Supplemental Data. Steiner et al. Plant Cell. (2012) /tpc
|
|
- Jessica Collins
- 6 years ago
- Views:
Transcription
1 Supplemental Figure 1. SPY does not interact with free GST. Invitro pull-down assay using E. coli-expressed MBP-SPY and GST, GST-TCP14 and GST-TCP15. MBP-SPY was used as bait and incubated with equal amount of GST, GST-TCP14 or GST-TCP15. Amylose resin was used to pull down MBP-SPY and its interacting proteins. Left panels (pull-down): an anti-gst antibody was used to detect GST, GST-TCP14 or GST-TCP15. The blot was striped and re-probed with anti-mbp antibody to detect MBP-SPY. Right panels (input): amounts of proteins added to the assays. Full-length GST- TCP14 = 80.1 kd, GST-TCP15 = 62.5 kd, MBP-SPY = kd and GST =
2 Supplemental Figure 2. Overexpression of TCP14 under the regulation of the CUC2 or FIL promoters only slightly affected plant development. Three weeks old WT (Ler) and transactivated transgenic plants overexpressing TCP14 under the regulation of CUC2 (CUC2 pro >>TCP14) or FIL (FIL pro >>TCP14) promoters. Bars = 1cm 2
3 Supplemental Figure 3. TCP14 activity requires functional SPY. A. Inflorescences and flowers of WT Ler, transactivated AS1 pro >>TCP14 in Ler, spy-4, transctivated AS1 pro >>TCP14 in spy- 4 and progeny of transctivated AS1 pro >>TCP14 spy-4 plants crossed to WT Ler (spy-4 AS1 pro >>TCP14 x WT). B and C. The activity of the AS1 promoter in the transactivated AS1 pro >>TCP14/GFP WT (AS1 pro >>GFP) and spy-4 (spy-4 AS1 pro >>GFP) seedlings (B) and flowers (C) was confirmed by the detection of the GFP signal using fluorescence binocular (excitation 488 nm, emission 520 nm; Leica MZFL III, St. Gallen, Switzerland). Bars in A - inflorescence = 1 cm; single flower = 1 mm. 3
4 Supplemental Figure 4. Overexpression of TCP14 and TCP15 suppresses petal development. Single flowers of WT Ler and transgenic Ler expressing TCP14 or TCP15 under the regulation of the AS1 promoter in transactivated lines (AS1 pro >>TCP14 and AS1 pro >>TCP15). Bars = 1 mm. 4
5 Supplemental Figure 5. SEC interacts with TCP14 and TCP15. In-vitro pull-down assay using E. coli-expressed MBP-SEC (fulllength SEC), GST, GST-TCP14 and GST-TCP15. MBP-SEC was used as bait and incubated with equal amount of GST, GST-TCP14 or GST-TCP15. Amylose resin was used to pull down MBP-SEC and its interacting proteins. Left panels (pull-down): An anti-gst antibody was used to detect the GST, GST-TCP14 or GST-TCP15. The blot was striped and re-probed with anti-mbp antibody to detect MBP-SPY. Right panels (input): amounts of proteins added to the assays. Full-length GST-TCP14 = 80.1 kd, GST-TCP15 = 62.5 kd, MBP-SEC = kd and GST =
6 Supplemental Figure 6. SEC does not modify GST. ARR5-GST was co-expressed with SEC in E. coli. Duplicate blots were probed to detect GlcNAc modified proteins (GalT) or GST (α-gst). Although the fusion protein was highly expressed it was not modified. The only GlcNAc modified proteins detected were SEC and truncated forms of SEC. 6
7 Supplemental Figure 7. SEC modifies TCP 2, 8, 19, 23 and 24. Clones of TCP coding regions constructed in the vector puni51 were obtained from the ABRC and recombined with phb3-his6 (ABRC) to create a plasmid expressing a HIS-tagged version of the TCP. The HIS-tagged TCP 2, 8, 19, 23 and 24 and an Arabidopsis protein that is not modified by SEC, At2G33430 (C), were coexpressed in E. coli without SEC (-) or with wild-type SEC (+), expressed from pacyc-mal-sec (Scott et al. 2006). Blots containing total E. coli proteins were prepared and proteins bearing GlcNAc modifications were labeled with 3 H-galactose. The expected location of the HIS-TCP protein is indicated by the red dot. Other SEC-modified proteins are truncated forms of SEC or truncated forms of the TCP. TCP 4, 9, 11, and 21 were also tested and either were poorly expressed (TCP4) or had such weak signal that we cannot be confident that they are modified. 7
8 Supplemental Figure 8. The double mutant tcp14 tcp15 and spy-4 share similar phenotypes. A. Rosette leaves (seventh leaf) of WT Col, tcp15, tcp14, tcp14 tcp15 and spy-4 taken from plants grown under short-day conditions (8 h of light). B. Flower buds of WT Col, tcp15, tcp14, tcp14 tcp15 and spy-4. Bar in A = 1 cm, bar in B = 1 mm. 8
9 Supplemental Figure 9. The loss of TCP14 and TCP15 has no effect on GA responses. A. Germination of WT Col, spy-4 and tcp14 tcp15 seeds on 2 mg/l paclobutrazol. B. Number of leaves to flowering in Wt Col, spy-4 and tcp14 tcp15 grown under short day conditions (8 h light). Values are means of ten plants ± SE. 9
10 Supplemental Figure 10. Expression of ARR5, but not TCP14 or TCP15, is promoted by CK. Seedlings were treated with 10 µm BA or water (Mock) and 4 h later RNA was extracted and analyzed by qrt-pcr for the expression of TCP14, TCP15 and ARR5. Values are means of three biological replicates ± SE. 10
11 Supplemental Figure 11. Reducing CK levels suppresses TCP14 overexpression effects. A. Three weeks old WT Ler, AS1 pro >>TCP14, AS1 pro >>CKX3 and AS1 pro >>TCP14/CKX3 plants. B. Inflorescences of WT and the different transgenic lines. C. Representative fifth leaf from mature WT Ler, AS1 pro >>TCP14, AS1 pro >>CKX3 and AS1 pro >>TCP14/CKX3 plants. D. PCR analyses to DNA extracted from WT Ler and the different transgenic lines using primers specific to OP:CKX3 or OP:TCP14. Bar in A and B = 1 cm. 11
12 Supplemental Figure 12. Overexpressing CKX3 suppresses TCP14 activity and this is reversed by exogenous CK. Inflorescences of WT Ler, AS1 pro >>TCP14, AS1 pro >>CKX3 and AS1 pro >>TCP14/CKX3 plants non-treated (left) and treated (right) with 50 µm BA. 12
13 Purpose Primer Sequence (5' to 3' ) Cloning- TCP14F GGCATATGCAAAAGCCAACATCAAG Yeast Two Hybrid TCP14R GGCTCGAGCTAATCTTGCTGATCCTCCT Cloning- Yeast Two Hybrid TCP15F TCP15R AACATATGGATCCGGATCCGGATCA AACTCGAGCTAGGAATGATGACTGGTGC Cloning- invitro pull TCP14_F GGGACAAGTTTGTACAAAAAAGCAGGCTTC ATGCAAAAGCCAACATCAAGT down TCP14_R GGGGACCACTTTGTACAAGAAAGCTGGGTC TAATCTTGCTGATCCTCCT Cloning- invitro pull TCP15_F GGGGACAAGTTTGTACAAAAAAGCAGGCTT CATGGATCCGGATCCGGATCATAACCATCG down TCP15_R GGGGACCACTTTGTACAAGAAAGCTGGGTC TAGGAATGATGACTGGTGC Cloning- invitro pull SEC_F GGGGACAAGTTTGTACAAAAAAGCAGGCTT CATGATCTCGTCCAAAAACGGAGCTGCC down SEC_R GGGGACCACTTTGTACAAGAAAGCTGGGTT TATCTGTCATGTGGGAATTCTAGG Cloning- invitro pull SPY_F GGGGACAAGTTTGTACAAAAAAGCAGGCTA TATGGTGGGACTGGAAGATGATACT down SPY_R GGGGACCACTTTGTACAAGAAAGCTGGGTT CTAGCTAGTGGAGTCCATTCTCTTT PCR analysis TCP14_F ATAATCCAACAAAGCAAGAA OCS_R ATAGGCGTCTCGCATATCTC PCR analysis CKX3_F GGTCAAACGACATCGTGTCA OCS_R ATAGGCGTCTCGCATATCTC PCR analysis TUB_F AGATTCTTCACATCCAGGGTGGTC qrt-pcr analysis qrt-pcr analysis qrt-pcr analysis TUB_R TCP14-RT_F TCP14-RT_R TCP15-RT_F TCP15-RT_R ARR5-RT_F ARR5-RT_R CTCACTACATCGCCTGAACATCTC CGTCGTCTTTGTTTCCTGGT TCTCCTTCTTGCTTTGTTGGA CCTTTGGCTTCTGGTTATGG TTGTTATGGTTCCCCGTCTC GAAGTTCATCGAGCGGTTACTC TTAATCTTCAGATCCTCAAATCCA qrt-pcr TUB-RT_F AAACTCACTACCCCCAGCTTT 13
14 analysis TUB-RT_R GAGAGGAGCAAAACCAACCA Cloning- O- GlcNAc modification Cloning- O- GlcNAc modification Cloning- O- GlcNAc modification Cloning- CUC2 promoter SEC-B1_F SEC-B2_R-1 TCP14_F Gateway TCP14_R Gateway TCP15_F Gateway TCP15_R Gateway CUC2pro_F CUC2pro_R GGGGACAAGTTTGTACAAAAAAGCAGGCTC GATGATCTCGTCCAAAAACGGAGCTG GGGGACCACTTTGTACAAGAAAGCTGGGTT TTATCTGTCATGTGGGAATTCTAGG GGGGACAAGTTTGTACAAAAAAGCAGGCTT CATGCAAAAGCCAACATCAAGT GGGGACCACTTTGTACAAGAAAGCTGGGTC TAATCTTGCTGATCCTCCT GGGGACAAGTTTGTACAAAAAAGCAGGCTT CATGGATCCGGATCCGGATCATAACCATCG GGGGACCACTTTGTACAAGAAAGCTGGGTC TAGGAA TGATGACTGGTGC CTCGAGAGTGAAGACGCGAACAAGTTGC GGATCCTAAGAAGAAAGATCTAAAGCTTTT GTTTGAGA Supplemental Table 1. Primers used in this study. 14
A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 Journal of Plant Research A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana Linna Leng 1 Qianqian Liang
More informationSupplementary Table 1. The Q-PCR primer sequence is summarized in the following table.
Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of
More informationSupplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and
Supplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and PHT1 Protein Amounts. (A) Shoot morphology of 19-day-old nla mutants under Pi-sufficient conditions. (B) [ 33 P]Pi uptake
More informationConstruction of plant complementation vector and generation of transgenic plants
MATERIAL S AND METHODS Plant materials and growth conditions Arabidopsis ecotype Columbia (Col0) was used for this study. SALK_072009, SALK_076309, and SALK_027645 were obtained from the Arabidopsis Biological
More informationSupplemental Data. mir156-regulated SPL Transcription. Factors Define an Endogenous Flowering. Pathway in Arabidopsis thaliana
Cell, Volume 138 Supplemental Data mir156-regulated SPL Transcription Factors Define an Endogenous Flowering Pathway in Arabidopsis thaliana Jia-Wei Wang, Benjamin Czech, and Detlef Weigel Table S1. Interaction
More informationSupplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination.
Supplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination. Seeds of Col-0 were harvested from plants grown at 16 C, stored for 2 months, imbibed for indicated
More informationSupplemental Information. Boundary Formation through a Direct. Threshold-Based Readout. of Mobile Small RNA Gradients
Developmental Cell, Volume 43 Supplemental Information Boundary Formation through a Direct Threshold-Based Readout of Mobile Small RNA Gradients Damianos S. Skopelitis, Anna H. Benkovics, Aman Y. Husbands,
More informationMolecular Cell Biology - Problem Drill 11: Recombinant DNA
Molecular Cell Biology - Problem Drill 11: Recombinant DNA Question No. 1 of 10 1. Which of the following statements about the sources of DNA used for molecular cloning is correct? Question #1 (A) cdna
More informationFigure S1. Figure S2. Figure S3 HB Anti-FSP27 (COOH-terminal peptide) Ab. Anti-GST-FSP27(45-127) Ab.
/ 36B4 mrna ratio Figure S1 * 2. 1.6 1.2.8 *.4 control TNFα BRL49653 Figure S2 Su bw AT p iw Anti- (COOH-terminal peptide) Ab Blot : Anti-GST-(45-127) Ab β-actin Figure S3 HB2 HW AT BA T Figure S4 A TAG
More informationAlternative Cleavage and Polyadenylation of RNA
Developmental Cell 18 Supplemental Information The Spen Family Protein FPA Controls Alternative Cleavage and Polyadenylation of RNA Csaba Hornyik, Lionel C. Terzi, and Gordon G. Simpson Figure S1, related
More informationGenetics - Problem Drill 19: Dissection of Gene Function: Mutational Analysis of Model Organisms
Genetics - Problem Drill 19: Dissection of Gene Function: Mutational Analysis of Model Organisms No. 1 of 10 1. The mouse gene knockout is based on. (A) Homologous recombination (B) Site-specific recombination
More informationSupplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/-
#1074683s 1 Supplemental Online Material Materials and Methods Cell lines and tissue culture The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- knock-out animals
More informationUsing mutants to clone genes
Using mutants to clone genes Objectives 1. What is positional cloning? 2. What is insertional tagging? 3. How can one confirm that the gene cloned is the same one that is mutated to give the phenotype
More informationRecombinant DNA Technology. The Role of Recombinant DNA Technology in Biotechnology. yeast. Biotechnology. Recombinant DNA technology.
PowerPoint Lecture Presentations prepared by Mindy Miller-Kittrell, North Carolina State University C H A P T E R 8 Recombinant DNA Technology The Role of Recombinant DNA Technology in Biotechnology Biotechnology?
More informationTechnical tips Session 5
Technical tips Session 5 Chromatine Immunoprecipitation (ChIP): This is a powerful in vivo method to quantitate interaction of proteins associated with specific regions of the genome. It involves the immunoprecipitation
More informationContents... vii. List of Figures... xii. List of Tables... xiv. Abbreviatons... xv. Summary... xvii. 1. Introduction In vitro evolution...
vii Contents Contents... vii List of Figures... xii List of Tables... xiv Abbreviatons... xv Summary... xvii 1. Introduction...1 1.1 In vitro evolution... 1 1.2 Phage Display Technology... 3 1.3 Cell surface
More informationSupplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling
Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Glendining KA 1, Markie D 2, Gardner RJM 4, Franz EA 3, Robertson SP 4, Jasoni CL 1 Supplementary
More informationCHAPTER 9 DNA Technologies
CHAPTER 9 DNA Technologies Recombinant DNA Artificially created DNA that combines sequences that do not occur together in the nature Basis of much of the modern molecular biology Molecular cloning of genes
More informationNature Structural and Molecular Biology: doi: /nsmb.2937
Supplementary Figure 1 Multiple sequence alignment of the CtIP N-terminal domain, purified CtIP protein constructs and details of the 2F o F c electron density map of CtIP-NTD. (a) Multiple sequence alignment,
More informationTitle: Production and characterisation of monoclonal antibodies against RAI3 and its expression in human breast cancer
Author's response to reviews Title: Production and characterisation of monoclonal antibodies against RAI3 and its expression in human breast cancer Authors: Hannah Jörißen (hannah.joerissen@molbiotech.rwth-aachen.de)
More informationSupplementary information, Figure S1
Supplementary information, Figure S1 (A) Schematic diagram of the sgrna and hspcas9 expression cassettes in a single binary vector designed for Agrobacterium-mediated stable transformation of Arabidopsis
More informationLearning Objectives :
Learning Objectives : Understand the basic differences between genomic and cdna libraries Understand how genomic libraries are constructed Understand the purpose for having overlapping DNA fragments in
More informationRoche Molecular Biochemicals Technical Note No. LC 10/2000
Roche Molecular Biochemicals Technical Note No. LC 10/2000 LightCycler Overview of LightCycler Quantification Methods 1. General Introduction Introduction Content Definitions This Technical Note will introduce
More informationToll Receptor-Mediated Hippo Signaling Controls Innate Immunity in Drosophila
Cell Supplemental Information Toll Receptor-Mediated Hippo Signaling Controls Innate Immunity in Drosophila Bo Liu, Yonggang Zheng, Feng Yin, Jianzhong Yu, Neal Silverman, and Duojia Pan Supplemental Experimental
More informationSupplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons
Neuron, Volume 61 Supplemental Data LMO4 Controls the Balance between Excitatory and Inhibitory Spinal V2 Interneurons Kaumudi Joshi, Seunghee Lee, Bora Lee, Jae W. Lee, and Soo-Kyung Lee Supplemental
More information3. human genomics clone genes associated with genetic disorders. 4. many projects generate ordered clones that cover genome
Lectures 30 and 31 Genome analysis I. Genome analysis A. two general areas 1. structural 2. functional B. genome projects a status report 1. 1 st sequenced: several viral genomes 2. mitochondria and chloroplasts
More informationsicker; i.e. to test whether we can reverse the mutant phenotype of mec1-100 when the suppressor gene is ectopically over-expressed in mec1-100.
Internship Report ~FMI (Basel, Switzerland)~ Kyoto University Faculty of Medicine 1 st grade Yuiko Hirata This summer I went to the FMI (Friedrich Miescher Institute for Biomedical Research) in Basel.
More information2054, Chap. 14, page 1
2054, Chap. 14, page 1 I. Recombinant DNA technology (Chapter 14) A. recombinant DNA technology = collection of methods used to perform genetic engineering 1. genetic engineering = deliberate modification
More informationCassette denotes the ORFs expressed by the expression cassette targeted by the PCR primers used to
Stanyon, C.A., Limjindaporn, T., and Finley, Jr., R.L. Simultaneous transfer of open reading frames into several different expression vectors. Biotechniques, 35, 520-536, 2003. http://www.biotechniques.com
More informationCHAPTER 20 DNA TECHNOLOGY AND GENOMICS. Section A: DNA Cloning
Section A: DNA Cloning 1. DNA technology makes it possible to clone genes for basic research and commercial applications: an overview 2. Restriction enzymes are used to make recombinant DNA 3. Genes can
More informationBacterial DNA replication
Bacterial DNA replication Summary: What problems do these proteins solve? Tyr OH attacks PO4 and forms a covalent intermediate Structural changes in the protein open the gap by 20 Å! 1 Summary: What problems
More informationMIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr.
MIT Department of Biology 7.01: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. Claudette Gardel iv) Would Xba I be useful for cloning? Why or why not?
More informationTrueORF TM cdna Clones and PrecisionShuttle TM Vector System
TrueORF TM cdna Clones and PrecisionShuttle TM Vector System Application Guide Table of Contents Package Contents and Storage Conditions... 2 Related, Optional Reagents... 2 Related Products... 2 Available
More informationM Keramatipour 2. M Keramatipour 1. M Keramatipour 4. M Keramatipour 3. M Keramatipour 5. M Keramatipour
Molecular Cloning Methods Mohammad Keramatipour MD, PhD keramatipour@tums.ac.ir Outline DNA recombinant technology DNA cloning co Cell based PCR PCR-based Some application of DNA cloning Genomic libraries
More informationGenetics Lecture 21 Recombinant DNA
Genetics Lecture 21 Recombinant DNA Recombinant DNA In 1971, a paper published by Kathleen Danna and Daniel Nathans marked the beginning of the recombinant DNA era. The paper described the isolation of
More informationNature Neuroscience: doi: /nn Supplementary Figure 1
Supplementary Figure 1 PCR-genotyping of the three mouse models used in this study and controls for behavioral experiments after semi-chronic Pten inhibition. a-c. DNA from App/Psen1 (a), Pten tg (b) and
More informationLecture 25 (11/15/17)
Lecture 25 (11/15/17) Reading: Ch9; 328-332 Ch25; 990-995, 1005-1012 Problems: Ch9 (study-guide: applying); 1,2 Ch9 (study-guide: facts); 7,8 Ch25 (text); 1-3,5-7,9,10,13-15 Ch25 (study-guide: applying);
More informationThe Two-Hybrid System
Encyclopedic Reference of Genomics and Proteomics in Molecular Medicine The Two-Hybrid System Carolina Vollert & Peter Uetz Institut für Genetik Forschungszentrum Karlsruhe PO Box 3640 D-76021 Karlsruhe
More informationFunctional Genomics in Plants
Functional Genomics in Plants Jeffrey L Bennetzen, Purdue University, West Lafayette, Indiana, USA Functional genomics refers to a suite of genetic technologies that will contribute to a comprehensive
More informationCandidate region (0.74 Mb) ATC TCT GGG ACT CAT GAG CAG GAG GCT AGC ATC TCT GGG ACT CAT TAG CAG GAG GCT AGC
A idm-3 idm-3 B Physical distance (Mb) 4.6 4.86.6 8.4 C Chr.3 Recom. Rate (%) ATG 3.9.9.9 9.74 Candidate region (.74 Mb) n=4 TAA D idm-3 G3T(E4) G4A(W988) WT idm-3 ATC TCT GGG ACT CAT GAG CAG GAG GCT AGC
More informationA 5 P degradation hot spot influences molecular farming of anticancerogenic nuclease TBN1 in tobacco cells
Plant Cell, Tissue and Organ Culture (PCTOC) A 5 P degradation hot spot influences molecular farming of anticancerogenic nuclease TBN1 in tobacco cells Anna Týcová a,b, Rajen J. J. Piernikarczyk c, Michael
More informationHCT116 SW48 Nutlin: p53
Figure S HCT6 SW8 Nutlin: - + - + p GAPDH Figure S. Nutlin- treatment induces p protein. HCT6 and SW8 cells were left untreated or treated for 8 hr with Nutlin- ( µm) to up-regulate p. Whole cell lysates
More informationAP Biology. Chapter 20. Biotechnology: DNA Technology & Genomics. Biotechnology. The BIG Questions. Evolution & breeding of food plants
What do you notice about these phrases? radar racecar Madam I m Adam Able was I ere I saw Elba a man, a plan, a canal, Panama Was it a bar or a bat I saw? Chapter 20. Biotechnology: DNA Technology & enomics
More informationLecture 3 Mutagens and Mutagenesis. 1. Mutagens A. Physical and Chemical mutagens B. Transposons and retrotransposons C. T-DNA
Lecture 3 Mutagens and Mutagenesis 1. Mutagens A. Physical and Chemical mutagens B. Transposons and retrotransposons C. T-DNA 2. Mutagenesis A. Screen B. Selection C. Lethal mutations Read: 508-514 Figs:
More informationCertificate of Analysis
Certificate of Analysis pet6xhn Expression Vector Set Contents Product Information... 1 pet6xhn-n, pet6xhn-c, and pet6xhn-gfpuv Vector Information... 2 Location of Features... 4 Additional Information...
More informationIntroducing new DNA into the genome requires cloning the donor sequence, delivery of the cloned DNA into the cell, and integration into the genome.
Key Terms Chapter 32: Genetic Engineering Cloning describes propagation of a DNA sequence by incorporating it into a hybrid construct that can be replicated in a host cell. A cloning vector is a plasmid
More informationA CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish
Developmental Cell Supplemental Information A CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish Julien Ablain, Ellen M. Durand, Song Yang, Yi Zhou, and Leonard I. Zon % larvae
More informationRNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by. 5 AGACACAAACACCAUUGUCACACUCCACAGC; Rand-2 OMe,
Materials and methods Oligonucleotides and DNA constructs RNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by Dharmacon Inc. (Lafayette, CO). The sequences were: 122-2 OMe, 5
More informationTo isolate single GNS 144 cell clones, cells were plated at a density of 1cell/well
Supplemental Information: Supplemental Methods: Cell culture To isolate single GNS 144 cell clones, cells were plated at a density of 1cell/well in 96 well Primaria plates in GNS media and incubated at
More informationSupporting Information
Supporting Information Yuan et al. 10.1073/pnas.0906869106 Fig. S1. Heat map showing that Populus ICS is coregulated with orthologs of Arabidopsis genes involved in PhQ biosynthesis and PSI function, but
More informationSupplementary Fig. 1 related to Fig. 1 Clinical relevance of lncrna candidate
Supplementary Figure Legends Supplementary Fig. 1 related to Fig. 1 Clinical relevance of lncrna candidate BC041951 in gastric cancer. (A) The flow chart for selected candidate lncrnas in 660 up-regulated
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Dynamic Phosphorylation of HP1 Regulates Mitotic Progression in Human Cells Supplementary Figures Supplementary Figure 1. NDR1 interacts with HP1. (a) Immunoprecipitation using
More information2.5. Equipment and materials supplied by user PCR based template preparation Influence of temperature on in vitro EGFP synthesis 11
Manual 15 Reactions LEXSY in vitro Translation Cell-free protein expression kit based on Leishmania tarentolae for PCR-based template generation Cat. No. EGE-2010-15 FOR RESEARCH USE ONLY. NOT INTENDED
More informationTECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits
In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits Catalog Numbers APPA001 In Vitro Bacterial Split GFP "Fold 'n' Glow" Solubility Assay Kit (Green) APPA008 In Vitro Bacterial
More informationLecture Four. Molecular Approaches I: Nucleic Acids
Lecture Four. Molecular Approaches I: Nucleic Acids I. Recombinant DNA and Gene Cloning Recombinant DNA is DNA that has been created artificially. DNA from two or more sources is incorporated into a single
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/323/5910/124/dc1 Supporting Online Material for Regulation of Neuronal Survival Factor MEF2D by Chaperone-Mediated Autophagy Qian Yang, Hua She, Marla Gearing, Emanuela
More information240EQ222 - Genetic Engineering
Coordinating unit: Teaching unit: Academic year: Degree: ECTS credits: 2017 295 - EEBE - Barcelona East School of Engineering 713 - EQ - Department of Chemical Engineering MASTER'S DEGREE IN CHEMICAL ENGINEERING
More informationChapter 20: Biotechnology
Name Period The AP Biology exam has reached into this chapter for essay questions on a regular basis over the past 15 years. Student responses show that biotechnology is a difficult topic. This chapter
More informationThe microtubule-associated tau protein has intrinsic acetyltransferase activity. Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and
SUPPLEMENTARY INFORMATION: The microtubule-associated tau protein has intrinsic acetyltransferase activity Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and Virginia M.Y. Lee Cohen
More informationSupporting Information. SI Material and Methods
Supporting Information SI Material and Methods RNA extraction and qrt-pcr RNA extractions were done using the classical phenol-chloroform method. Total RNA samples were treated with Turbo DNA-free (Ambion)
More informationStabilization of a virus-like particle and its application as a nanoreactor at physiological conditions
Supporting Information Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Lise Schoonen, b Sjors Maassen, b Roeland J. M. Nolte b and Jan C. M. van
More informationTightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter
TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter L M Guzman et al. (1995) Journal of Bacteriology 177: 4121-4130 Outline 1. Introduction 2. Objective 3.
More informationFigure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of
Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of xylose, inducing expression of gfp-tola, localization
More informationViral RNAi suppressor reversibly binds sirna to. outcompete Dicer and RISC via multiple-turnover
Supplementary Data Viral RNAi suppressor reversibly binds sirna to outcompete Dicer and RISC via multiple-turnover Renata A. Rawlings 1,2, Vishalakshi Krishnan 2 and Nils G. Walter 2 * 1 Biophysics and
More informationGenetic Engineering & Recombinant DNA
Genetic Engineering & Recombinant DNA Chapter 10 Copyright The McGraw-Hill Companies, Inc) Permission required for reproduction or display. Applications of Genetic Engineering Basic science vs. Applied
More informationHeterologous protein expression systems
IMBB-FORTH Heterologous protein expression systems What are they? Protein expression systems producing desired polypeptides from recombinant genes. Plasmids carry and express the desired recombinant genes
More informationNEW! CHOgro Expression System
NEW! CHOgro Expression System At Mirus Bio, we know it s all about expression. Introducing the new CHOgro Expression System, a transient transfection platform that finally gets high protein titers with
More informationGenome research in eukaryotes
Functional Genomics Genome and EST sequencing can tell us how many POTENTIAL genes are present in the genome Proteomics can tell us about proteins and their interactions The goal of functional genomics
More informationR1 12 kb R1 4 kb R1. R1 10 kb R1 2 kb R1 4 kb R1
Bcor101 Sample questions Midterm 3 1. The maps of the sites for restriction enzyme EcoR1 (R1) in the wild type and mutated cystic fibrosis genes are shown below: Wild Type R1 12 kb R1 4 kb R1 _ _ CF probe
More informationMultiple choice questions (numbers in brackets indicate the number of correct answers)
1 Multiple choice questions (numbers in brackets indicate the number of correct answers) February 1, 2013 1. Ribose is found in Nucleic acids Proteins Lipids RNA DNA (2) 2. Most RNA in cells is transfer
More informationGM130 Is Required for Compartmental Organization of Dendritic Golgi Outposts
Current Biology, Volume 24 Supplemental Information GM130 Is Required for Compartmental Organization of Dendritic Golgi Outposts Wei Zhou, Jin Chang, Xin Wang, Masha G. Savelieff, Yinyin Zhao, Shanshan
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/324/5927/649/dc1 Supporting Online Material for Exchange of Genetic Material Between Cells in Plant Tissue Grafts Sandra Stegemann and Ralph Bock* *To whom correspondence
More information3 Designing Primers for Site-Directed Mutagenesis
3 Designing Primers for Site-Directed Mutagenesis 3.1 Learning Objectives During the next two labs you will learn the basics of site-directed mutagenesis: you will design primers for the mutants you designed
More informationAP Biology Gene Expression/Biotechnology REVIEW
AP Biology Gene Expression/Biotechnology REVIEW Multiple Choice Identify the choice that best completes the statement or answers the question. 1. Gene expression can be a. regulated before transcription.
More informationRamp1 EPD0843_4_B11. EUCOMM/KOMP-CSD Knockout-First Genotyping
EUCOMM/KOMP-CSD Knockout-First Genotyping Introduction The majority of animals produced from the EUCOMM/KOMP-CSD ES cell resource contain the Knockout-First-Reporter Tagged Insertion allele. As well as
More informationUsp14 EPD0582_2_G09. EUCOMM/KOMP-CSD Knockout-First Genotyping
EUCOMM/KOMP-CSD Knockout-First Genotyping Introduction The majority of animals produced from the EUCOMM/KOMP-CSD ES cell resource contain the Knockout-First-Reporter Tagged Insertion allele. As well as
More informationsirna Transfection Into Primary Neurons Using Fuse-It-siRNA
sirna Transfection Into Primary Neurons Using Fuse-It-siRNA This Application Note describes a protocol for sirna transfection into sensitive, primary cortical neurons using Fuse-It-siRNA. This innovative
More informationIntroduction to Protein Purification
Introduction to Protein Purification 1 Day 1) Introduction to Protein Purification. Input for Purification Protocol Development - Guidelines for Protein Purification Day 2) Sample Preparation before Chromatography
More informationSureSilencing sirna Array Technology Overview
SureSilencing sirna Array Technology Overview Pathway-Focused sirna-based RNA Interference Topics to be Covered Who is SuperArray? Brief Introduction to RNA Interference Challenges Facing RNA Interference
More informationSupplementary Information
Supplementary Information Deletion of the B-B and C-C regions of inverted terminal repeats reduces raav productivity but increases transgene expression Qingzhang Zhou 1, Wenhong Tian 2, Chunguo Liu 3,
More informationStrategies for Improving Soluble Protein Production in E. coli
Strategies for Improving Soluble Protein Production in E. coli Key Learning Objectives Overview of recombinant protein expression in E. coli Challenges in protein expression Solutions Clone quickly Reduce
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/1137999/dc1 Supporting Online Material for Disrupting the Pairing Between let-7 and Enhances Oncogenic Transformation Christine Mayr, Michael T. Hemann, David P. Bartel*
More informationSupplemental Fig. S1. Key to underlines: Key to amino acids:
AspA-F1 AspA 1 MKQMETKGYGYFRKTKAYGLVCGIT--------------LAGALTLGTTSVSADDVTTLNPATNLTTLQTPPTADQTQLAHQAGQQSGELVSEVSNTEWD 86 SspB 1 MQKREV--FG-FRKSKVAKTLCGAV-LGAALIAIADQQVLADEVTETNSTANVAVTTTGNPATNLPEAQGEATEAASQSQAQAGSKDGALPVEVSADDLN
More informationTargeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley
Targeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley Nagaveni Budhagatapalli a, Twan Rutten b, Maia Gurushidze a, Jochen Kumlehn a,
More informationThe OSU1/QUA2/TSD2-Encoded Putative Methyltransferase Is a Critical Modulator of Carbon and Nitrogen Nutrient Balance Response in Arabidopsis
The OSU1/QUA2/TSD2-Encoded Putative Methyltransferase Is a Critical Modulator of Carbon and Nitrogen Nutrient Balance Response in Arabidopsis Peng Gao 1., Zeyu Xin 1., Zhi-Liang Zheng 1,2 * 1 Department
More informationReverse Transcriptase Reverse Transcriptase 100 µl 5X RT Buffer 0.1 M DTT 500 µl Storage -20 C for 24 months
www.smobio.com Product Information Reverse Transcriptase ExcelRT series RP1000 20,000 units Reverse Transcriptase 100 µl 5X RT Buffer 1 ml 0.1 M DTT 500 µl Storage -20 C for 24 months Description The ExcelRT
More informationSYBR Green Realtime PCR Master Mix
Instruction manual SYBR Green Realtime PCR Master Mix 0810 F0924K SYBR Green Realtime PCR Master Mix QPK-201T 1 ml x 1 QPK-201 1 ml x 5 Contents [1] Introduction [2] Components [3] Primer design [4] Detection
More informationSupporting Information-Tables
Supporting Information-Tables Table S1. Bacterial strains and plasmids used in this work Bacterial strains Description Source of reference Streptococcus pneumoniae 1 Cp1015 non-capsulated and βl susceptible
More informationLecture 2-3: Using Mutants to study Biological processes
Lecture 2-3: Using Mutants to study Biological processes Objectives: 1. Why use mutants? 2. How are mutants isolated? 3. What important genetic analyses must be done immediately after a genetic screen
More informationmir-24-mediated down-regulation of H2AX suppresses DNA repair
Supplemental Online Material mir-24-mediated down-regulation of H2AX suppresses DNA repair in terminally differentiated blood cells Ashish Lal 1,4, Yunfeng Pan 2,4, Francisco Navarro 1,4, Derek M. Dykxhoorn
More informationHeme utilization in the Caenorhabditis elegans hypodermal cells is facilitated by hemeresponsive
Supplemental Data Heme utilization in the Caenorhabditis elegans hypodermal cells is facilitated by hemeresponsive gene-2 Caiyong Chen 1, Tamika K. Samuel 1, Michael Krause 2, Harry A. Dailey 3, and Iqbal
More informationSupplementary Information
Journal : Nature Biotechnology Supplementary Information Targeted genome engineering in human cells with RNA-guided endonucleases Seung Woo Cho, Sojung Kim, Jong Min Kim, and Jin-Soo Kim* National Creative
More informationYeast Two Hybrid Assay: A Fishing Tale
KEYWORDS: yeast two hybrid, molecular interactions, galactose metabolism Special section on techniques: Yeast Two Hybrid Assay: A Fishing Tale Solmaz Sobhanifar Pathology, University of British Columbia
More informationBENG 183 Trey Ideker. Genome Assembly and Physical Mapping
BENG 183 Trey Ideker Genome Assembly and Physical Mapping Reasons for sequencing Complete genome sequencing!!! Resequencing (Confirmatory) E.g., short regions containing single nucleotide polymorphisms
More informationSupplementary Figure 1. Isolation of GFPHigh cells.
Supplementary Figure 1. Isolation of GFP High cells. (A) Schematic diagram of cell isolation based on Wnt signaling activity. Colorectal cancer (CRC) cell lines were stably transduced with lentivirus encoding
More informationSUPPLEMENTAL MATERIAL SUPPLEMANTAL METHODS SUPPLEMENTAL RESULTS
SUPPLEMENTAL MATERIAL SUPPLEMANTAL METHODS hubb and hubb +1 constructs. To create the hubb construct, intermediate PCR products (named UBBwt-1 and UBBwt-2) were obtained using a pcdna3 vector containing
More informationSupplementary Information Design of small molecule-responsive micrornas based on structural requirements for Drosha processing
Supplementary Information Design of small molecule-responsive micrornas based on structural requirements for Drosha processing Chase L. Beisel, Yvonne Y. Chen, Stephanie J. Culler, Kevin G. Hoff, & Christina
More informationFigure S2. Response of mouse ES cells to GSK3 inhibition. Mentioned in discussion
Stem Cell Reports, Volume 1 Supplemental Information Robust Self-Renewal of Rat Embryonic Stem Cells Requires Fine-Tuning of Glycogen Synthase Kinase-3 Inhibition Yaoyao Chen, Kathryn Blair, and Austin
More informationSUPPLEMENTAL MATERIAL
SUPPLEMENTAL MATERIAL Materials and Methods Primers for ChIP/qPCR (Fig. 3): CG7939 (RpL32) Rp49+10F Rp49+110R Rp49+241F Rp49+341R Rp49+549F Rp49+613R TCTGGTTTCCGGCAAGGTATGT GCAGTTCAACTCGAAACCGCCAAA ATACTGCCCAAGAAGCTAGCCCAA
More informationmcherry Monoclonal Antibody (16D7) Catalog Number M11217 Product data sheet
Website: thermofisher.com Customer Service (US): 1 800 955 6288 ext. 1 Technical Support (US): 1 800 955 6288 ext. 441 mcherry Monoclonal Antibody (16D7) Catalog Number M11217 Product data sheet Details
More information