Colorado at Denver MATH 5610, Computational Biology p.1/24 Announcements Error on syllabus Class

More information

Gene Identification in silico

Gene Identification in silico Gene Identification in silico Nita Parekh, IIIT Hyderabad Presented at National Seminar on Bioinformatics and Functional Genomics, at Bioinformatics centre, Pondicherry University, Feb 15 17, 2006. Introduction

More information

3D Structure Prediction with Fold Recognition/Threading. Michael Tress CNB-CSIC, Madrid

3D Structure Prediction with Fold Recognition/Threading. Michael Tress CNB-CSIC, Madrid 3D Structure Prediction with Fold Recognition/Threading Michael Tress CNB-CSIC, Madrid MREYKLVVLGSGGVGKSALTVQFVQGIFVDEYDPTIEDSY RKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFAL VYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDL

More information

Bioinformatics for Proteomics. Ann Loraine

Bioinformatics for Proteomics. Ann Loraine Bioinformatics for Proteomics Ann Loraine aloraine@uab.edu What is bioinformatics? The science of collecting, processing, organizing, storing, analyzing, and mining biological information, especially data

More information

Exploring Similarities of Conserved Domains/Motifs

Exploring Similarities of Conserved Domains/Motifs Exploring Similarities of Conserved Domains/Motifs Sotiria Palioura Abstract Traditionally, proteins are represented as amino acid sequences. There are, though, other (potentially more exciting) representations;

More information

Computational Biology and Bioinformatics

Computational Biology and Bioinformatics Computational Biology and Bioinformatics Computational biology Development of algorithms to solve problems in biology Bioinformatics Application of computational biology to the analysis and management

More information

Last Update: 12/31/2017. Recommended Background Tutorial: An Introduction to NCBI BLAST

Last Update: 12/31/2017. Recommended Background Tutorial: An Introduction to NCBI BLAST BLAST Exercise: Detecting and Interpreting Genetic Homology Adapted by T. Cordonnier, C. Shaffer, W. Leung and SCR Elgin from Detecting and Interpreting Genetic Homology by Dr. J. Buhler Recommended Background

More information

Why Use BLAST? David Form - August 15,

Why Use BLAST? David Form - August 15, Wolbachia Workshop 2017 Bioinformatics BLAST Basic Local Alignment Search Tool Finding Model Organisms for Study of Disease Can yeast be used as a model organism to study cystic fibrosis? BLAST Why Use

More information

Introduction to Bioinformatics

Introduction to Bioinformatics Introduction to Bioinformatics Dr. Taysir Hassan Abdel Hamid Lecturer, Information Systems Department Faculty of Computer and Information Assiut University taysirhs@aun.edu.eg taysir_soliman@hotmail.com

More information

Computational analysis of non-coding RNA. Andrew Uzilov BME110 Tue, Nov 16, 2010

Computational analysis of non-coding RNA. Andrew Uzilov BME110 Tue, Nov 16, 2010 Computational analysis of non-coding RNA Andrew Uzilov auzilov@ucsc.edu BME110 Tue, Nov 16, 2010 1 Corrected/updated talk slides are here: http://tinyurl.com/uzilovrna redirects to: http://users.soe.ucsc.edu/~auzilov/bme110/fall2010/

More information

Query-seeded iterative sequence similarity searching improves selectivity 5 20-fold

Query-seeded iterative sequence similarity searching improves selectivity 5 20-fold Nucleic Acids Research, 2016 1 doi: 10.1093/nar/gkw1207 Query-seeded iterative sequence similarity searching improves selectivity 5 20-fold William R. Pearson 1,*, Weizhong Li 2 and Rodrigo Lopez 2 1 Dept.

More information

Protein Structure Databases, cont. 11/09/05

Protein Structure Databases, cont. 11/09/05 11/9/05 Protein Structure Databases (continued) Prediction & Modeling Bioinformatics Seminars Nov 10 Thurs 3:40 Com S Seminar in 223 Atanasoff Computational Epidemiology Armin R. Mikler, Univ. North Texas

More information

I nternet Resources for Bioinformatics Data and Tools

I nternet Resources for Bioinformatics Data and Tools ~i;;;;;;;'s :.. ~,;;%.: ;!,;s163 ~. s :s163:: ~s ;'.:'. 3;3 ~,: S;I:;~.3;3'/////, IS~I'//. i: ~s '/, Z I;~;I; :;;; :;I~Z;I~,;'//.;;;;;I'/,;:, :;:;/,;'L;;;~;'~;~,::,:, Z'LZ:..;;',;';4...;,;',~/,~:...;/,;:'.::.

More information

Chimp Sequence Annotation: Region 2_3

Chimp Sequence Annotation: Region 2_3 Chimp Sequence Annotation: Region 2_3 Jeff Howenstein March 30, 2007 BIO434W Genomics 1 Introduction We received region 2_3 of the ChimpChunk sequence, and the first step we performed was to run RepeatMasker

More information

RNA Genomics II. BME 110: CompBio Tools Todd Lowe & Andrew Uzilov May 17, 2011

RNA Genomics II. BME 110: CompBio Tools Todd Lowe & Andrew Uzilov May 17, 2011 RNA Genomics II BME 110: CompBio Tools Todd Lowe & Andrew Uzilov May 17, 2011 1 TIME Why RNA? An evolutionary perspective The RNA World hypotheses: life arose as self-replicating non-coding RNA (ncrna)

More information

Identification of Single Nucleotide Polymorphisms and associated Disease Genes using NCBI resources

Identification of Single Nucleotide Polymorphisms and associated Disease Genes using NCBI resources Identification of Single Nucleotide Polymorphisms and associated Disease Genes using NCBI resources Navreet Kaur M.Tech Student Department of Computer Engineering. University College of Engineering, Punjabi

More information

Translating Biological Data Sets Into Linked Data

Translating Biological Data Sets Into Linked Data Translating Biological Data Sets Into Linked Data Mark Tomko Simmons College, Boston MA The Broad Institute of MIT and Harvard, Cambridge MA September 28, 2011 Overview Why study biological data? UniProt

More information

COMPUTER RESOURCES II:

COMPUTER RESOURCES II: COMPUTER RESOURCES II: Using the computer to analyze data, using the internet, and accessing online databases Bio 210, Fall 2006 Linda S. Huang, Ph.D. University of Massachusetts Boston In the first computer

More information

Bioinformatics with basic local alignment search tool (BLAST) and fast alignment (FASTA)

Bioinformatics with basic local alignment search tool (BLAST) and fast alignment (FASTA) Vol. 6(1), pp. 1-6, April 2014 DOI: 10.5897/IJBC2013.0086 Article Number: 093849744377 ISSN 2141-2464 Copyright 2014 Author(s) retain the copyright of this article http://www.academicjournals.org/jbsa

More information

BIOINFORMATICS IN BIOCHEMISTRY

BIOINFORMATICS IN BIOCHEMISTRY BIOINFORMATICS IN BIOCHEMISTRY Bioinformatics a field at the interface of molecular biology, computer science, and mathematics Bioinformatics focuses on the analysis of molecular sequences (DNA, RNA, and

More information

Alignment to a database. November 3, 2016

Alignment to a database. November 3, 2016 Alignment to a database November 3, 2016 How do you create a database? 1982 GenBank (at LANL, 2000 sequences) 1988 A way to search GenBank (FASTA) Genome Project 1982 GenBank (at LANL, 2000 sequences)

More information

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,

More information

Leonardo Mariño-Ramírez, PhD NCBI / NLM / NIH. BIOL 7210 A Computational Genomics 2/18/2015

Leonardo Mariño-Ramírez, PhD NCBI / NLM / NIH. BIOL 7210 A Computational Genomics 2/18/2015 Leonardo Mariño-Ramírez, PhD NCBI / NLM / NIH BIOL 7210 A Computational Genomics 2/18/2015 The $1,000 genome is here! http://www.illumina.com/systems/hiseq-x-sequencing-system.ilmn Bioinformatics bottleneck

More information

Applied Bioinformatics

Applied Bioinformatics Applied Bioinformatics Bing Zhang Department of Biomedical Informatics Vanderbilt University bing.zhang@vanderbilt.edu Course overview What is bioinformatics Data driven science: the creation and advancement

More information

APPENDIX. Appendix. Table of Contents. Ethics Background. Creating Discussion Ground Rules. Amino Acid Abbreviations and Chemistry Resources

APPENDIX. Appendix. Table of Contents. Ethics Background. Creating Discussion Ground Rules. Amino Acid Abbreviations and Chemistry Resources Appendix Table of Contents A2 A3 A4 A5 A6 A7 A9 Ethics Background Creating Discussion Ground Rules Amino Acid Abbreviations and Chemistry Resources Codons and Amino Acid Chemistry Behind the Scenes with

More information

Annotating Fosmid 14p24 of D. Virilis chromosome 4

Annotating Fosmid 14p24 of D. Virilis chromosome 4 Lo 1 Annotating Fosmid 14p24 of D. Virilis chromosome 4 Lo, Louis April 20, 2006 Annotation Report Introduction In the first half of Research Explorations in Genomics I finished a 38kb fragment of chromosome

More information

JPred and Jnet: Protein Secondary Structure Prediction.

JPred and Jnet: Protein Secondary Structure Prediction. JPred and Jnet: Protein Secondary Structure Prediction www.compbio.dundee.ac.uk/jpred ...A I L E G D Y A S H M K... FUNCTION? Protein Sequence a-helix b-strand Secondary Structure Fold What is the difference

More information

An Introduction to Bioinformatics for Biological Sciences Students

An Introduction to Bioinformatics for Biological Sciences Students An Introduction to Bioinformatics for Biological Sciences Students Department of Microbiology and Immunology, McGill University Version 2.5 (For the BIOC-300 lab), March 2006 2 AN INTRODUCTION TO BIOINFORMATICS

More information

BIOINFORMATICS AND FUNCTIONAL GENOMICS

BIOINFORMATICS AND FUNCTIONAL GENOMICS BIOINFORMATICS AND FUNCTIONAL GENOMICS third edition Jonathan Pevsner Bioinformatics and Functional Genomics Bioinformatics and Functional Genomics Third Edition Jonathan Pevsner Department of Neurology,

More information

Overview of Health Informatics. ITI BMI-Dept

Overview of Health Informatics. ITI BMI-Dept Overview of Health Informatics ITI BMI-Dept Fellowship Week 5 Overview of Health Informatics ITI, BMI-Dept Day 10 7/5/2010 2 Agenda 1-Bioinformatics Definitions 2-System Biology 3-Bioinformatics vs Computational

More information

Post-assembly Data Analysis

Post-assembly Data Analysis Assembled transcriptome Post-assembly Data Analysis Quantification: the expression level of each gene in each sample DE genes: genes differentially expressed between samples Clustering/network analysis

More information

Introduction to Molecular Biology Databases

Introduction to Molecular Biology Databases Introduction to Molecular Biology Databases Laboratorio de Bioinformática Centro de Astrobiología INTA-CSIC Centro de Astrobiología PRESENT BIOLOGY RESEARCH Data sources Genome sequencing projects: genome

More information

Teaching Principles of Enzyme Structure, Evolution, and Catalysis Using Bioinformatics

Teaching Principles of Enzyme Structure, Evolution, and Catalysis Using Bioinformatics KBM Journal of Science Education (2010) 1 (1): 7-12 doi: 10.5147/kbmjse/2010/0013 Teaching Principles of Enzyme Structure, Evolution, and Catalysis Using Bioinformatics Pablo Sobrado Department of Biochemistry,

More information

Hands-On Four Investigating Inherited Diseases

Hands-On Four Investigating Inherited Diseases Hands-On Four Investigating Inherited Diseases The purpose of these exercises is to introduce bioinformatics databases and tools. We investigate an important human gene and see how mutations give rise

More information

Bioinformatic Methods I Lab 2 LAB 2 ADVANCED BLAST AND COMPARATIVE GENOMICS. [Software needed: web access]

Bioinformatic Methods I Lab 2 LAB 2 ADVANCED BLAST AND COMPARATIVE GENOMICS. [Software needed: web access] LAB 2 ADVANCED BLAST AND COMPARATIVE GENOMICS [Software needed: web access] There are 4 sections to this lab: BlastP, PSI-Blast, Translated Blast, and Comparative Genomics. Last time we used BLAST to query

More information

The use of bioinformatic analysis in support of HGT from plants to microorganisms. Meeting with applicants Parma, 26 November 2015

The use of bioinformatic analysis in support of HGT from plants to microorganisms. Meeting with applicants Parma, 26 November 2015 The use of bioinformatic analysis in support of HGT from plants to microorganisms Meeting with applicants Parma, 26 November 2015 WHY WE NEED TO CONSIDER HGT IN GM PLANT RA Directive 2001/18/EC As general

More information

(a) (3 points) Which of these plants (use number) show e/e pattern? Which show E/E Pattern and which showed heterozygous e/e pattern?

(a) (3 points) Which of these plants (use number) show e/e pattern? Which show E/E Pattern and which showed heterozygous e/e pattern? 1. (20 points) What are each of the following molecular markers? (Indicate (a) what they stand for; (b) the nature of the molecular polymorphism and (c) Methods of detection (such as gel electrophoresis,

More information

Big picture and history

Big picture and history Big picture and history (and Computational Biology) CS-5700 / BIO-5323 Outline 1 2 3 4 Outline 1 2 3 4 First to be databased were proteins The development of protein- s (Sanger and Tuppy 1951) led to the

More information

B I O I N F O R M A T I C S

B I O I N F O R M A T I C S B I O I N F O R M A T I C S Kristel Van Steen, PhD 2 Montefiore Institute - Systems and Modeling GIGA - Bioinformatics ULg kristel.vansteen@ulg.ac.be SUPPLEMENTARY CHAPTER: DATA BASES AND MINING 1 What

More information

NCBI web resources I: databases and Entrez

NCBI web resources I: databases and Entrez NCBI web resources I: databases and Entrez Yanbin Yin Most materials are downloaded from ftp://ftp.ncbi.nih.gov/pub/education/ 1 Homework assignment 1 Two parts: Extract the gene IDs reported in table

More information

AB INITIO PROTEIN STRUCTURE PREDICTION ALGORITHMS

AB INITIO PROTEIN STRUCTURE PREDICTION ALGORITHMS San Jose State University SJSU ScholarWorks Master's Projects Master's Theses and Graduate Research Spring 2011 AB INITIO PROTEIN STRUCTURE PREDICTION ALGORITHMS Maciej Kicinski San Jose State University

More information

Gene-centered resources at NCBI

Gene-centered resources at NCBI COURSE OF BIOINFORMATICS a.a. 2014-2015 Gene-centered resources at NCBI We searched Accession Number: M60495 AT NCBI Nucleotide Gene has been implemented at NCBI to organize information about genes, serving

More information

Web based Bioinformatics Applications in Proteomics. Genbank

Web based Bioinformatics Applications in Proteomics. Genbank Web based Bioinformatics Applications in Proteomics Chiquito Crasto ccrasto@genetics.uab.edu February 9, 2010 Genbank Primary nucleic acid sequence database Maintained by NCBI National Center for Biotechnology

More information

Application for Automating Database Storage of EST to Blast Results. Vikas Sharma Shrividya Shivkumar Nathan Helmick

Application for Automating Database Storage of EST to Blast Results. Vikas Sharma Shrividya Shivkumar Nathan Helmick Application for Automating Database Storage of EST to Blast Results Vikas Sharma Shrividya Shivkumar Nathan Helmick Outline Biology Primer Vikas Sharma System Overview Nathan Helmick Creating ESTs Nathan

More information

Typically, to be biologically related means to share a common ancestor. In biology, we call this homologous

Typically, to be biologically related means to share a common ancestor. In biology, we call this homologous Typically, to be biologically related means to share a common ancestor. In biology, we call this homologous. Two proteins sharing a common ancestor are said to be homologs. Homologyoften implies structural

More information

BIOINFORMATICS Introduction

BIOINFORMATICS Introduction BIOINFORMATICS Introduction Mark Gerstein, Yale University bioinfo.mbb.yale.edu/mbb452a 1 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu What is Bioinformatics? (Molecular) Bio -informatics One idea

More information

Agenda. Web Databases for Drosophila. Gene annotation workflow. GEP Drosophila annotation projects 01/01/2018. Annotation adding labels to a sequence

Agenda. Web Databases for Drosophila. Gene annotation workflow. GEP Drosophila annotation projects 01/01/2018. Annotation adding labels to a sequence Agenda GEP annotation project overview Web Databases for Drosophila An introduction to web tools, databases and NCBI BLAST Web databases for Drosophila annotation UCSC Genome Browser NCBI / BLAST FlyBase

More information

Korilog. high-performance sequence similarity search tool & integration with KNIME platform. Patrick Durand, PhD, CEO. BIOINFORMATICS Solutions

Korilog. high-performance sequence similarity search tool & integration with KNIME platform. Patrick Durand, PhD, CEO. BIOINFORMATICS Solutions KLAST high-performance sequence similarity search tool & integration with KNIME platform Patrick Durand, PhD, CEO Sequence analysis big challenge DNA sequence... Context 1. Modern sequencers produce huge

More information

Getting To Know Your Protein

Getting To Know Your Protein Getting To Know Your Protein Comparative Protein Analysis: Part II. Protein Domain Identification & Classification Robert Latek, PhD Sr. Bioinformatics Scientist Whitehead Institute for Biomedical Research

More information

8/21/2014. From Gene to Protein

8/21/2014. From Gene to Protein From Gene to Protein Chapter 17 Objectives Describe the contributions made by Garrod, Beadle, and Tatum to our understanding of the relationship between genes and enzymes Briefly explain how information

More information

NiceProt View of Swiss-Prot: P18907

NiceProt View of Swiss-Prot: P18907 Hosted by NCSC US ExPASy Home page Site Map Search ExPASy Contact us Swiss-Prot Mirror sites: Australia Bolivia Canada China Korea Switzerland Taiwan Search Swiss-Prot/TrEMBL for horse alpha Go Clear NiceProt

More information

UCSC Genome Browser. Introduction to ab initio and evidence-based gene finding

UCSC Genome Browser. Introduction to ab initio and evidence-based gene finding UCSC Genome Browser Introduction to ab initio and evidence-based gene finding Wilson Leung 06/2006 Outline Introduction to annotation ab initio gene finding Basics of the UCSC Browser Evidence-based gene

More information

Protein 3D Structure Prediction

Protein 3D Structure Prediction Protein 3D Structure Prediction Michael Tress CNIO ?? MREYKLVVLGSGGVGKSALTVQFVQGIFVDE YDPTIEDSYRKQVEVDCQQCMLEILDTAGTE QFTAMRDLYMKNGQGFALVYSITAQSTFNDL QDLREQILRVKDTEDVPMILVGNKCDLEDER VVGKEQGQNLARQWCNCAFLESSAKSKINVN

More information

Protein Bioinformatics PH Final Exam

Protein Bioinformatics PH Final Exam Name (please print) Protein Bioinformatics PH260.655 Final Exam => take-home questions => open-note => please use either * the Word-file to type your answers or * print out the PDF and hand-write your

More information

Structure & Function. Ulf Leser

Structure & Function. Ulf Leser Proteins: Structure & Function Ulf Leser This Lecture Introduction Structure Function Databases Predicting Protein Secondary Structure Many figures from Zvelebil, M. and Baum, J. O. (2008). "Understanding

More information

Molecular Databases and Tools

Molecular Databases and Tools NWeHealth, The University of Manchester Molecular Databases and Tools Afternoon Session: NCBI/EBI resources, pairwise alignment, BLAST, multiple sequence alignment and primer finding. Dr. Georgina Moulton

More information

Sequence Databases. Chapter 2. caister.com/bioinformaticsbooks. Paul Rangel. Sequence Databases

Sequence Databases. Chapter 2. caister.com/bioinformaticsbooks. Paul Rangel. Sequence Databases Chapter 2 Paul Rangel Abstract DNA and Protein sequence databases are the cornerstone of bioinformatics research. DNA databases such as GenBank and EMBL accept genome data from sequencing projects around

More information

Annotating 7G24-63 Justin Richner May 4, Figure 1: Map of my sequence

Annotating 7G24-63 Justin Richner May 4, Figure 1: Map of my sequence Annotating 7G24-63 Justin Richner May 4, 2005 Zfh2 exons Thd1 exons Pur-alpha exons 0 40 kb 8 = 1 kb = LINE, Penelope = DNA/Transib, Transib1 = DINE = Novel Repeat = LTR/PAO, Diver2 I = LTR/Gypsy, Invader

More information

SAMPLE LITERATURE Please refer to included weblink for correct version.

SAMPLE LITERATURE Please refer to included weblink for correct version. Edvo-Kit #340 DNA Informatics Experiment Objective: In this experiment, students will explore the popular bioninformatics tool BLAST. First they will read sequences from autoradiographs of automated gel

More information

Product Applications for the Sequence Analysis Collection

Product Applications for the Sequence Analysis Collection Product Applications for the Sequence Analysis Collection Pipeline Pilot Contents Introduction... 1 Pipeline Pilot and Bioinformatics... 2 Sequence Searching with Profile HMM...2 Integrating Data in a

More information

BLAST Basics. ... Elements of Bioinformatics Spring, Tom Carter. tom/

BLAST Basics. ... Elements of Bioinformatics Spring, Tom Carter.  tom/ BLAST Basics...... Elements of Bioinformatics Spring, 2003 Tom Carter http://astarte.csustan.edu/ tom/ March, 2003 1 Sequence Comparison One of the fundamental tasks we would like to do in bioinformatics

More information

NATIONAL OPEN UNIVERSITY OF NIGERIA SCHOOL OF ARTS AND SOCIAL SCIENCES COURSE CODE: BIO 316 COURSE TITLE: INTRODUCTION TO BIOINFORMATICS

NATIONAL OPEN UNIVERSITY OF NIGERIA SCHOOL OF ARTS AND SOCIAL SCIENCES COURSE CODE: BIO 316 COURSE TITLE: INTRODUCTION TO BIOINFORMATICS NATIONAL OPEN UNIVERSITY OF NIGERIA SCHOOL OF ARTS AND SOCIAL SCIENCES COURSE CODE: BIO 316 COURSE TITLE: INTRODUCTION TO BIOINFORMATICS 1 Course Code : BIO 316 Course Title : Introduction to Bioinformatics

More information

Bioinformatic tools for metagenomic data analysis

Bioinformatic tools for metagenomic data analysis Bioinformatic tools for metagenomic data analysis MEGAN - blast-based tool for exploring taxonomic content MG-RAST (SEED, FIG) - rapid annotation of metagenomic data, phylogenetic classification and metabolic

More information

Exploring the Genetic Basis for Behavior. Instructor s Notes

Exploring the Genetic Basis for Behavior. Instructor s Notes Exploring the Genetic Basis for Behavior Instructor s Notes Introduction This lab was designed for our 300-level Advanced Genetics course taken by juniors and seniors majoring in Biology or Biochemistry.

More information

Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

Gapped BLAST and PSI-BLAST: a new generation of protein database search programs 1997 Oxford University Press Nucleic Acids Research, 1997, Vol. 25, No. 17 3389 3402 Gapped BLAST and PSI-BLAST: a new generation of protein database search programs Stephen F. Altschul*, Thomas L. Madden,

More information

Computer aided modeling of a fructose repressor

Computer aided modeling of a fructose repressor Computer aided modeling of a fructose repressor Miia Helanto and Kristiina Kiviharju Abstract The bioconversion of fructose to mannitol is a commercially interesting bioprocess. Fructose can, however be

More information

Introduction to Microarray Data Analysis and Gene Networks. Alvis Brazma European Bioinformatics Institute

Introduction to Microarray Data Analysis and Gene Networks. Alvis Brazma European Bioinformatics Institute Introduction to Microarray Data Analysis and Gene Networks Alvis Brazma European Bioinformatics Institute A brief outline of this course What is gene expression, why it s important Microarrays and how

More information

HINT-KB: The Human Interactome Knowledge Base

HINT-KB: The Human Interactome Knowledge Base HINT-KB: The Human Interactome Knowledge Base Konstantinos Theofilatos 1, Christos Dimitrakopoulos 1, Dimitrios Kleftogiannis 2, Charalampos Moschopoulos 3, Stergios Papadimitriou 4, Spiros Likothanassis

More information

Glossary of Commonly used Annotation Terms

Glossary of Commonly used Annotation Terms Glossary of Commonly used Annotation Terms Akela a general use server for the annotation group as well as other groups throughout TIGR. Annotation Notebook a link from the gene list page that is associated

More information

Germ-line vs somatic-variation theories

Germ-line vs somatic-variation theories BME 128 Tuesday April 26 (1) Filling in the gaps Antibody diversity, how is it achieved? - by specialised (!) mechanisms Chp6 (Protein Diversity & Sequence Analysis) - more about the main concepts in this

More information

From Gene to Function: In Silico Warfare on the West Nile Virus

From Gene to Function: In Silico Warfare on the West Nile Virus Pharmaceutical case study Page 1 of 5 From Gene to Function: In Silico Warfare on the West Nile Virus Anne Marie Quinn, Luke Fisher and Dana Haley-Vicente Accelrys Inc., San Diego, CA Can we produce reliable

More information

TIGR THE INSTITUTE FOR GENOMIC RESEARCH

TIGR THE INSTITUTE FOR GENOMIC RESEARCH Introduction to Genome Annotation: Overview of What You Will Learn This Week C. Robin Buell May 21, 2007 Types of Annotation Structural Annotation: Defining genes, boundaries, sequence motifs e.g. ORF,

More information

Analysis of Microarray Data

Analysis of Microarray Data Analysis of Microarray Data Lecture 3: Visualization and Functional Analysis George Bell, Ph.D. Senior Bioinformatics Scientist Bioinformatics and Research Computing Whitehead Institute Outline Review

More information

Small Genome Annotation and Data Management at TIGR

Small Genome Annotation and Data Management at TIGR Small Genome Annotation and Data Management at TIGR Michelle Gwinn, William Nelson, Robert Dodson, Steven Salzberg, Owen White Abstract TIGR has developed, and continues to refine, a comprehensive, efficient

More information

BLAST. Subject: The result from another organism that your query was matched to.

BLAST. Subject: The result from another organism that your query was matched to. BLAST (Basic Local Alignment Search Tool) Note: This is a complete transcript to the powerpoint. It is good to read through this once to understand everything. If you ever need help and just need a quick

More information

Biotechnology Explorer

Biotechnology Explorer Biotechnology Explorer C. elegans Behavior Kit Bioinformatics Supplement explorer.bio-rad.com Catalog #166-5120EDU This kit contains temperature-sensitive reagents. Open immediately and see individual

More information