Supplemental Data. Steiner et al. Plant Cell. (2012) /tpc

Size: px
Start display at page:

Download "Supplemental Data. Steiner et al. Plant Cell. (2012) /tpc"

Transcription

1 Supplemental Figure 1. SPY does not interact with free GST. Invitro pull-down assay using E. coli-expressed MBP-SPY and GST, GST-TCP14 and GST-TCP15. MBP-SPY was used as bait and incubated with equal amount of GST, GST-TCP14 or GST-TCP15. Amylose resin was used to pull down MBP-SPY and its interacting proteins. Left panels (pull-down): an anti-gst antibody was used to detect GST, GST-TCP14 or GST-TCP15. The blot was striped and re-probed with anti-mbp antibody to detect MBP-SPY. Right panels (input): amounts of proteins added to the assays. Full-length GST- TCP14 = 80.1 kd, GST-TCP15 = 62.5 kd, MBP-SPY = kd and GST =

2 Supplemental Figure 2. Overexpression of TCP14 under the regulation of the CUC2 or FIL promoters only slightly affected plant development. Three weeks old WT (Ler) and transactivated transgenic plants overexpressing TCP14 under the regulation of CUC2 (CUC2 pro >>TCP14) or FIL (FIL pro >>TCP14) promoters. Bars = 1cm 2

3 Supplemental Figure 3. TCP14 activity requires functional SPY. A. Inflorescences and flowers of WT Ler, transactivated AS1 pro >>TCP14 in Ler, spy-4, transctivated AS1 pro >>TCP14 in spy- 4 and progeny of transctivated AS1 pro >>TCP14 spy-4 plants crossed to WT Ler (spy-4 AS1 pro >>TCP14 x WT). B and C. The activity of the AS1 promoter in the transactivated AS1 pro >>TCP14/GFP WT (AS1 pro >>GFP) and spy-4 (spy-4 AS1 pro >>GFP) seedlings (B) and flowers (C) was confirmed by the detection of the GFP signal using fluorescence binocular (excitation 488 nm, emission 520 nm; Leica MZFL III, St. Gallen, Switzerland). Bars in A - inflorescence = 1 cm; single flower = 1 mm. 3

4 Supplemental Figure 4. Overexpression of TCP14 and TCP15 suppresses petal development. Single flowers of WT Ler and transgenic Ler expressing TCP14 or TCP15 under the regulation of the AS1 promoter in transactivated lines (AS1 pro >>TCP14 and AS1 pro >>TCP15). Bars = 1 mm. 4

5 Supplemental Figure 5. SEC interacts with TCP14 and TCP15. In-vitro pull-down assay using E. coli-expressed MBP-SEC (fulllength SEC), GST, GST-TCP14 and GST-TCP15. MBP-SEC was used as bait and incubated with equal amount of GST, GST-TCP14 or GST-TCP15. Amylose resin was used to pull down MBP-SEC and its interacting proteins. Left panels (pull-down): An anti-gst antibody was used to detect the GST, GST-TCP14 or GST-TCP15. The blot was striped and re-probed with anti-mbp antibody to detect MBP-SPY. Right panels (input): amounts of proteins added to the assays. Full-length GST-TCP14 = 80.1 kd, GST-TCP15 = 62.5 kd, MBP-SEC = kd and GST =

6 Supplemental Figure 6. SEC does not modify GST. ARR5-GST was co-expressed with SEC in E. coli. Duplicate blots were probed to detect GlcNAc modified proteins (GalT) or GST (α-gst). Although the fusion protein was highly expressed it was not modified. The only GlcNAc modified proteins detected were SEC and truncated forms of SEC. 6

7 Supplemental Figure 7. SEC modifies TCP 2, 8, 19, 23 and 24. Clones of TCP coding regions constructed in the vector puni51 were obtained from the ABRC and recombined with phb3-his6 (ABRC) to create a plasmid expressing a HIS-tagged version of the TCP. The HIS-tagged TCP 2, 8, 19, 23 and 24 and an Arabidopsis protein that is not modified by SEC, At2G33430 (C), were coexpressed in E. coli without SEC (-) or with wild-type SEC (+), expressed from pacyc-mal-sec (Scott et al. 2006). Blots containing total E. coli proteins were prepared and proteins bearing GlcNAc modifications were labeled with 3 H-galactose. The expected location of the HIS-TCP protein is indicated by the red dot. Other SEC-modified proteins are truncated forms of SEC or truncated forms of the TCP. TCP 4, 9, 11, and 21 were also tested and either were poorly expressed (TCP4) or had such weak signal that we cannot be confident that they are modified. 7

8 Supplemental Figure 8. The double mutant tcp14 tcp15 and spy-4 share similar phenotypes. A. Rosette leaves (seventh leaf) of WT Col, tcp15, tcp14, tcp14 tcp15 and spy-4 taken from plants grown under short-day conditions (8 h of light). B. Flower buds of WT Col, tcp15, tcp14, tcp14 tcp15 and spy-4. Bar in A = 1 cm, bar in B = 1 mm. 8

9 Supplemental Figure 9. The loss of TCP14 and TCP15 has no effect on GA responses. A. Germination of WT Col, spy-4 and tcp14 tcp15 seeds on 2 mg/l paclobutrazol. B. Number of leaves to flowering in Wt Col, spy-4 and tcp14 tcp15 grown under short day conditions (8 h light). Values are means of ten plants ± SE. 9

10 Supplemental Figure 10. Expression of ARR5, but not TCP14 or TCP15, is promoted by CK. Seedlings were treated with 10 µm BA or water (Mock) and 4 h later RNA was extracted and analyzed by qrt-pcr for the expression of TCP14, TCP15 and ARR5. Values are means of three biological replicates ± SE. 10

11 Supplemental Figure 11. Reducing CK levels suppresses TCP14 overexpression effects. A. Three weeks old WT Ler, AS1 pro >>TCP14, AS1 pro >>CKX3 and AS1 pro >>TCP14/CKX3 plants. B. Inflorescences of WT and the different transgenic lines. C. Representative fifth leaf from mature WT Ler, AS1 pro >>TCP14, AS1 pro >>CKX3 and AS1 pro >>TCP14/CKX3 plants. D. PCR analyses to DNA extracted from WT Ler and the different transgenic lines using primers specific to OP:CKX3 or OP:TCP14. Bar in A and B = 1 cm. 11

12 Supplemental Figure 12. Overexpressing CKX3 suppresses TCP14 activity and this is reversed by exogenous CK. Inflorescences of WT Ler, AS1 pro >>TCP14, AS1 pro >>CKX3 and AS1 pro >>TCP14/CKX3 plants non-treated (left) and treated (right) with 50 µm BA. 12

13 Purpose Primer Sequence (5' to 3' ) Cloning- TCP14F GGCATATGCAAAAGCCAACATCAAG Yeast Two Hybrid TCP14R GGCTCGAGCTAATCTTGCTGATCCTCCT Cloning- Yeast Two Hybrid TCP15F TCP15R AACATATGGATCCGGATCCGGATCA AACTCGAGCTAGGAATGATGACTGGTGC Cloning- invitro pull TCP14_F GGGACAAGTTTGTACAAAAAAGCAGGCTTC ATGCAAAAGCCAACATCAAGT down TCP14_R GGGGACCACTTTGTACAAGAAAGCTGGGTC TAATCTTGCTGATCCTCCT Cloning- invitro pull TCP15_F GGGGACAAGTTTGTACAAAAAAGCAGGCTT CATGGATCCGGATCCGGATCATAACCATCG down TCP15_R GGGGACCACTTTGTACAAGAAAGCTGGGTC TAGGAATGATGACTGGTGC Cloning- invitro pull SEC_F GGGGACAAGTTTGTACAAAAAAGCAGGCTT CATGATCTCGTCCAAAAACGGAGCTGCC down SEC_R GGGGACCACTTTGTACAAGAAAGCTGGGTT TATCTGTCATGTGGGAATTCTAGG Cloning- invitro pull SPY_F GGGGACAAGTTTGTACAAAAAAGCAGGCTA TATGGTGGGACTGGAAGATGATACT down SPY_R GGGGACCACTTTGTACAAGAAAGCTGGGTT CTAGCTAGTGGAGTCCATTCTCTTT PCR analysis TCP14_F ATAATCCAACAAAGCAAGAA OCS_R ATAGGCGTCTCGCATATCTC PCR analysis CKX3_F GGTCAAACGACATCGTGTCA OCS_R ATAGGCGTCTCGCATATCTC PCR analysis TUB_F AGATTCTTCACATCCAGGGTGGTC qrt-pcr analysis qrt-pcr analysis qrt-pcr analysis TUB_R TCP14-RT_F TCP14-RT_R TCP15-RT_F TCP15-RT_R ARR5-RT_F ARR5-RT_R CTCACTACATCGCCTGAACATCTC CGTCGTCTTTGTTTCCTGGT TCTCCTTCTTGCTTTGTTGGA CCTTTGGCTTCTGGTTATGG TTGTTATGGTTCCCCGTCTC GAAGTTCATCGAGCGGTTACTC TTAATCTTCAGATCCTCAAATCCA qrt-pcr TUB-RT_F AAACTCACTACCCCCAGCTTT 13

14 analysis TUB-RT_R GAGAGGAGCAAAACCAACCA Cloning- O- GlcNAc modification Cloning- O- GlcNAc modification Cloning- O- GlcNAc modification Cloning- CUC2 promoter SEC-B1_F SEC-B2_R-1 TCP14_F Gateway TCP14_R Gateway TCP15_F Gateway TCP15_R Gateway CUC2pro_F CUC2pro_R GGGGACAAGTTTGTACAAAAAAGCAGGCTC GATGATCTCGTCCAAAAACGGAGCTG GGGGACCACTTTGTACAAGAAAGCTGGGTT TTATCTGTCATGTGGGAATTCTAGG GGGGACAAGTTTGTACAAAAAAGCAGGCTT CATGCAAAAGCCAACATCAAGT GGGGACCACTTTGTACAAGAAAGCTGGGTC TAATCTTGCTGATCCTCCT GGGGACAAGTTTGTACAAAAAAGCAGGCTT CATGGATCCGGATCCGGATCATAACCATCG GGGGACCACTTTGTACAAGAAAGCTGGGTC TAGGAA TGATGACTGGTGC CTCGAGAGTGAAGACGCGAACAAGTTGC GGATCCTAAGAAGAAAGATCTAAAGCTTTT GTTTGAGA Supplemental Table 1. Primers used in this study. 14

A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana

A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 Journal of Plant Research A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana Linna Leng 1 Qianqian Liang

More information

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table.

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of

More information

Supplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and

Supplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and Supplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and PHT1 Protein Amounts. (A) Shoot morphology of 19-day-old nla mutants under Pi-sufficient conditions. (B) [ 33 P]Pi uptake

More information

Construction of plant complementation vector and generation of transgenic plants

Construction of plant complementation vector and generation of transgenic plants MATERIAL S AND METHODS Plant materials and growth conditions Arabidopsis ecotype Columbia (Col0) was used for this study. SALK_072009, SALK_076309, and SALK_027645 were obtained from the Arabidopsis Biological

More information

Supplemental Data. mir156-regulated SPL Transcription. Factors Define an Endogenous Flowering. Pathway in Arabidopsis thaliana

Supplemental Data. mir156-regulated SPL Transcription. Factors Define an Endogenous Flowering. Pathway in Arabidopsis thaliana Cell, Volume 138 Supplemental Data mir156-regulated SPL Transcription Factors Define an Endogenous Flowering Pathway in Arabidopsis thaliana Jia-Wei Wang, Benjamin Czech, and Detlef Weigel Table S1. Interaction

More information

Supplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination.

Supplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination. Supplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination. Seeds of Col-0 were harvested from plants grown at 16 C, stored for 2 months, imbibed for indicated

More information

Supplemental Information. Boundary Formation through a Direct. Threshold-Based Readout. of Mobile Small RNA Gradients

Supplemental Information. Boundary Formation through a Direct. Threshold-Based Readout. of Mobile Small RNA Gradients Developmental Cell, Volume 43 Supplemental Information Boundary Formation through a Direct Threshold-Based Readout of Mobile Small RNA Gradients Damianos S. Skopelitis, Anna H. Benkovics, Aman Y. Husbands,

More information

Molecular Cell Biology - Problem Drill 11: Recombinant DNA

Molecular Cell Biology - Problem Drill 11: Recombinant DNA Molecular Cell Biology - Problem Drill 11: Recombinant DNA Question No. 1 of 10 1. Which of the following statements about the sources of DNA used for molecular cloning is correct? Question #1 (A) cdna

More information

Figure S1. Figure S2. Figure S3 HB Anti-FSP27 (COOH-terminal peptide) Ab. Anti-GST-FSP27(45-127) Ab.

Figure S1. Figure S2. Figure S3 HB Anti-FSP27 (COOH-terminal peptide) Ab. Anti-GST-FSP27(45-127) Ab. / 36B4 mrna ratio Figure S1 * 2. 1.6 1.2.8 *.4 control TNFα BRL49653 Figure S2 Su bw AT p iw Anti- (COOH-terminal peptide) Ab Blot : Anti-GST-(45-127) Ab β-actin Figure S3 HB2 HW AT BA T Figure S4 A TAG

More information

Alternative Cleavage and Polyadenylation of RNA

Alternative Cleavage and Polyadenylation of RNA Developmental Cell 18 Supplemental Information The Spen Family Protein FPA Controls Alternative Cleavage and Polyadenylation of RNA Csaba Hornyik, Lionel C. Terzi, and Gordon G. Simpson Figure S1, related

More information

Genetics - Problem Drill 19: Dissection of Gene Function: Mutational Analysis of Model Organisms

Genetics - Problem Drill 19: Dissection of Gene Function: Mutational Analysis of Model Organisms Genetics - Problem Drill 19: Dissection of Gene Function: Mutational Analysis of Model Organisms No. 1 of 10 1. The mouse gene knockout is based on. (A) Homologous recombination (B) Site-specific recombination

More information

Supplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/-

Supplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- #1074683s 1 Supplemental Online Material Materials and Methods Cell lines and tissue culture The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- knock-out animals

More information

Using mutants to clone genes

Using mutants to clone genes Using mutants to clone genes Objectives 1. What is positional cloning? 2. What is insertional tagging? 3. How can one confirm that the gene cloned is the same one that is mutated to give the phenotype

More information

Recombinant DNA Technology. The Role of Recombinant DNA Technology in Biotechnology. yeast. Biotechnology. Recombinant DNA technology.

Recombinant DNA Technology. The Role of Recombinant DNA Technology in Biotechnology. yeast. Biotechnology. Recombinant DNA technology. PowerPoint Lecture Presentations prepared by Mindy Miller-Kittrell, North Carolina State University C H A P T E R 8 Recombinant DNA Technology The Role of Recombinant DNA Technology in Biotechnology Biotechnology?

More information

Technical tips Session 5

Technical tips Session 5 Technical tips Session 5 Chromatine Immunoprecipitation (ChIP): This is a powerful in vivo method to quantitate interaction of proteins associated with specific regions of the genome. It involves the immunoprecipitation

More information

Contents... vii. List of Figures... xii. List of Tables... xiv. Abbreviatons... xv. Summary... xvii. 1. Introduction In vitro evolution...

Contents... vii. List of Figures... xii. List of Tables... xiv. Abbreviatons... xv. Summary... xvii. 1. Introduction In vitro evolution... vii Contents Contents... vii List of Figures... xii List of Tables... xiv Abbreviatons... xv Summary... xvii 1. Introduction...1 1.1 In vitro evolution... 1 1.2 Phage Display Technology... 3 1.3 Cell surface

More information

Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling

Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Glendining KA 1, Markie D 2, Gardner RJM 4, Franz EA 3, Robertson SP 4, Jasoni CL 1 Supplementary

More information

CHAPTER 9 DNA Technologies

CHAPTER 9 DNA Technologies CHAPTER 9 DNA Technologies Recombinant DNA Artificially created DNA that combines sequences that do not occur together in the nature Basis of much of the modern molecular biology Molecular cloning of genes

More information

Nature Structural and Molecular Biology: doi: /nsmb.2937

Nature Structural and Molecular Biology: doi: /nsmb.2937 Supplementary Figure 1 Multiple sequence alignment of the CtIP N-terminal domain, purified CtIP protein constructs and details of the 2F o F c electron density map of CtIP-NTD. (a) Multiple sequence alignment,

More information

Title: Production and characterisation of monoclonal antibodies against RAI3 and its expression in human breast cancer

Title: Production and characterisation of monoclonal antibodies against RAI3 and its expression in human breast cancer Author's response to reviews Title: Production and characterisation of monoclonal antibodies against RAI3 and its expression in human breast cancer Authors: Hannah Jörißen (hannah.joerissen@molbiotech.rwth-aachen.de)

More information

Supplementary information, Figure S1

Supplementary information, Figure S1 Supplementary information, Figure S1 (A) Schematic diagram of the sgrna and hspcas9 expression cassettes in a single binary vector designed for Agrobacterium-mediated stable transformation of Arabidopsis

More information

Learning Objectives :

Learning Objectives : Learning Objectives : Understand the basic differences between genomic and cdna libraries Understand how genomic libraries are constructed Understand the purpose for having overlapping DNA fragments in

More information

Roche Molecular Biochemicals Technical Note No. LC 10/2000

Roche Molecular Biochemicals Technical Note No. LC 10/2000 Roche Molecular Biochemicals Technical Note No. LC 10/2000 LightCycler Overview of LightCycler Quantification Methods 1. General Introduction Introduction Content Definitions This Technical Note will introduce

More information

Toll Receptor-Mediated Hippo Signaling Controls Innate Immunity in Drosophila

Toll Receptor-Mediated Hippo Signaling Controls Innate Immunity in Drosophila Cell Supplemental Information Toll Receptor-Mediated Hippo Signaling Controls Innate Immunity in Drosophila Bo Liu, Yonggang Zheng, Feng Yin, Jianzhong Yu, Neal Silverman, and Duojia Pan Supplemental Experimental

More information

Supplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons

Supplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons Neuron, Volume 61 Supplemental Data LMO4 Controls the Balance between Excitatory and Inhibitory Spinal V2 Interneurons Kaumudi Joshi, Seunghee Lee, Bora Lee, Jae W. Lee, and Soo-Kyung Lee Supplemental

More information

3. human genomics clone genes associated with genetic disorders. 4. many projects generate ordered clones that cover genome

3. human genomics clone genes associated with genetic disorders. 4. many projects generate ordered clones that cover genome Lectures 30 and 31 Genome analysis I. Genome analysis A. two general areas 1. structural 2. functional B. genome projects a status report 1. 1 st sequenced: several viral genomes 2. mitochondria and chloroplasts

More information

sicker; i.e. to test whether we can reverse the mutant phenotype of mec1-100 when the suppressor gene is ectopically over-expressed in mec1-100.

sicker; i.e. to test whether we can reverse the mutant phenotype of mec1-100 when the suppressor gene is ectopically over-expressed in mec1-100. Internship Report ~FMI (Basel, Switzerland)~ Kyoto University Faculty of Medicine 1 st grade Yuiko Hirata This summer I went to the FMI (Friedrich Miescher Institute for Biomedical Research) in Basel.

More information

2054, Chap. 14, page 1

2054, Chap. 14, page 1 2054, Chap. 14, page 1 I. Recombinant DNA technology (Chapter 14) A. recombinant DNA technology = collection of methods used to perform genetic engineering 1. genetic engineering = deliberate modification

More information

Cassette denotes the ORFs expressed by the expression cassette targeted by the PCR primers used to

Cassette denotes the ORFs expressed by the expression cassette targeted by the PCR primers used to Stanyon, C.A., Limjindaporn, T., and Finley, Jr., R.L. Simultaneous transfer of open reading frames into several different expression vectors. Biotechniques, 35, 520-536, 2003. http://www.biotechniques.com

More information

CHAPTER 20 DNA TECHNOLOGY AND GENOMICS. Section A: DNA Cloning

CHAPTER 20 DNA TECHNOLOGY AND GENOMICS. Section A: DNA Cloning Section A: DNA Cloning 1. DNA technology makes it possible to clone genes for basic research and commercial applications: an overview 2. Restriction enzymes are used to make recombinant DNA 3. Genes can

More information

Bacterial DNA replication

Bacterial DNA replication Bacterial DNA replication Summary: What problems do these proteins solve? Tyr OH attacks PO4 and forms a covalent intermediate Structural changes in the protein open the gap by 20 Å! 1 Summary: What problems

More information

MIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr.

MIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. MIT Department of Biology 7.01: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. Claudette Gardel iv) Would Xba I be useful for cloning? Why or why not?

More information

TrueORF TM cdna Clones and PrecisionShuttle TM Vector System

TrueORF TM cdna Clones and PrecisionShuttle TM Vector System TrueORF TM cdna Clones and PrecisionShuttle TM Vector System Application Guide Table of Contents Package Contents and Storage Conditions... 2 Related, Optional Reagents... 2 Related Products... 2 Available

More information

M Keramatipour 2. M Keramatipour 1. M Keramatipour 4. M Keramatipour 3. M Keramatipour 5. M Keramatipour

M Keramatipour 2. M Keramatipour 1. M Keramatipour 4. M Keramatipour 3. M Keramatipour 5. M Keramatipour Molecular Cloning Methods Mohammad Keramatipour MD, PhD keramatipour@tums.ac.ir Outline DNA recombinant technology DNA cloning co Cell based PCR PCR-based Some application of DNA cloning Genomic libraries

More information

Genetics Lecture 21 Recombinant DNA

Genetics Lecture 21 Recombinant DNA Genetics Lecture 21 Recombinant DNA Recombinant DNA In 1971, a paper published by Kathleen Danna and Daniel Nathans marked the beginning of the recombinant DNA era. The paper described the isolation of

More information

Nature Neuroscience: doi: /nn Supplementary Figure 1

Nature Neuroscience: doi: /nn Supplementary Figure 1 Supplementary Figure 1 PCR-genotyping of the three mouse models used in this study and controls for behavioral experiments after semi-chronic Pten inhibition. a-c. DNA from App/Psen1 (a), Pten tg (b) and

More information

Lecture 25 (11/15/17)

Lecture 25 (11/15/17) Lecture 25 (11/15/17) Reading: Ch9; 328-332 Ch25; 990-995, 1005-1012 Problems: Ch9 (study-guide: applying); 1,2 Ch9 (study-guide: facts); 7,8 Ch25 (text); 1-3,5-7,9,10,13-15 Ch25 (study-guide: applying);

More information

The Two-Hybrid System

The Two-Hybrid System Encyclopedic Reference of Genomics and Proteomics in Molecular Medicine The Two-Hybrid System Carolina Vollert & Peter Uetz Institut für Genetik Forschungszentrum Karlsruhe PO Box 3640 D-76021 Karlsruhe

More information

Functional Genomics in Plants

Functional Genomics in Plants Functional Genomics in Plants Jeffrey L Bennetzen, Purdue University, West Lafayette, Indiana, USA Functional genomics refers to a suite of genetic technologies that will contribute to a comprehensive

More information

Candidate region (0.74 Mb) ATC TCT GGG ACT CAT GAG CAG GAG GCT AGC ATC TCT GGG ACT CAT TAG CAG GAG GCT AGC

Candidate region (0.74 Mb) ATC TCT GGG ACT CAT GAG CAG GAG GCT AGC ATC TCT GGG ACT CAT TAG CAG GAG GCT AGC A idm-3 idm-3 B Physical distance (Mb) 4.6 4.86.6 8.4 C Chr.3 Recom. Rate (%) ATG 3.9.9.9 9.74 Candidate region (.74 Mb) n=4 TAA D idm-3 G3T(E4) G4A(W988) WT idm-3 ATC TCT GGG ACT CAT GAG CAG GAG GCT AGC

More information

A 5 P degradation hot spot influences molecular farming of anticancerogenic nuclease TBN1 in tobacco cells

A 5 P degradation hot spot influences molecular farming of anticancerogenic nuclease TBN1 in tobacco cells Plant Cell, Tissue and Organ Culture (PCTOC) A 5 P degradation hot spot influences molecular farming of anticancerogenic nuclease TBN1 in tobacco cells Anna Týcová a,b, Rajen J. J. Piernikarczyk c, Michael

More information

HCT116 SW48 Nutlin: p53

HCT116 SW48 Nutlin: p53 Figure S HCT6 SW8 Nutlin: - + - + p GAPDH Figure S. Nutlin- treatment induces p protein. HCT6 and SW8 cells were left untreated or treated for 8 hr with Nutlin- ( µm) to up-regulate p. Whole cell lysates

More information

AP Biology. Chapter 20. Biotechnology: DNA Technology & Genomics. Biotechnology. The BIG Questions. Evolution & breeding of food plants

AP Biology. Chapter 20. Biotechnology: DNA Technology & Genomics. Biotechnology. The BIG Questions. Evolution & breeding of food plants What do you notice about these phrases? radar racecar Madam I m Adam Able was I ere I saw Elba a man, a plan, a canal, Panama Was it a bar or a bat I saw? Chapter 20. Biotechnology: DNA Technology & enomics

More information

Lecture 3 Mutagens and Mutagenesis. 1. Mutagens A. Physical and Chemical mutagens B. Transposons and retrotransposons C. T-DNA

Lecture 3 Mutagens and Mutagenesis. 1. Mutagens A. Physical and Chemical mutagens B. Transposons and retrotransposons C. T-DNA Lecture 3 Mutagens and Mutagenesis 1. Mutagens A. Physical and Chemical mutagens B. Transposons and retrotransposons C. T-DNA 2. Mutagenesis A. Screen B. Selection C. Lethal mutations Read: 508-514 Figs:

More information

Certificate of Analysis

Certificate of Analysis Certificate of Analysis pet6xhn Expression Vector Set Contents Product Information... 1 pet6xhn-n, pet6xhn-c, and pet6xhn-gfpuv Vector Information... 2 Location of Features... 4 Additional Information...

More information

Introducing new DNA into the genome requires cloning the donor sequence, delivery of the cloned DNA into the cell, and integration into the genome.

Introducing new DNA into the genome requires cloning the donor sequence, delivery of the cloned DNA into the cell, and integration into the genome. Key Terms Chapter 32: Genetic Engineering Cloning describes propagation of a DNA sequence by incorporating it into a hybrid construct that can be replicated in a host cell. A cloning vector is a plasmid

More information

A CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish

A CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish Developmental Cell Supplemental Information A CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish Julien Ablain, Ellen M. Durand, Song Yang, Yi Zhou, and Leonard I. Zon % larvae

More information

RNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by. 5 AGACACAAACACCAUUGUCACACUCCACAGC; Rand-2 OMe,

RNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by. 5 AGACACAAACACCAUUGUCACACUCCACAGC; Rand-2 OMe, Materials and methods Oligonucleotides and DNA constructs RNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by Dharmacon Inc. (Lafayette, CO). The sequences were: 122-2 OMe, 5

More information

To isolate single GNS 144 cell clones, cells were plated at a density of 1cell/well

To isolate single GNS 144 cell clones, cells were plated at a density of 1cell/well Supplemental Information: Supplemental Methods: Cell culture To isolate single GNS 144 cell clones, cells were plated at a density of 1cell/well in 96 well Primaria plates in GNS media and incubated at

More information

Supporting Information

Supporting Information Supporting Information Yuan et al. 10.1073/pnas.0906869106 Fig. S1. Heat map showing that Populus ICS is coregulated with orthologs of Arabidopsis genes involved in PhQ biosynthesis and PSI function, but

More information

Supplementary Fig. 1 related to Fig. 1 Clinical relevance of lncrna candidate

Supplementary Fig. 1 related to Fig. 1 Clinical relevance of lncrna candidate Supplementary Figure Legends Supplementary Fig. 1 related to Fig. 1 Clinical relevance of lncrna candidate BC041951 in gastric cancer. (A) The flow chart for selected candidate lncrnas in 660 up-regulated

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION Dynamic Phosphorylation of HP1 Regulates Mitotic Progression in Human Cells Supplementary Figures Supplementary Figure 1. NDR1 interacts with HP1. (a) Immunoprecipitation using

More information

2.5. Equipment and materials supplied by user PCR based template preparation Influence of temperature on in vitro EGFP synthesis 11

2.5. Equipment and materials supplied by user PCR based template preparation Influence of temperature on in vitro EGFP synthesis 11 Manual 15 Reactions LEXSY in vitro Translation Cell-free protein expression kit based on Leishmania tarentolae for PCR-based template generation Cat. No. EGE-2010-15 FOR RESEARCH USE ONLY. NOT INTENDED

More information

TECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits

TECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits Catalog Numbers APPA001 In Vitro Bacterial Split GFP "Fold 'n' Glow" Solubility Assay Kit (Green) APPA008 In Vitro Bacterial

More information

Lecture Four. Molecular Approaches I: Nucleic Acids

Lecture Four. Molecular Approaches I: Nucleic Acids Lecture Four. Molecular Approaches I: Nucleic Acids I. Recombinant DNA and Gene Cloning Recombinant DNA is DNA that has been created artificially. DNA from two or more sources is incorporated into a single

More information

Supporting Online Material for

Supporting Online Material for www.sciencemag.org/cgi/content/full/323/5910/124/dc1 Supporting Online Material for Regulation of Neuronal Survival Factor MEF2D by Chaperone-Mediated Autophagy Qian Yang, Hua She, Marla Gearing, Emanuela

More information

240EQ222 - Genetic Engineering

240EQ222 - Genetic Engineering Coordinating unit: Teaching unit: Academic year: Degree: ECTS credits: 2017 295 - EEBE - Barcelona East School of Engineering 713 - EQ - Department of Chemical Engineering MASTER'S DEGREE IN CHEMICAL ENGINEERING

More information

Chapter 20: Biotechnology

Chapter 20: Biotechnology Name Period The AP Biology exam has reached into this chapter for essay questions on a regular basis over the past 15 years. Student responses show that biotechnology is a difficult topic. This chapter

More information

The microtubule-associated tau protein has intrinsic acetyltransferase activity. Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and

The microtubule-associated tau protein has intrinsic acetyltransferase activity. Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and SUPPLEMENTARY INFORMATION: The microtubule-associated tau protein has intrinsic acetyltransferase activity Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and Virginia M.Y. Lee Cohen

More information

Supporting Information. SI Material and Methods

Supporting Information. SI Material and Methods Supporting Information SI Material and Methods RNA extraction and qrt-pcr RNA extractions were done using the classical phenol-chloroform method. Total RNA samples were treated with Turbo DNA-free (Ambion)

More information

Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions

Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Supporting Information Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Lise Schoonen, b Sjors Maassen, b Roeland J. M. Nolte b and Jan C. M. van

More information

TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter

TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter L M Guzman et al. (1995) Journal of Bacteriology 177: 4121-4130 Outline 1. Introduction 2. Objective 3.

More information

Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of

Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of xylose, inducing expression of gfp-tola, localization

More information

Viral RNAi suppressor reversibly binds sirna to. outcompete Dicer and RISC via multiple-turnover

Viral RNAi suppressor reversibly binds sirna to. outcompete Dicer and RISC via multiple-turnover Supplementary Data Viral RNAi suppressor reversibly binds sirna to outcompete Dicer and RISC via multiple-turnover Renata A. Rawlings 1,2, Vishalakshi Krishnan 2 and Nils G. Walter 2 * 1 Biophysics and

More information

Genetic Engineering & Recombinant DNA

Genetic Engineering & Recombinant DNA Genetic Engineering & Recombinant DNA Chapter 10 Copyright The McGraw-Hill Companies, Inc) Permission required for reproduction or display. Applications of Genetic Engineering Basic science vs. Applied

More information

Heterologous protein expression systems

Heterologous protein expression systems IMBB-FORTH Heterologous protein expression systems What are they? Protein expression systems producing desired polypeptides from recombinant genes. Plasmids carry and express the desired recombinant genes

More information

NEW! CHOgro Expression System

NEW! CHOgro Expression System NEW! CHOgro Expression System At Mirus Bio, we know it s all about expression. Introducing the new CHOgro Expression System, a transient transfection platform that finally gets high protein titers with

More information

Genome research in eukaryotes

Genome research in eukaryotes Functional Genomics Genome and EST sequencing can tell us how many POTENTIAL genes are present in the genome Proteomics can tell us about proteins and their interactions The goal of functional genomics

More information

R1 12 kb R1 4 kb R1. R1 10 kb R1 2 kb R1 4 kb R1

R1 12 kb R1 4 kb R1. R1 10 kb R1 2 kb R1 4 kb R1 Bcor101 Sample questions Midterm 3 1. The maps of the sites for restriction enzyme EcoR1 (R1) in the wild type and mutated cystic fibrosis genes are shown below: Wild Type R1 12 kb R1 4 kb R1 _ _ CF probe

More information

Multiple choice questions (numbers in brackets indicate the number of correct answers)

Multiple choice questions (numbers in brackets indicate the number of correct answers) 1 Multiple choice questions (numbers in brackets indicate the number of correct answers) February 1, 2013 1. Ribose is found in Nucleic acids Proteins Lipids RNA DNA (2) 2. Most RNA in cells is transfer

More information

GM130 Is Required for Compartmental Organization of Dendritic Golgi Outposts

GM130 Is Required for Compartmental Organization of Dendritic Golgi Outposts Current Biology, Volume 24 Supplemental Information GM130 Is Required for Compartmental Organization of Dendritic Golgi Outposts Wei Zhou, Jin Chang, Xin Wang, Masha G. Savelieff, Yinyin Zhao, Shanshan

More information

Supporting Online Material for

Supporting Online Material for www.sciencemag.org/cgi/content/full/324/5927/649/dc1 Supporting Online Material for Exchange of Genetic Material Between Cells in Plant Tissue Grafts Sandra Stegemann and Ralph Bock* *To whom correspondence

More information

3 Designing Primers for Site-Directed Mutagenesis

3 Designing Primers for Site-Directed Mutagenesis 3 Designing Primers for Site-Directed Mutagenesis 3.1 Learning Objectives During the next two labs you will learn the basics of site-directed mutagenesis: you will design primers for the mutants you designed

More information

AP Biology Gene Expression/Biotechnology REVIEW

AP Biology Gene Expression/Biotechnology REVIEW AP Biology Gene Expression/Biotechnology REVIEW Multiple Choice Identify the choice that best completes the statement or answers the question. 1. Gene expression can be a. regulated before transcription.

More information

Ramp1 EPD0843_4_B11. EUCOMM/KOMP-CSD Knockout-First Genotyping

Ramp1 EPD0843_4_B11. EUCOMM/KOMP-CSD Knockout-First Genotyping EUCOMM/KOMP-CSD Knockout-First Genotyping Introduction The majority of animals produced from the EUCOMM/KOMP-CSD ES cell resource contain the Knockout-First-Reporter Tagged Insertion allele. As well as

More information

Usp14 EPD0582_2_G09. EUCOMM/KOMP-CSD Knockout-First Genotyping

Usp14 EPD0582_2_G09. EUCOMM/KOMP-CSD Knockout-First Genotyping EUCOMM/KOMP-CSD Knockout-First Genotyping Introduction The majority of animals produced from the EUCOMM/KOMP-CSD ES cell resource contain the Knockout-First-Reporter Tagged Insertion allele. As well as

More information

sirna Transfection Into Primary Neurons Using Fuse-It-siRNA

sirna Transfection Into Primary Neurons Using Fuse-It-siRNA sirna Transfection Into Primary Neurons Using Fuse-It-siRNA This Application Note describes a protocol for sirna transfection into sensitive, primary cortical neurons using Fuse-It-siRNA. This innovative

More information

Introduction to Protein Purification

Introduction to Protein Purification Introduction to Protein Purification 1 Day 1) Introduction to Protein Purification. Input for Purification Protocol Development - Guidelines for Protein Purification Day 2) Sample Preparation before Chromatography

More information

SureSilencing sirna Array Technology Overview

SureSilencing sirna Array Technology Overview SureSilencing sirna Array Technology Overview Pathway-Focused sirna-based RNA Interference Topics to be Covered Who is SuperArray? Brief Introduction to RNA Interference Challenges Facing RNA Interference

More information

Supplementary Information

Supplementary Information Supplementary Information Deletion of the B-B and C-C regions of inverted terminal repeats reduces raav productivity but increases transgene expression Qingzhang Zhou 1, Wenhong Tian 2, Chunguo Liu 3,

More information

Strategies for Improving Soluble Protein Production in E. coli

Strategies for Improving Soluble Protein Production in E. coli Strategies for Improving Soluble Protein Production in E. coli Key Learning Objectives Overview of recombinant protein expression in E. coli Challenges in protein expression Solutions Clone quickly Reduce

More information

Supporting Online Material for

Supporting Online Material for www.sciencemag.org/cgi/content/full/1137999/dc1 Supporting Online Material for Disrupting the Pairing Between let-7 and Enhances Oncogenic Transformation Christine Mayr, Michael T. Hemann, David P. Bartel*

More information

Supplemental Fig. S1. Key to underlines: Key to amino acids:

Supplemental Fig. S1. Key to underlines: Key to amino acids: AspA-F1 AspA 1 MKQMETKGYGYFRKTKAYGLVCGIT--------------LAGALTLGTTSVSADDVTTLNPATNLTTLQTPPTADQTQLAHQAGQQSGELVSEVSNTEWD 86 SspB 1 MQKREV--FG-FRKSKVAKTLCGAV-LGAALIAIADQQVLADEVTETNSTANVAVTTTGNPATNLPEAQGEATEAASQSQAQAGSKDGALPVEVSADDLN

More information

Targeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley

Targeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley Targeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley Nagaveni Budhagatapalli a, Twan Rutten b, Maia Gurushidze a, Jochen Kumlehn a,

More information

The OSU1/QUA2/TSD2-Encoded Putative Methyltransferase Is a Critical Modulator of Carbon and Nitrogen Nutrient Balance Response in Arabidopsis

The OSU1/QUA2/TSD2-Encoded Putative Methyltransferase Is a Critical Modulator of Carbon and Nitrogen Nutrient Balance Response in Arabidopsis The OSU1/QUA2/TSD2-Encoded Putative Methyltransferase Is a Critical Modulator of Carbon and Nitrogen Nutrient Balance Response in Arabidopsis Peng Gao 1., Zeyu Xin 1., Zhi-Liang Zheng 1,2 * 1 Department

More information

Reverse Transcriptase Reverse Transcriptase 100 µl 5X RT Buffer 0.1 M DTT 500 µl Storage -20 C for 24 months

Reverse Transcriptase Reverse Transcriptase 100 µl 5X RT Buffer 0.1 M DTT 500 µl Storage -20 C for 24 months www.smobio.com Product Information Reverse Transcriptase ExcelRT series RP1000 20,000 units Reverse Transcriptase 100 µl 5X RT Buffer 1 ml 0.1 M DTT 500 µl Storage -20 C for 24 months Description The ExcelRT

More information

SYBR Green Realtime PCR Master Mix

SYBR Green Realtime PCR Master Mix Instruction manual SYBR Green Realtime PCR Master Mix 0810 F0924K SYBR Green Realtime PCR Master Mix QPK-201T 1 ml x 1 QPK-201 1 ml x 5 Contents [1] Introduction [2] Components [3] Primer design [4] Detection

More information

Supporting Information-Tables

Supporting Information-Tables Supporting Information-Tables Table S1. Bacterial strains and plasmids used in this work Bacterial strains Description Source of reference Streptococcus pneumoniae 1 Cp1015 non-capsulated and βl susceptible

More information

Lecture 2-3: Using Mutants to study Biological processes

Lecture 2-3: Using Mutants to study Biological processes Lecture 2-3: Using Mutants to study Biological processes Objectives: 1. Why use mutants? 2. How are mutants isolated? 3. What important genetic analyses must be done immediately after a genetic screen

More information

mir-24-mediated down-regulation of H2AX suppresses DNA repair

mir-24-mediated down-regulation of H2AX suppresses DNA repair Supplemental Online Material mir-24-mediated down-regulation of H2AX suppresses DNA repair in terminally differentiated blood cells Ashish Lal 1,4, Yunfeng Pan 2,4, Francisco Navarro 1,4, Derek M. Dykxhoorn

More information

Heme utilization in the Caenorhabditis elegans hypodermal cells is facilitated by hemeresponsive

Heme utilization in the Caenorhabditis elegans hypodermal cells is facilitated by hemeresponsive Supplemental Data Heme utilization in the Caenorhabditis elegans hypodermal cells is facilitated by hemeresponsive gene-2 Caiyong Chen 1, Tamika K. Samuel 1, Michael Krause 2, Harry A. Dailey 3, and Iqbal

More information

Supplementary Information

Supplementary Information Journal : Nature Biotechnology Supplementary Information Targeted genome engineering in human cells with RNA-guided endonucleases Seung Woo Cho, Sojung Kim, Jong Min Kim, and Jin-Soo Kim* National Creative

More information

Yeast Two Hybrid Assay: A Fishing Tale

Yeast Two Hybrid Assay: A Fishing Tale KEYWORDS: yeast two hybrid, molecular interactions, galactose metabolism Special section on techniques: Yeast Two Hybrid Assay: A Fishing Tale Solmaz Sobhanifar Pathology, University of British Columbia

More information

BENG 183 Trey Ideker. Genome Assembly and Physical Mapping

BENG 183 Trey Ideker. Genome Assembly and Physical Mapping BENG 183 Trey Ideker Genome Assembly and Physical Mapping Reasons for sequencing Complete genome sequencing!!! Resequencing (Confirmatory) E.g., short regions containing single nucleotide polymorphisms

More information

Supplementary Figure 1. Isolation of GFPHigh cells.

Supplementary Figure 1. Isolation of GFPHigh cells. Supplementary Figure 1. Isolation of GFP High cells. (A) Schematic diagram of cell isolation based on Wnt signaling activity. Colorectal cancer (CRC) cell lines were stably transduced with lentivirus encoding

More information

SUPPLEMENTAL MATERIAL SUPPLEMANTAL METHODS SUPPLEMENTAL RESULTS

SUPPLEMENTAL MATERIAL SUPPLEMANTAL METHODS SUPPLEMENTAL RESULTS SUPPLEMENTAL MATERIAL SUPPLEMANTAL METHODS hubb and hubb +1 constructs. To create the hubb construct, intermediate PCR products (named UBBwt-1 and UBBwt-2) were obtained using a pcdna3 vector containing

More information

Supplementary Information Design of small molecule-responsive micrornas based on structural requirements for Drosha processing

Supplementary Information Design of small molecule-responsive micrornas based on structural requirements for Drosha processing Supplementary Information Design of small molecule-responsive micrornas based on structural requirements for Drosha processing Chase L. Beisel, Yvonne Y. Chen, Stephanie J. Culler, Kevin G. Hoff, & Christina

More information

Figure S2. Response of mouse ES cells to GSK3 inhibition. Mentioned in discussion

Figure S2. Response of mouse ES cells to GSK3 inhibition. Mentioned in discussion Stem Cell Reports, Volume 1 Supplemental Information Robust Self-Renewal of Rat Embryonic Stem Cells Requires Fine-Tuning of Glycogen Synthase Kinase-3 Inhibition Yaoyao Chen, Kathryn Blair, and Austin

More information

SUPPLEMENTAL MATERIAL

SUPPLEMENTAL MATERIAL SUPPLEMENTAL MATERIAL Materials and Methods Primers for ChIP/qPCR (Fig. 3): CG7939 (RpL32) Rp49+10F Rp49+110R Rp49+241F Rp49+341R Rp49+549F Rp49+613R TCTGGTTTCCGGCAAGGTATGT GCAGTTCAACTCGAAACCGCCAAA ATACTGCCCAAGAAGCTAGCCCAA

More information

mcherry Monoclonal Antibody (16D7) Catalog Number M11217 Product data sheet

mcherry Monoclonal Antibody (16D7) Catalog Number M11217 Product data sheet Website: thermofisher.com Customer Service (US): 1 800 955 6288 ext. 1 Technical Support (US): 1 800 955 6288 ext. 441 mcherry Monoclonal Antibody (16D7) Catalog Number M11217 Product data sheet Details

More information