SUPPLEMENTARY INFORMATION

Size: px
Start display at page:

Download "SUPPLEMENTARY INFORMATION"

Transcription

1 DOI: 1.138/nc2274 EpH4 Prentl -/MDCK EpH4 Prentl -/MDCK - FERM- Figure S1 (kd) delferm- (1-438)- c Prentl MDCK -/MDCK deljfr- Input Control IP IP Input Control IP IP d Control Control Figure S1 () Specificity of ntiody nd endogenous expression of. Western lotting for or ws performed ginst cell homogentes from EpH4, MDCK nd -/MDCK cells. ntiody specificlly recognized endogenous protein in EpH4 cells nd exogenous - protein in -/MDCK cells. Endogenous expression ws hrdly detected in MDCK cells. () JFR of is necessry to recruit to the AJC. Deletion mutnts of were expressed in MDCK cells, nd these cells were immunostined for nd. Scle r, 5 μm. (c) does not ffect - interctions. ws immunoprecipitted from prentl or -/MDCK cells, nd the precipittes were immunolotted for or. (d) Depletion of or does not ffect the locliztion nd expression of the other. EpH4 cells were trnsfected with control, or RNA expression vector, together with. Cells were doule-immunostined for nd or. Scle r, 5 μm. 1

2 Figure S2 si si si si si PKCλ signl intensity (A.U.) * si si si DKD si PKCλ H2O Y si si H2O Y signl intensity (A.U.) H2O Y si H2O Y si si si 2P-MLC 2P-MLC 2P-MLC 2P-MLC 2P-MLC signl intensity (A.U.) H2O Y si H2O Y si Figure S2 () Upregultion of myosin IIB t AJCs in, or PKCλ knockdown cells. These molecules were depleted y sirna in EpH4 cells. Cells were immunostined for nd myosin IIB (). Scle r, 5 μm. Signl intensity of myosin IIB t AJCs in knocked down EpH4 cells is indicted in the grph, which ows representtive result of three independent experiments. Asterisks on rs indicte tht the men is significntly different from si control (men ± s.e.m, *p<.5, p<.1, Student s t-test, n>2 cells). () Inhiition of ROCK ctivity ttenutes DKDinduced upregultion of ctomyosin ctivity. nd were depleted y sirna in EpH4 cells. After the tretment with or without Y-27632, cells were immunostined for nd myosin IIB or 2P-MLC (pt18/ps19- MLC). Scle r, 5 μm. Signl intensity of myosin IIB or 2P-MLC t AJCs in knocked down EpH4 cells with or without Y tretment is indicted in the grph (men ± s.e.m, p<.1, Student s t-test, n>2 cells). 2

3 Prentl MDCK c Figure S3 si Cont-1 si Cont-2 si -1 si -2 si -/MDCK si PKCλ Signl intensity (A.U.) Prentl - d si si 2 Apicl re (µm 2 ) si si si si si Figure S3 ehves like. () Prentl MDCK nd -/ MDCK cells immunostined for nd. Scle r, 5 μm. Signl intensity of t AJCs is indicted in the grph (men ±s.e.m, p<.1, Student s t-test, n>2 cells). (), or oth of them were depleted y sirna in EpH4 cells. Cells were immunostined for nd. Locliztion of t AJCs indicted y rrows is mgnified t the right pnels. Scle r, 5 μm. (c) or ws depleted in EpH4 cells, nd these proteins were detected y doule immunostining. Ded lines indicte the orders etween norml nd KD cells. Scle r, 5 μm. Knockdown efficiency for is lso indicted y Western lotting. Knockdown of does not ffect, or protein level. (d) ws depleted in EpH4 cells. Cells were immunostined for, or myosin IIB. Ded lines indicte the orders etween norml nd KD cells. Scle r, 5 μm. Apicl re of ech cell ws mesured using -stined smples (men ± s.e.m, p<.1, Student s t-test, n>3 cells). 3

4 Control 1 Control 2 #27 # Control 1 MDCK #27 MDCK Control 1 MDCK #27 MDCK Apicl re (µm 2 ) 2,5 2, 1,5 1, 5 Control 1 #27 # P-MLC signl intensity (A.U.) Control 1 #27 c P-MLC signl intensity (A.U.) ** delbd - - deljfr - - Figure S4 Stle KD MDCK cells ow picl constriction nd upregultion of P-MLC. () MDCK cells stly expressing control or RNA were generted, nd their expression levels of were exmined y Western lotting. #27 or # indictes individul clone. Cells were immunostined for. Scle r, 5 μm. () Cells were immunostined for, or. The regions surrounded y ded squre re mgnified t right pnels. signls visile in the control cells re minly derived from stress fiers ut not from AJCs. Scle r, 5 μm. Apicl re of ech cell or signl intensity t AJCs is indicted in the grphs, ech of which ows representtive result of three independent experiments. Asterisks on rs indicte tht the men is significntly different from control 1 (men ± s.e.m, p<.1, Student s t-test, n>5 cells). (c) Signl intensity of 1P- MLC t AJCs in #27 MDCK cells expressing the indicted proteins. Grph ows representtive result of three independent experiments. Asterisks indicte tht the men is significntly different from control (men ± s.e.m, **p<.1, p<.1, Student s t-test, n>2 cells). 4

5 GAP- /EpH4 si si GAP-PKCι- /EpH4 si si JAMA- /EpH4 si si JAMA-PKCι- /EpH4 si si Figure S5 Junctionl locliztion of is sufficient to inhiit the upregultion of P-MLC induced y DKD of nd. nd were depleted in stle EpH4 trnsfectnts expressing GAP-, GAP-PKCι-, JAMA- or JAMA-PKCι-. Cells were immunostined for, nd. Scle r, 5 μm. 5

6 endogenous S417,T124,S1163,T1189,S1281,S13,T14, T17,S1341 MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNK NIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRK VYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLY MVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVK PDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQG GDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRD TVAPVVPDLSSDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYY SNRRYLPSANASENRSSSNVDKSLQESLQKTIYKLEEQLHNEMQLKDEME QKCRTSNLKLDKIMKELDEEGNQRRNLESAVSQIEKEKMLLQHRINEYQR KVEQENEKRRNIENEVSTLKDQLEDLRKASQTSQLANEKLTQLQKQLEEA NDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQAD KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEG ERKEAQDMLNHSEKEKNNLEIDLNYKLKSIQQRLEQEVNEHKVTKARLTD KHQSIEEAKSVAMCEMEKKLKEEREAREKAENRVVETEKQCSMLDVDLKQ SQQKLEHLTENKERMEDEVKNLALQLEQESNKRLLLQNELKTQAFEADNL KGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMRELQDQLEAEQ YFSTLYKTQVKELKEEIEEKNRENLRKIQELQSEKETLSTQLDLAETKAE SEQLARGILEEQYFELTQESKKAASRNRQEITDKDHTVSRLEETNSVLTK DIEMLRKENEELNERMRTAEEEYKLKKEEEINNLKAAFEKNISTERTLKT QAVNKLAEIMNRKDFKIDRKKANTQDLRKKEKENRKLQLELNQEREKFNQ MVVKHQKELNDMQAQLVEECTHRNELQMQLASKESDIEQLRAKLLDLSDS TSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKKQYVVVSSKKI LFYNDEQDKEQSSPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY ANEGECRKDIEVEPVQQGEKTNFQNHKGHEFIPTLYHFPANCEACAKPLW HVFKPPPALECRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLAC SQDEQKKWVTHLVKKIPKNPPSGFVRASPRTLSTRSTANQSFRKVVKNTS GKTS in vitro kinse ssy T219,S679,T997,T1,T124,S1291,S131,S1322, S13,T14,T17,S1341 MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNK NIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRK VYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLY MVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVK PDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQG GDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRD TVAPVVPDLSSDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYY SNRRYLPSANASENRSSSNVDKSLQESLQKTIYKLEEQLHNEMQLKDEME QKCRTSNLKLDKIMKELDEEGNQRRNLESAVSQIEKEKMLLQHRINEYQR KVEQENEKRRNIENEVSTLKDQLEDLRKASQTSQLANEKLTQLQKQLEEA NDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQAD KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEG ERKEAQDMLNHSEKEKNNLEIDLNYKLKSIQQRLEQEVNEHKVTKARLTD KHQSIEEAKSVAMCEMEKKLKEEREAREKAENRVVETEKQCSMLDVDLKQ SQQKLEHLTENKERMEDEVKNLALQLEQESNKRLLLQNELKTQAFEADNL KGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMRELQDQLEAEQ YFSTLYKTQVKELKEEIEEKNRENLRKIQELQSEKETLSTQLDLAETKAE SEQLARGILEEQYFELTQESKKAASRNRQEITDKDHTVSRLEETNSVLTK DIEMLRKENEELNERMRTAEEEYKLKKEEEINNLKAAFEKNISTERTLKT QAVNKLAEIMNRKDFKIDRKKANTQDLRKKEKENRKLQLELNQEREKFNQ MVVKHQKELNDMQAQLVEECTHRNELQMQLASKESDIEQLRAKLLDLSDS TSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKKQYVVVSSKKI LFYNDEQDKEQSSPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY ANEGECRKDIEVEPVQQGEKTNFQNHKGHEFIPTLYHFPANCEACAKPLW HVFKPPPALECRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLAC SQDEQKKWVTHLVKKIPKNPPSGFVRASPRTLSTRSTANQSFRKVVKNTS GKTS coverge(~6%) Figure S6 Determintion of phosphoryltion sites y LC-MS/MS. All phosphoryltion sites identified y endogenous immunoprecipittion nd in vitro kinse ssy re indicted on top. The full-length mino cid sequence of is own, nd the sequences covered y LC-MS/MS re indicted in red letters. Phosphoryltion sites commonly identified in oth ssys re underlined in lue. 6

7 MDCK cells Control 1 Control 2 ROCKs #11 ROCKs #15, ROCK2 ROCKs, c Y (-) Y () si control #1 si control #2 si PKCλ #1 si PKCλ #2 si control #1 si control #2 si PKCλ #1 si PKCλ #2 GST-MLC (~47 kd) GST (GST-MLC) CBB (IP) d incution time 1' 5' 15' Y GST rec.pkcι e GST (GST-MLC) (IP) WT 4A 4E 5A 5E GST (GST-MLC) - (IP) (IP) f g Pull down GST GTPγS-GST-RhoA Input µg GST-RhoA (~ kd) - WT CBB IB: Input WT 4A 4E 5A 5E GTPγS-GST-RhoA-pull down (2µg) WT 4A 4E 5A 5E - IB: Figure S7 () or ROCKs knockdown in MDCK cells. RNA expression vector for or ROCKs were co-trnsfected with expression vector. Cells were immunostined for nd. Scle r, 5 μm. MDCK cells stly expressing control or ROCKs RNA were generted, nd their expressions of nd ROCK2 were exmined y Western lotting. #11 or #15 indictes individul clone. (-g) Phosphoryltion of y does not ffect the kinse ctivity of or Rho- interctions. () GST- MLC ws prepred from E. coli, nd stined with CBB. (c) Immunoprecipitted fter PKCλ knockdown ws used to perform immune complex kinse ssy ginst GST-MLC with or without Y Kinse ctivity ws estimted y Western lotting for. (d) Immunoprecipitted ws incuted with GST (control) or recominnt (rec.) PKCι for phosphoryltion. After GST or rec. PKCι ws wed out, immunoprecipitted ws used to perform immune complex kinse ssy ginst GST-MLC with or without Y for indicted times. Kinse ctivity ws estimted y Western lotting for. (e), wild type, unphosphoryltle or phosphomimetic mutnts of - ws expressed in HEK293 cells nd immunoprecipitted with ntiody. Immunoprecipitted proteins were used to perform immune complex kinse ssy ginst GST-MLC. Kinse ctivity ws estimted y Western lotting for. (f) GST-RhoA ws prepred from E. coli, nd stined with CBB. (g) Wild type - ws expressed in HEK293 cells, nd pull-down ssy ws performed with different mounts of GTPγS-GST-RhoA or GST to determine the unsturted concentrtion of GTPγS-GST-RhoA, which cn ind -., wild type, unphosphoryltle or phosphomimetic mutnts of - were expressed in HEK293 cells, nd pulled down with 2 μg of GTPγS-GST-RhoA. 7

8 -C3 ( #27 MDCK) Figure S8 Rho ctivity is required for the mintennce of AJCs. or -C3 (C3, otulinum C3 toxin; n inhiitor of Rho ctivity) ws expressed in #27 MDCK cells. Cells were immunostined for nd. signls re missing in the cells expressing -C3. Scle r, 5 μm. 8

9 Fig. 1 Fig. 1 Fig. 2 Fig. 1d Fig. 3 Fig. 3d Fig. 4 Fig. 4 Fig. 4e Fig. 5c Fig. S1 Fig. S3 Fig. S7c Fig. S12 Flg Fig. S12c GST Fig. S8 Fig. S12d GAPDH N-cdherin GST Fig. S11 Fig. S12f - () ROCK2 GST Figure S9 Full scns of Western lots presented. The red oxes indicte the res used in the figures. 9

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION NCS (ng/ml) Time (min) kd 500 500 0 30 0 30 IP: IP: 112 105 75 IB: ps407 IB: Mdm2 NCS + + IB: IB: tuulin IP input sup NCS (ng/ml) 50 100 500 Time (min) 0 15 30 60 120 15 30 60 120 15 30 60 120 IB: ps407

More information

Auxin regulates SCF TIR1 -dependent degradation of AUX/IAA proteins

Auxin regulates SCF TIR1 -dependent degradation of AUX/IAA proteins Auxin regultes SCF TIR1 -dependent degrdtion of AUX/IAA proteins rticles Willim M. Gry², Stefn Kepinski²³, Den Rouse³, Ottoline Leyser³ & Mrk Estelle The Institute for Cellulr nd Moleculr Biology, The

More information

Calpain-mediated proteolysis of talin regulates adhesion dynamics

Calpain-mediated proteolysis of talin regulates adhesion dynamics Clpin-medited proteolysis of tlin regultes dhesion dynmics Sntos J. Frnco 1,Mry A. Rodgers 2,Benjmin J. Perrin 1,Jewon Hn 3,Dvid A. Bennin 2,Dvid R. Critchley 4 nd Ann Huttenlocher 2,5 Dynmic regultion

More information

Supplementary Fig

Supplementary Fig Supplementry Fig. 1 * 180-115- 82-64- 49-37- * 180-115- 85-64- 49-37- 26-26- Mem Cyt Mem Cyt Supplementry Fig.1 Specificity of nti-tie2 ntiodies. HUVECs were homogenized nd centrifuged t 400 000g to otin

More information

AKAP12 Mediates PKA-Induced Phosphorylation of ATR to Enhance Nucleotide Excision Repair

AKAP12 Mediates PKA-Induced Phosphorylation of ATR to Enhance Nucleotide Excision Repair University of Kentucky UKnowledge Mrkey ncer enter Fculty Publictions ncer 12-15-216 Medites PKA-Induced Phosphoryltion of ATR to Enhnce Nucleotide Excision Repir Sturt G. Jrrett University of Kentucky,

More information

Re-examination of sirna specificity questions role of PICH and Tao1 in the spindle checkpoint and identifies Mad2 as a sensitive target for small RNAs

Re-examination of sirna specificity questions role of PICH and Tao1 in the spindle checkpoint and identifies Mad2 as a sensitive target for small RNAs Chromosom (2) 9:49 65 DOI.7/s42-9-244-2 RESEARCH ARTICLE Re-exmintion of sirna specificity questions role of PICH nd To in the spindle checkpoint nd identifies Md2 s sensitive trget for smll RNAs Ndj C.

More information

D ocking and fusion of synaptic vesicles at release sites

D ocking and fusion of synaptic vesicles at release sites Phosphoryltion of y PKA modultes its interction with the SNARE complex rticles Miln G. Chhed*, Uri Ashery, Prtim Thkur, Jens Rettig nd Zu-Hng Sheng* *Synptic Function Unit, Ntionl Institute of Neurologicl

More information

Supplementary Materials

Supplementary Materials Supplementry Mterils Supplementry Figure 1 Supplementry Figure 2 in Fh deficient mice. Supplementry Figure 3 Supplementry Figure 4 Supplementry Figure 5 Supplementry Figure 6 Supplementry Figure 7 Supplementry

More information

TrkB phosphorylation by Cdk5 is required for activitydependent structural plasticity and spatial memory

TrkB phosphorylation by Cdk5 is required for activitydependent structural plasticity and spatial memory phosphoryltion y Cdk5 is required for ctivitydependent structurl plsticity nd sptil memory Kwok-On Li 13, Aln S L Wong 13, Mn-Chun Cheung 13, Pei Xu 13, Zhuoyi Ling 13, K-Chun Lok 13, Hui Xie 4, Mry E

More information

Osteopontin enhances multi-walled carbon nanotube-triggered lung fibrosis by promoting TGF-β1 activation and myofibroblast differentiation

Osteopontin enhances multi-walled carbon nanotube-triggered lung fibrosis by promoting TGF-β1 activation and myofibroblast differentiation Dong nd M Prticle nd Fire Toxicology (2017) 14:18 DOI 10.1186/s12989-017-0198-0 RESEARCH Open Access Osteopontin enhnces multi-wlled cron nnotue-triggered lung firosis y promoting TGF-β1 ctivtion nd myofirolst

More information

Figure 1: TDP-43 is subject to lysine acetylation within the RNA-binding domain a) QBI-293 cells were transfected with TDP-43 in the presence or

Figure 1: TDP-43 is subject to lysine acetylation within the RNA-binding domain a) QBI-293 cells were transfected with TDP-43 in the presence or Figure 1: TDP-43 is subject to lysine acetylation within the RNA-binding domain a) QBI-293 cells were transfected with TDP-43 in the presence or absence of the acetyltransferase CBP and acetylated TDP-43

More information

T H cell differentiation is accompanied by dynamic changes in histone acetylation of cytokine genes

T H cell differentiation is accompanied by dynamic changes in histone acetylation of cytokine genes H cell differentition is ccompnied y dynmic chnges in histone cetyltion of cytokine genes Orly Avni 1, Dong Lee 1,Fernndo Mcin 1, Susnne J. Szo 2, Lurie H. Glimcher 2 nd Anjn Ro 1 Pulished online: 10 June

More information

DNAPKcs-dependent arrest of RNA polymerase II transcription in the presence of DNA breaks

DNAPKcs-dependent arrest of RNA polymerase II transcription in the presence of DNA breaks DNAPKcs-dependent rrest of RNA polymerse II trnscription in the presence of DNA reks Tior Pnkoti, Céline Bonhomme, Dvid Chen & Evi Soutoglou npg Nture Americ, Inc. All rights reserved. DNA doule-strnd

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION Dynamic Phosphorylation of HP1 Regulates Mitotic Progression in Human Cells Supplementary Figures Supplementary Figure 1. NDR1 interacts with HP1. (a) Immunoprecipitation using

More information

GFP CCD2 GFP IP:GFP

GFP CCD2 GFP IP:GFP D1 D2 1 75 95 148 178 492 GFP CCD1 CCD2 CCD2 GFP D1 D2 GFP D1 D2 Beclin 1 IB:GFP IP:GFP Supplementary Figure 1: Mapping domains required for binding to HEK293T cells are transfected with EGFP-tagged mutant

More information

Mutant protein in Huntington disease is resistant to proteolysis in affected brain

Mutant protein in Huntington disease is resistant to proteolysis in affected brain Mutnt protein in Huntington disese is resistnt to proteolysis in ffected rin Roy B. Dyer 1 & Cynthi T. McMurry 1 3 Pulished online: 15 Octoer 2001, DOI: 10.1038/ng745 The cuse of Huntington disese pthophysiology

More information

Parkin ubiquitinates the α-synuclein interacting protein, synphilin-1: implications for Lewy-body formation in Parkinson disease

Parkin ubiquitinates the α-synuclein interacting protein, synphilin-1: implications for Lewy-body formation in Parkinson disease Prkin uiquitintes the αsynuclein intercting protein, synphilin1: implictions for Lewyody formtion in Prkinson disese KENNY K.K. CHUNG 1, YI ZHANG 2, KAH LEONG LIM 1, YUJI TANAKA 4, HUI HUANG 1, JUN GAO

More information

I n eukaryotes, chromosomes replicate from many origins that are

I n eukaryotes, chromosomes replicate from many origins that are Temporlly coordinted ssemly nd disssemly of repliction fctories in the sence of DNA synthesis Dniel S. Dimitrov* nd Dvid M. Gilert* *Deprtment of Biochemistry nd Moleculr Biology, Stte University of New

More information

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table.

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of

More information

Centrosome number is controlled by a centrosomeintrinsic block to reduplication

Centrosome number is controlled by a centrosomeintrinsic block to reduplication Centrosome numer is controlled y centrosomeintrinsic lock to redupliction Connie Wong 1 nd Tim Sterns 1,2 The centrosome duplictes once in S phse. To determine whether there is lock in centrosome redupliction,

More information

Synapsis, Strand Scission, and Strand Exchange Induced by the

Synapsis, Strand Scission, and Strand Exchange Induced by the MOLECULAR AND CELLULAR BIOLOGY, Sept. 1991, p. 4497-4508 0270-7306/91/094497-12$02.00/0 Copyright C) 1991, Americn Society for Microiology Vol. 11, No. 9 Synpsis, Strnd Scission, nd Strnd Exchnge Induced

More information

Modulation of glutamine metabolism by the PI(3)K PKB FOXO network regulates autophagy

Modulation of glutamine metabolism by the PI(3)K PKB FOXO network regulates autophagy A R T I C L E S Modultion of glutmine metbolism by the PI(3)K PKB FOXO network regultes utophgy Kristn E. vn der Vos 1,7, Pernill Elisson,8, Tssul Proiks-Ceznne 3,8, Stephin J. Vervoort,6, Ruben vn Boxtel,

More information

ARTICLES. Cyclin-dependent kinase 2 is essential for meiosis but not for mitotic cell division in mice

ARTICLES. Cyclin-dependent kinase 2 is essential for meiosis but not for mitotic cell division in mice Cyclin-dependent kinse 2 is essentil for meiosis ut not for mitotic cell division in mice Sgrrio Orteg 1, Igncio Prieto 2, Junko Odjim 1, Alerto Mrtín 1, Pierre Duus 3, Rocio Sotillo 1, Jose Luis Brero

More information

Soybean Fungicide and Insecticide Seed Treatments (2006 Final Report)

Soybean Fungicide and Insecticide Seed Treatments (2006 Final Report) Soyen Fungicide nd Iecticide Seed Tretments (2006 Finl Report) Purpose: The ojective of this study ws to investigte new iecticide seed tretments for soye. Cruiser ws registered recently nd Gucho hs yet

More information

1,500 1,000. LPS + alum. * * Casp1 p10. Casp1 p45

1,500 1,000. LPS + alum. * * Casp1 p10. Casp1 p45 a NLRP3 Non-stimulation R46 BAY SI TAT LPS R46 BAY SI TAT 1,5 1, c 15 1 5 5 Pro-IL-18 Pro-IL-1 LPS + alum d e f IL-1 p17 Pro-IL-1 1 75 5 5 Casp1 p1 NLRP3 LPS + alum Supplementary Figure 1 Inhiition of

More information

The winged-helix transcription factor Trident is expressed in cycling cells

The winged-helix transcription factor Trident is expressed in cycling cells 1997 Oxford University Press Nucleic Acids Reserch, 1997, Vol. 25, No. 9 1715 1719 The winged-helix trnscription fctor Trident is expressed in cycling cells Wouter Korver*, Jeroen Roose nd Hns Clevers

More information

Induction of a b-catenin-lef-1 complex by wnt-1 and transforming mutants of b-catenin

Induction of a b-catenin-lef-1 complex by wnt-1 and transforming mutants of b-catenin Oncogene (1997) 15, 2833 ± 2839 1997 Stockton Press All rights reserved 0950 ± 9232/97 $12.00 Induction of -ctenin-lef-1 complex y wnt-1 nd trnsforming mutnts of -ctenin Emilio Por ri 1, Bonnee Ruinfeld

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nture10924 no tg Lsm1-my Lsm2-my Lsm5-my Lsm6-my Lsm7-my Lsm8-my no tg Lsm1-my Lsm2-my Lsm5-my Lsm6-my Lsm7-my Lsm8-my kd 220 120 100 80 60 50 40 30 20 SeeBlue Mrker Mgi Mrk no tg Sm1-my Smd3-my

More information

Biologic sequelae of c-jun NH 2 -terminal kinase (JNK) activation in multiple myeloma cell lines

Biologic sequelae of c-jun NH 2 -terminal kinase (JNK) activation in multiple myeloma cell lines (23) 22, 8797 88 & 23 Nture Pulishing Group All rights reserved 95-9232/3 $25. www.nture.com/onc SHORT REPORT Biologic sequele of c-jun NH 2 -terminl kinse (JNK) ctivtion in multiple myelom cell lines

More information

Short hairpin RNA (shrna) against MMP14. Lentiviral plasmids containing shrna

Short hairpin RNA (shrna) against MMP14. Lentiviral plasmids containing shrna Supplemental Materials and Methods Short hairpin RNA (shrna) against MMP14. Lentiviral plasmids containing shrna (Mission shrna, Sigma) against mouse MMP14 were transfected into HEK293 cells using FuGene6

More information

A TGF-b1-Dependent Autocrine Loop Regulates the Structure of Focal Adhesions in Hypertrophic Scar Fibroblasts

A TGF-b1-Dependent Autocrine Loop Regulates the Structure of Focal Adhesions in Hypertrophic Scar Fibroblasts ORIGINAL ARTICLE A TGF-1-Dependent Autocrine Loop Regultes the Structure of Focl Adhesions in Hypertrophic Scr Firolsts Gnry Diri 1, Anelis Cmpner 2, Jeffrey R. Morgn 2 nd Livingston Vn De Wter 1 Following

More information

Inversin, the gene product mutated in nephronophthisis type II, functions as a molecular switch between Wnt signaling pathways

Inversin, the gene product mutated in nephronophthisis type II, functions as a molecular switch between Wnt signaling pathways ersin, the gene product mutted in nephronophthisis type II, functions s moleculr switch etween Wnt signling pthwys Mtis Simons 1,6, Jochim Gloy 1,6, Athin Gnner 1, Axel Bullerkotte 1, Mikhil Bshkurov 1,

More information

Foxo1 directly regulates the transcription of recombination-activating genes during B cell development

Foxo1 directly regulates the transcription of recombination-activating genes during B cell development 8 Nture Pulishing Group http://www.nture.com/ntureimmunology directly regultes the trnscription of recomintion-ctivting genes during B cell development Rupesh H Amin & Mrk S Schlissel Regulted expression

More information

EVALUATION OF INSECTICIDES ON NON-TRANSGENIC AND TRANSGENIC B.t. COTTON CULTIVARS FOR IMPACT ON TOBACCO BUDWORM, APHIDS AND SPIDER MITES

EVALUATION OF INSECTICIDES ON NON-TRANSGENIC AND TRANSGENIC B.t. COTTON CULTIVARS FOR IMPACT ON TOBACCO BUDWORM, APHIDS AND SPIDER MITES EVALUATION OF INSECTICIDES ON NON-TRANSGENIC AND TRANSGENIC B.t. COTTON CULTIVARS FOR IMPACT ON TOBACCO BUDWORM, APHIDS AND SPIDER MITES Texs Agriculturl Experiment Sttion, Nueces County, 2000 Roy D. Prker

More information

Conservation Tillage Strategies For Corn, Sorghum And Cotton

Conservation Tillage Strategies For Corn, Sorghum And Cotton (93%) cotton nd percent lint ws similr in oth pickers. The 15-inch row system with 27 plnts/a gve higher lint yield (1491 l/a) compred to 4-inch row cotton with 5 plnts/a (136 l/a). Plnt cnopy closed 3

More information

Specific Inhibition of Spleen Tyrosine Kinase Suppresses Leukocyte Immune Function and Inflammation in Animal Models of Rheumatoid Arthritis S

Specific Inhibition of Spleen Tyrosine Kinase Suppresses Leukocyte Immune Function and Inflammation in Animal Models of Rheumatoid Arthritis S Supplementl mteril to this rticle cn e found t: http://jpet.spetjournls.org/content/suppl/211/11/1/jpet.111.188441.dc1 1521-13/12/342-35 359$25. THE JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS

More information

Activation of Dual Apoptotic Pathways in Human Melanocytes and Protection by Survivin

Activation of Dual Apoptotic Pathways in Human Melanocytes and Protection by Survivin ORIGINAL ARTICLE Activtion of Dul Apoptotic Pthwys in Humn Melnocytes nd Protection y Survivin Tong Liu 1, Din Biddle 1, Adrinne N. Hnks 1, Brook Brouh 2, Hui Yn 1, Ry M. Lee 1,3,4, Sncy A. Lechmn 1,2

More information

Repair of Rhodopsin mrna by Spliceosome- Mediated RNA Trans-Splicing: A New Approach for Autosomal Dominant Retinitis Pigmentosa

Repair of Rhodopsin mrna by Spliceosome- Mediated RNA Trans-Splicing: A New Approach for Autosomal Dominant Retinitis Pigmentosa originl rticle The Americn Society of Gene & Cell Therpy MT Open Repir of Rhodopsin mrna y Spliceosome- Medited RNA Trns-Splicing: A New Approch for Autosoml Dominnt Retinitis Pigmentos Adeline Berger

More information

recessive lozenge-shaped-fly-eye "alleles" in trans: recessive lozenge-shaped-fly-eye "alleles" in trans:

recessive lozenge-shaped-fly-eye alleles in trans: recessive lozenge-shaped-fly-eye alleles in trans: Wht do we men (wht hve we ment) y " gene": Reding for lectures 15-17 (We F27, Fr F29, We M5) Chp 8: from 258 (Nonoverlpping...) to 261 ( Crcking) & from 285 (8.6) to 293 (end of "essentil concepts) Chp

More information

phenylalanine alanine

phenylalanine alanine END F UNIT TET ENGINEERING PRTEIN TET 60 mrks (1 hour) A copy of the EP Informtion heet is required for this test, together with the spectroscopic dt (n.m.r.) from Tble 23 in the Dt heets. 1 nylketonuri

More information

Directing human embryonic stem cell differentiation towards a renal lineage generates a self-organizing kidney

Directing human embryonic stem cell differentiation towards a renal lineage generates a self-organizing kidney L E T T E R Directing humn emryonic stem cell differentition towrds renl linege genertes self-orgnizing kidney M. Tksto 1, P. X. Er 1, M. Becroft 1, J. M. Vnslmrouck 1, E. G. Stnley 2,3, A. G. Elefnty

More information

B y sequence comparison to Chordin we noticed that CTGF. Connective-tissue growth factor (CTGF) modulates cell signalling by BMP and TGF-β

B y sequence comparison to Chordin we noticed that CTGF. Connective-tissue growth factor (CTGF) modulates cell signalling by BMP and TGF-β Connective-tissue growth fctor () modultes cell signlling y BMP nd TGF-β José G. Areu*, Nn I. Ketpur, Bruno Reversde nd E. M. De Roertis Howrd Hughes Medicl Institute nd Deprtment of Biologicl Chemistry,

More information

Dynamics and segregation of cell matrix adhesions in cultured fibroblasts

Dynamics and segregation of cell matrix adhesions in cultured fibroblasts Dynmics nd segregtion of cell mtrix dhesions in cultured fibroblsts Eli Zmir*, Menchem Ktz*, Yehudit Posen*, Nom Erez*, Kenneth M. Ymd, Ben-Zion Ktz, Shin Lin, Dine C. Lin, Alexnder Bershdsky*, Zvi Km*

More information

Disrupted-in-Schizophrenia 1 (DISC1) regulates spines of the glutamate synapse via Rac1

Disrupted-in-Schizophrenia 1 (DISC1) regulates spines of the glutamate synapse via Rac1 r t i c l e s Disrupted-in-Schizophreni 1 () regultes spines of the glutmte synpse vi Rc1 Akiko Hyshi-Tkgi 1, Mnu Tkki 1, Nick Grzine 2, Surv Seshdri 1, Hnnh Murdoch 3, Alln J Dunlop 3, Yuichi Mkino 4,

More information

A cell-intrinsic role for TLR2 MYD88 in intestinal and breast epithelia and oncogenesis

A cell-intrinsic role for TLR2 MYD88 in intestinal and breast epithelia and oncogenesis A cell-intrinsic role for TLR2 MYD88 in intestinl nd rest epitheli nd oncogenesis Ferenc A. Scheeren 1,2,8, Anger H. Kuo 1,8, Lind J. vn Weele 1, Shng Ci 1, Iris Glykofridis 2, Shheen S. Sikndr 1, Mider

More information

WP1. Agricultural biomass quality. Poul Erik Lærke, Na Liu & Uffe Jørgensen, Dept. of Agroecology

WP1. Agricultural biomass quality. Poul Erik Lærke, Na Liu & Uffe Jørgensen, Dept. of Agroecology WP1. Agriculturl iomss qulity Poul Erik Lærke, N Liu & Uffe Jørgensen, Dept. of Agroecology Influencing fctors Genotype Hrvest time Storge Soil type nd climte Anlyses Work content Yield nd qulity of dedicted

More information

Genetic capsid modifications allow efficient re-targeting of adeno-associated virus type 2

Genetic capsid modifications allow efficient re-targeting of adeno-associated virus type 2 Genetic cpsid modifictions llow efficient re-trgeting of deno-ssocited virus type 2 ANNE GIROD 1, MARTIN RIED 1, CHRISTIANE WOBUS 2, HARALD LAHM 1, KRISTIN LEIKE 1, JÜRGEN KLEINSCHMIDT 2, GILBERT DELÉAGE

More information

Nonlinear Mixed Effects Model for Swine Growth

Nonlinear Mixed Effects Model for Swine Growth Nonliner Mixed Effects Model for Swine Growth A. P. Schinckel nd B. A. Crig Deprtment of Animl Sciences nd Deprtment of Sttistics, Purdue University Introduction Severl nonliner growth functions model

More information

A tethered catalysis, two-hybrid system to identify protein-protein interactions requiring post-translational modifications

A tethered catalysis, two-hybrid system to identify protein-protein interactions requiring post-translational modifications A tethered ctlysis, two-hyrid system to identify protein-protein interctions requiring post-trnsltionl modifictions Dwei Guo 1,4,Tony R Hzun 2,4,Xin-Jing Xu 1,Sze-Ling Ng 1, Stnley Fields 2,& Min-Ho Kuo

More information

Macmillan Publishers Limited. All rights reserved

Macmillan Publishers Limited. All rights reserved Vol 466 26 August 21 doi:1.138/nture933 LETTERS Role of Tet proteins in 5mC to 5hmC conversion, ES-cell self-renewl nd inner cell mss specifiction Shinsuke Ito 1,2, An C. D Alessio 1,2, Olen V. Trnov 1,2,

More information

PML regulates p53 stability by sequestering Mdm2 to the nucleolus

PML regulates p53 stability by sequestering Mdm2 to the nucleolus regultes stility y sequestering to the nuleolus Ros Bernrdi 1,Pier Polo Sglioni 1,3,Stephn Bergmnn 1,3,Henning F. Horn 2,Kren H. Vousden 2 nd Pier Polo Pndolfi 1,4 The promyeloyti leukemi () tumour-suppressor

More information

The trans-snare-regulating function of Munc18-1 is essential to synaptic exocytosis

The trans-snare-regulating function of Munc18-1 is essential to synaptic exocytosis Received 2 Dec 214 Accepted 9 Oct 215 Pulished 17 Nov 215 DOI: 1.138/ncomms9852 The trns-snare-regulting function of Munc18-1 is essentil to synptic exocytosis Chong Shen 1, *, Shilendr S. Rthore 1, *,

More information

Chapter 9. Mapping and characterizing whole genomes. Structural Genomics Functional genomics

Chapter 9. Mapping and characterizing whole genomes. Structural Genomics Functional genomics Chpter 9 Mpping nd chrcterizing whole genomes Structurl Genomics Functionl genomics How mny genes hs humn? 5,500 27,000 Interprettion of genomic informtion: high throughput technologies re used to get

More information

p53-cofactor JMY is a multifunctional actin nucleation factor

p53-cofactor JMY is a multifunctional actin nucleation factor letters p53-cofctor is multifunctionl nucletion fctor J. Brdley Zuchero, Amnd S. Coutts 2, Mrgot E. Quinln 3, Nichols B. L Thngue 2 nd R. Dyche Mullins,4 Mny cellulr structures re ssemled from networks

More information

Nanoparticle-mediated Gene Silencing Confers Radioprotection to Salivary Glands In Vivo

Nanoparticle-mediated Gene Silencing Confers Radioprotection to Salivary Glands In Vivo originl rticle Nnoprticle-medited Gene Silencing Confers Rdioprotection to Slivry Glnds In Vivo Szilvi Arny 1, Dnielle SW Benoit 2, Stephen Dewhurst 3 nd Ctherine E Ovitt 1 1 Center for Orl Biology, University

More information

Coleman et al., Supplementary Figure 1

Coleman et al., Supplementary Figure 1 Coleman et al., Supplementary Figure 1 BrdU Merge G1 Early S Mid S Supplementary Figure 1. Sequential destruction of CRL4 Cdt2 targets during the G1/S transition. HCT116 cells were synchronized by sequential

More information

Report to the Southwest Florida Water Management District. Effects of Microsprinkler Irrigation Coverage on Citrus Performance

Report to the Southwest Florida Water Management District. Effects of Microsprinkler Irrigation Coverage on Citrus Performance Report to the Southwest Florid Wter Mngement District Effects of Microsprinkler Irrigtion Coverge on Citrus Performnce L. R. Prsons University of Florid Institute of Food nd Agriculturl Sciences Citrus

More information

ASPP1 Fw GGTTGGGAATCCACGTGTTG ASPP1 Rv GCCATATCTTGGAGCTCTGAGAG

ASPP1 Fw GGTTGGGAATCCACGTGTTG ASPP1 Rv GCCATATCTTGGAGCTCTGAGAG Supplemental Materials and Methods Plasmids: the following plasmids were used in the supplementary data: pwzl-myc- Lats2 (Aylon et al, 2006), pretrosuper-vector and pretrosuper-shp53 (generous gift of

More information

The Effect of Peptidoglycan on Immune Response in Black Tiger Shrimp (Penaeus monodon Fabricius)

The Effect of Peptidoglycan on Immune Response in Black Tiger Shrimp (Penaeus monodon Fabricius) Ksetsrt J. (Nt. Sci.) 4 : 181 187 (26) The Effect of Peptidoglycn on Immune Response in Blck Tiger Shrimp (Peneus monodon Fricius) Wtchriy Purivirojkul 1 *, Nontwith Areechon 2 nd Prpnsk Srispoome 2 ABSTRACT

More information

Switching to fast growth: the insulin-like growth factor (IGF) system in skeletal muscle of Atlantic salmon

Switching to fast growth: the insulin-like growth factor (IGF) system in skeletal muscle of Atlantic salmon 3859 The Journl of Experimentl Biology 211, 3859-387 Pulished y The Compny of Biologists 28 doi:1.1242/je.24117 Switching to fst growth: the insulin-like growth fctor (IGF) system in skeletl muscle of

More information

Loss of neuropathy target esterase in mice links organophosphate exposure to hyperactivity

Loss of neuropathy target esterase in mice links organophosphate exposure to hyperactivity Loss of neuropthy trget esterse in mice links orgnophosphte exposure to hyperctivity rticle Christopher J. Winrow 1,3, Mtthew L. Hemming 1, Dune M. Allen 1, Gry B. Quistd 2, John E. Csid 2 & Crrolee Brlow

More information

Interleukin 21 and its receptor are involved in NK cell expansion and regulation of lymphocyte function

Interleukin 21 and its receptor are involved in NK cell expansion and regulation of lymphocyte function Interleukin 21 nd its receptor re involved in NK cell expnsion nd regultion of lymphocyte function rticles Juli Prrish-Novk, Stcey R. Dillon, Andrew Nelson, Angie Hmmond, indy Sprecher, Jne A. Gross, Jnet

More information

Optimizations and Interpretations of Signal from Liquid Distribution Setup in Shake Flask

Optimizations and Interpretations of Signal from Liquid Distribution Setup in Shake Flask Proceedings of the World Congress on Engineering 9 Vol II WCE 9, July -, 9, London, U.K. Optimiztions nd Interprettions of Signl from Liquid Distriution Setup in Shke Flsk Amizon Azizn, Rungnp Vorvichn

More information

Gemin5-snRNA interaction reveals an RNA binding function for WD repeat domains

Gemin5-snRNA interaction reveals an RNA binding function for WD repeat domains Gemin5-snRNA interction revels n RNA inding function for WD repet domins Chi-kong Lu, Jennifer L Bchorik & Gideon Dreyfuss Gemin5 inds specificlly to the smll nucler RNA (snrna)-defining smll nucler rionucleoprotein

More information

Topic 7. Acids, Bases, Buffers, Titrations, Polyprotic acids

Topic 7. Acids, Bases, Buffers, Titrations, Polyprotic acids Topic 7 cids, Bses, Buffers, Titrtions, Polyprotic cids Conjugte cids & bses Strengths of cids & bses strong cid or strong bse is completely dissocited in queous solution. Wek cids nd Wek Bses Crboxylic

More information

Role of protein phosphatases in the run down of guinea pig cardiac Cav1.2 Ca 2 channels

Role of protein phosphatases in the run down of guinea pig cardiac Cav1.2 Ca 2 channels m J Physiol ell Physiol : 77 779, 6. First pulished Jnury 6, 6; doi:./jpcell.99.. LL FOR PPERS STIM nd Ori Proteins in lcium Signling Role of protein phosphtses in the run down of guine pig crdic v. chnnels

More information

Ubiquitin-dependent regulation of COPII coat size and function

Ubiquitin-dependent regulation of COPII coat size and function ARTICLE doi:10.1038/nture10822 Uiquitin-dependent regultion of COPII cot size nd function Lingyn Jin 1 *, Knik Bjj Phuj 1,2 *, Ktherine E. Wickliffe 1, Amit Gorur 1,2, Christine Bumgärtel 1, Rndy Schekmn

More information

Inhibition of autophagy significantly enhances combination therapy with sorafenib and HDAC inhibitors for human hepatoma cells

Inhibition of autophagy significantly enhances combination therapy with sorafenib and HDAC inhibitors for human hepatoma cells Online Sumissions: http://www.wjgnet.com/esps/ pgoffice@wjgnet.com doi:1.3748/wjg.v2.i17.4953 World J Gstroenterol 214 My 7; 2(17): 4953-4962 ISSN 17-9327 (print) ISSN 2219-284 (online) 214 Bishideng Pulishing

More information

Reversal of Blindness in Animal Models of Leber Congenital Amaurosis Using Optimized AAV2-mediated Gene Transfer

Reversal of Blindness in Animal Models of Leber Congenital Amaurosis Using Optimized AAV2-mediated Gene Transfer originl rticle Reversl of Blindness in Animl Models of Leer Congenitl Amurosis Using Optimized AAV2-medited Gene Trnsfer Jennette Bennicelli 1, John Frser Wright 2,3, Andrs Komromy 4, Jonthn B Jcos 5,

More information

The tumor suppressor p53 and the oncoprotein simian virus 40 T antigen bind to overlapping domains on the MDM2 protein.

The tumor suppressor p53 and the oncoprotein simian virus 40 T antigen bind to overlapping domains on the MDM2 protein. The tumor suppressor p53 nd the oncoprotein simin virus 40 T ntigen bind to overlpping domins on the MDM2 protein. D R Brown, S Deb, R M Muñoz, M A Subler nd S P Deb Mol. Cell. Biol. 1993, 13(11):6849.

More information

sirna Transfection Into Primary Neurons Using Fuse-It-siRNA

sirna Transfection Into Primary Neurons Using Fuse-It-siRNA sirna Transfection Into Primary Neurons Using Fuse-It-siRNA This Application Note describes a protocol for sirna transfection into sensitive, primary cortical neurons using Fuse-It-siRNA. This innovative

More information

Evaluation of Winter Canola Grown in 30 inch Rows

Evaluation of Winter Canola Grown in 30 inch Rows Evlution of Winter Cnol Grown in 3 inch Rows Chd Godsey, Oilseed Cropping Systems Specilist Pst reserch in Oklhom hs indicted tht yield potentil my decrese from to 1% when cnol is grown in 3 inch rows,

More information

Determining the architectures of macromolecular assemblies

Determining the architectures of macromolecular assemblies Vol 450 29 Novemer 2007 doi:10.1038/nture06404 Determining the rchitectures of mcromoleculr ssemlies ARTICLES Frnk Aler 1 *, Svetln Dokudovsky 2 *{, Lieseth M. Veenhoff 2 *{, Wenzhu Zhng 3, Juli Kipper

More information

Supplemental Data. Steiner et al. Plant Cell. (2012) /tpc

Supplemental Data. Steiner et al. Plant Cell. (2012) /tpc Supplemental Figure 1. SPY does not interact with free GST. Invitro pull-down assay using E. coli-expressed MBP-SPY and GST, GST-TCP14 and GST-TCP15. MBP-SPY was used as bait and incubated with equal amount

More information

Transient cell-specific EXO70A1 activity in the CASP domain and Casparian strip localization

Transient cell-specific EXO70A1 activity in the CASP domain and Casparian strip localization In the formt provided y the uthors nd unedited. SUPPLEMENTARY INFORMATION Trnsient cell-specific EXO7A1 ctivity in the CASP domin nd Csprin strip locliztion Lothr Klmch 1, Kin Hémty 1,2, Dmien De Bellis

More information

A module of negative feedback regulators defines growth factor signaling

A module of negative feedback regulators defines growth factor signaling 7 Nture Pulishing Group http://www.nture.com/nturegenetics A module of negtive feedck regultors defines growth fctor signling Ido Amit,9, Ami Citri,8,9, Tl Shy, Yiling Lu 3, Menchem Ktz, Fn Zhng 3, Gi

More information

Smac-mediated sensitization of human B-lymphoma cells to staurosporine- and lactacystin-triggered apoptosis is apoptosome-dependent

Smac-mediated sensitization of human B-lymphoma cells to staurosporine- and lactacystin-triggered apoptosis is apoptosome-dependent ORIGINAL ARTICLE (27) 21, 13 143 & 27 Nture Pulishing Group All rights reserved 887-6924/7 $3. www.nture.com/leu Smc-medited sensitiztion of humn B-lymphom cells to sturosporine- nd lctcystin-triggered

More information

Macmillan Publishers Limited. All rights reserved

Macmillan Publishers Limited. All rights reserved LETTER doi:1.18/nture1199 Nturl RNA circles function s efficient microrna sponges Thoms B. Hnsen 1, Trine I. Jensen 1, Bettin H. Clusen 2, Jesper B. Brmsen 1,, Bente Finsen 2, Christin K. Dmgrd 1 & Jørgen

More information

Biochemical and proteomics responses in Mediterranean crab: Effective tools to assess the toxic effects of marine contaminants. Dr.

Biochemical and proteomics responses in Mediterranean crab: Effective tools to assess the toxic effects of marine contaminants. Dr. Biochemicl nd proteomics responses in Mediterrnen cr: Effective tools to ssess the toxic effects of mrine contminnts Dr. Jmel JEBALI, PhD Higher Institute of Biotechnology of Monstir- Thr Hdded Street,

More information

Reducible Poly(oligo-d-arginine) for Enhanced Gene Expression in Mouse Lung by Intratracheal Injection

Reducible Poly(oligo-d-arginine) for Enhanced Gene Expression in Mouse Lung by Intratracheal Injection originl rticle The Americn Society of Gene & Cell Therpy Reducile Poly(oligo-d-rginine) for Enhnced Gene Expression in Mouse Lung y Intrtrchel Injection Young-Wook Won 1, Hyun Ah Kim 1, Minhyung Lee 1

More information

A) B) Ladder. Supplementary Figure 1. Recombinant calpain 14 purification analysis. A) The general domain structure of classical

A) B) Ladder. Supplementary Figure 1. Recombinant calpain 14 purification analysis. A) The general domain structure of classical A) B) Ladder C) r4 r4 Nt- -Ct 78 kda Supplementary Figure 1. Recombinant calpain 14 purification analysis. A) The general domain structure of classical calpains is shown. The protease core consists of

More information

Journal of Integrative Agriculture 2017, 16(0): Available online at ScienceDirect

Journal of Integrative Agriculture 2017, 16(0): Available online at  ScienceDirect Journl of Integrtive Agriculture 217, 16(): 6345-7 Aville online t www.sciencedirect.com ScienceDirect RESEARCH ARTICLE Functionl chrcteriztion of MdMYB73 revels its involvement in cold stress response

More information

Lethal influenza infection in the absence of the natural killer cell receptor gene Ncr1

Lethal influenza infection in the absence of the natural killer cell receptor gene Ncr1 26 Nture Pulishing Group http://www.nture.com/ntureimmunology Lethl influenz infection in the sence of the nturl killer cell receptor gene Ncr Roi Gzit, Rizy Grud, Morn Eloim, Tl I Arnon, Gil Ktz, Hgit

More information

Characterization of unconventional MYO6, the human homologue of the gene responsible for deafness in Snell s waltzer mice

Characterization of unconventional MYO6, the human homologue of the gene responsible for deafness in Snell s waltzer mice 1997 Oxford University Press Humn Moleculr Genetics, 1997, Vol. 6, No. 8 1225 1231 Chrcteriztion of unconventionl MYO6, the humn homologue of the gene responsile for defness in Snell s wltzer mice Kren

More information

Induced Apoptosis Investigation in Wild-type and FLT3-ITD Acute Myeloid Leukemia Cells by Nanochannel Electroporation and Single-cell qrt-pcr

Induced Apoptosis Investigation in Wild-type and FLT3-ITD Acute Myeloid Leukemia Cells by Nanochannel Electroporation and Single-cell qrt-pcr originl rticle Induced Apoptosis Investigtion in Wild-type nd FLT3-ITD Acute Myeloid Leukemi Cells y Nnochnnel Electroportion nd Single-cell qrt-pcr Keling Go 1,2, Xiomeng Hung 1,3,4, Chi-Ling Ching 1,4,

More information

Keywords: marine carotenoid; fucoxanthinol; Nrf2; apoptosis; ESR; peroxy radical

Keywords: marine carotenoid; fucoxanthinol; Nrf2; apoptosis; ESR; peroxy radical Article Dul Biologicl Functions of Cytoprotective Effect nd Apoptosis Induction y Bioville Mrine Crotenoid Fucoxnthinol through Modultion of the Nrf2 Activtion in RAW264.7 Mcrophge Cells Junsei Tir *,

More information

Supplementary Materials

Supplementary Materials Supplementary Materials Construction of Synthetic Nucleoli in Human Cells Reveals How a Major Functional Nuclear Domain is Formed and Propagated Through Cell Divisision Authors: Alice Grob, Christine Colleran

More information

Expression of CD226 is associated to but not required for NK cell education

Expression of CD226 is associated to but not required for NK cell education Received 7 Oct 216 Accepted 13 Apr 217 Pulished 31 My 217 DOI: 1.138/ncomms15627 OPEN Expression of CD226 is ssocited to ut not required for NK cell eduction Arnik K. Wgner 1,2, *, Ndir Kdri 2, *, Johnn

More information

Role of elongin-binding domain of von hippel lindau gene product on HuR-mediated VPF/VEGF mrna stability in renal cell carcinoma

Role of elongin-binding domain of von hippel lindau gene product on HuR-mediated VPF/VEGF mrna stability in renal cell carcinoma (2005) 24, 7850 7858 & 2005 Nture Pulishing Group All rights reserved 0950-9232/05 $30.00 www.nture.com/onc Role of elongin-inding domin of von hippel lindu gene product on -medited VPF/VEGF mrna stility

More information

by Neurobasal medium (supplemented with B27, 0.5mM glutamine, and 100 U/mL

by Neurobasal medium (supplemented with B27, 0.5mM glutamine, and 100 U/mL Supplementary Materials and methods Neuronal cultures and transfection The hippocampus was dissected from E8 rat embryos, dissociated, and neurons plated onto glass coverslips coated with poly-ornithine

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/3/6/ra27/dc Supplementary Materials for AAA+ Proteins and Coordinate PIKK Activity and Function in Nonsense-Mediated mrna Decay Natsuko Izumi, Akio Yamashita,*

More information

Autologous conditioned serum: The comparative cytokine profiles of two commercial methods (IRAP and IRAP II) using equine blood

Autologous conditioned serum: The comparative cytokine profiles of two commercial methods (IRAP and IRAP II) using equine blood 516 EQUINE VETEINAY JOUNAL Equine vet. J. (211) 43 (5) 516-521 doi: 1.1111/j.242-336.21.321.x Autologous conditioned serum: The comprtive cytokine profiles of two commercil methods (IAP nd IAP II) using

More information

Optimizing the Effectiveness of Induced Resistance in Tomato for Bacterial Disease Management. Cheryl Trueman

Optimizing the Effectiveness of Induced Resistance in Tomato for Bacterial Disease Management. Cheryl Trueman Optimizing the Effectiveness of Induced Resistnce in Tomto for Bcteril Disese Mngement by Cheryl Truemn A Thesis presented to The University of Guelph In prtil fulfilment of requirements for the degree

More information

Caulobacter crescentus

Caulobacter crescentus JOURNAL OF BACTRIOLOGY, Oct. 1976, p. 456-462 Copyright 1976 Americn Society for Microbiology Vol. 128, No. 1 Printed in U.S.A. Requirement of Cell Division Step for Stlk Formtion in Culobcter crescentus

More information

Cannabidiol displays unexpectedly high potency as an antagonist of CB 1 and CB 2 receptor agonists in vitro

Cannabidiol displays unexpectedly high potency as an antagonist of CB 1 and CB 2 receptor agonists in vitro British Journl of Phrmcology (27) 15, 613 623 & 27 Nture Pulishing Group All rights reserved 7 1188/7 $3. www.rjphrmcol.org RESEARCH PAPER Cnnidiol displys unexpectedly high potency s n ntgonist of CB

More information

Annex 5: Henrik Haugaard-Nielsen, Senior Researcher. Dorette Müller-Stöver, Post Doc.

Annex 5: Henrik Haugaard-Nielsen, Senior Researcher.   Dorette Müller-Stöver, Post Doc. Annex 5: Preliminry Results from the Soil Incution Study/Pot Experiment on Fertilizer Vlue of Aneroiclly Digested Slurries from Cofermenttion with Ulv lctuc Henrik Hugrd-Nielsen, Senior Resercher. E-mil:

More information

Apolipoprotein E promotes astrocyte colocalization and degradation of deposited amyloid-β peptides

Apolipoprotein E promotes astrocyte colocalization and degradation of deposited amyloid-β peptides 24 Nture Pulishing Group http://www.nture.com/nturemedicine Apolipoprotein E promotes strocyte colocliztion nd degrdtion of deposited myloid-β peptides Mill Koistinho 1,4,Suizhen Lin 1,4,Xin Wu 1,Michil

More information

LETTERS. Dynamics of DNA replication loops reveal temporal control of lagging-strand synthesis

LETTERS. Dynamics of DNA replication loops reveal temporal control of lagging-strand synthesis Vol 457 15 Jnury 9 doi:1.138/nture751 Dynmics of DNA repliction loops revel temporl control of lgging-strnd synthesis Smir M. Hmdn 1, Joseph J. Lopro 1, Msteru Tkhshi 1, Chrles C. Richrdson 1 & Antoine

More information

Hossain_Supplemental Figure 1

Hossain_Supplemental Figure 1 Hossain_Supplemental Figure 1 GFP-PACT GFP-PACT Motif I GFP-PACT Motif II A. MG132 (1µM) GFP Tubulin GFP-PACT Pericentrin GFP-PACT GFP-PACT Pericentrin Fig. S1. Expression and localization of Orc1 PACT

More information