Marc Kvansakul, Mark F. van Delft, Erinna F. Lee, Jacqueline M. Gulbis, W. Douglas Fairlie, David C.S. Huang, and Peter M. Colman
|
|
- Candace York
- 6 years ago
- Views:
Transcription
1 Molecular Cell, Volume 25 Supplemental Data A Structural Viral Mimic of Prosurvival Bcl-2: A Pivotal Role for Sequestering Proapoptotic Bax and Bak Marc Kvansakul, Mark F. van Delft, Erinna F. Lee, Jacqueline M. Gulbis, W. Douglas Fairlie, David C.S. Huang, and Peter M. Colman Supplemental Experimental Procedures Expression and retroviral constructs All mammalian expression vectors for HA-tagged BH3-only proteins, Bax and Bak subcloned into pef PGKhygro have been described previously (Chen et al., 2005; Huang et al., 1997; O'Connor et al., 1998; Willis et al., 2005), the FLAG-tagged vector for Bcl-x L was described previously (Huang et al., 1997). Similar constructs, made by subcloning into pef PGKpuro, were made for wild-type or mutant forms of M11L. Retroviral expression constructs (Noxa, Noxa3E, Bim S, Bim S 4E) were made by subcloning into the pmig vector (MSCV-IRES-GFP, GFP sequence is that of EGFP) and have been previously described (Chen et al., 2005; Willis et al., 2005). The GFP selection cassette was replaced with that of hygromycin (van Delft et al., 2006) for the constructs expressing FLAG-tagged Bcl-2, and wild-type or mutant M11L. All the cdnas used were of human origin except for Bad (mouse), Bid (mouse), Hrk (rat) and M11L (myxoma virus). Details of all oligonucleotides and constructs are available from the authors. Tissue culture, cell death induction, retroviral infections, and apoptosis assays All cell lines (HEK293T: immortalized human embryonal kidney cell line, Phoenix Ecotropic packaging cells (Kinsella and Nolan, 1996), FDC-P1: mouse myelomonocytic, and mouse embryonic fibroblasts: MEFs ) were cultured in Dulbecco s Modified Eagles (DME) medium supplemented with 10% fetal calf serum (FCS), and in some cases with 250 µm L-asparagine and 50 µm 2-mercaptoethanol. All MEFs (Chen et al., 2005; Willis et al., 2005; Willis et al., In Press) were generated from E embryos and immortalized (at passage 2-4) with SV40 large T antigen. All mice used were of C57BL/6 origin or have been
2 backcrossed (>10 generations) to this genetic background and their genotype determined as previously described (details are available from the authors). Cell death was induced with ABT-737 (4 µm, Abbott Laboratories; (Oltersdorf et al., 2005), UV-irradiation (200 J/m 2 ), Etoposide (100 µm), IL-3 deprivation (of FDC-P1 cells) or by retroviral infection. pmig retroviral constructs encoding BH3-only proteins were transiently transfected into Phoenix Ecotropic packaging cells and viral supernatants used to infect cells as described (Chen et al., 2005). Cell viability in both short-term assays and longterm assays of colony formation was determined as described (Chen et al., 2005). Long-term survival is expressed as a percentage of the number of colonies obtained relative to retroviral infection with empty parental retrovirus. Immunoprecipitation and immunoblotting The transfection and metabolic labeling of the human embryonic kidney (HEK) 293T cells with 35 S-methionine/cysteine (NEN) have been described (Huang et al., 1997; Moriishi et al., 1999; O'Connor et al., 1998). Immunoprecipitation was performed using mouse monoclonal anti-flag (M2: Sigma) or anti-ha (3F10; Roche) antibodies. Control immunoprecipitations were performed using an anti-mouse Glu-Glu (MMS-115R: CRP) antibody. Proteins were resolved by SDS:PAGE (Novex gels, Invitrogen), transferred onto nitrocellulose membranes and proteins detected by immunoblotting using mouse monoclonal anti-bax (2D2; Sigma), FLAG (9H1; (Wilson-Annan et al., 2003); rabbit polyclonal anti-bak (B5929: Sigma); rat monoclonal anti-bim (3C5; Alexis). Secondary antibodies included HRP-conjugated anti-rat or anti-mouse IgG (Chemicon). The proteins were detected using Enhanced ChemiLuminescence (ECL, GE Healthcare). Supplemental References Chen, L., Willis, S. N., Wei, A., Smith, B. J., Fletcher, J. I., Hinds, M. G., Colman, P. M., Day, C. L., Adams, J. M., and Huang, D. C. S. (2005). Differential targeting of pro-survival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Mol Cell 17, Huang, D. C. S., O'Reilly, L. A., Strasser, A., and Cory, S. (1997). The anti-apoptosis function of Bcl-2 can be genetically separated from its inhibitory effect on cell cycle entry. EMBO J 16, Kinsella, T. M., and Nolan, G. P. (1996). Episomal vectors rapidly and stably produce hightiter recombinant retrovirus. Hum Gene Ther 7,
3 Moriishi, K., Huang, D. C. S., Cory, S., and Adams, J. M. (1999). Bcl-2 family members do not inhibit apoptosis by binding the caspase-activator Apaf-1. Proc Natl Acad Sci U S A 96, O'Connor, L., Strasser, A., O'Reilly, L. A., Hausmann, G., Adams, J. M., Cory, S., and Huang, D. C. S. (1998). Bim: a novel member of the Bcl-2 family that promotes apoptosis. EMBO J 17, Oltersdorf, T., Elmore, S. W., Shoemaker, A. R., Armstrong, R. C., Augeri, D. J., Belli, B. A., Bruncko, M., Deckwerth, T. L., Dinges, J., Hajduk, P. J., et al. (2005). An inhibitor of Bcl-2 family proteins induces regression of solid tumours. Nature 435, van Delft, M. F., Wei, A. H., Mason, K. D., Vandenberg, C. J., Chen, L., Czabotar, P. E., Willis, S. N., Scott, C. L., Day, C. L., Cory, S., et al. (2006). The BH3 mimetic ABT-737 targets selective Bcl-2 proteins and efficiently induces apoptosis via Bak/Bax if Mcl-1 is neutralized. Cancer Cell 10, Willis, S. N., Chen, L., Dewson, G., Wei, A., Naik, E., Fletcher, J. I., Adams, J. M., and Huang, D. C. (2005). Pro-apoptotic Bak is sequestered by Mc1-1 and Bcl-x L, but not Bcl-2, until displaced by BH3-only proteins. Genes Dev 19, Willis, S. N., Fletcher, J. I., Kaufmann, T., van Delft, M. F., Chen, L., Czabotar, P. E., Ierino, H., Lee, E. F., Fairlie, W. D., Bouillet, P., et al. (In Press). Apoptosis is induced when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak. Science. Wilson-Annan, J., O'Reilly, L. A., Crawford, S. A., Hausmann, G., Beaumont, J. G., Parma, L. P., Chen, L., Lackmann, M., Lithgow, T., Hinds, M. G., et al. (2003). Proapoptotic BH3- only proteins trigger membrane integration of prosurvival Bcl-w and neutralize its activity. J Cell Biol 162,
4 Figure S1. Lack of mammalian sequence homologs of M11L. The top ten hits from a NCBI BlastP search using the M11L amino acid sequence. Other than related viral proteins, the highest ranked mammalian protein (shown in bold) did not show any significant similarity with M11L. +: significant hits analyzed in greater detail in Fig. S3. Figure S2. Intramolecular disulfide bond in M11L. (A) Experimental electron density for the M11L:Bak BH3 complex contoured at 1.5σ around the M11L C33-C127 disulfide bond. Unexpectedly, a buried disulfide bond is present in M11L, despite the presence of reducing agents throughout the protein purification and crystallization. (B) Viability of FDC-P1 cells stably expressing FLAG-tagged wild-type M11L or a double cysteine mutant (C33S/C127S) 0 or 24 h following IL-3 withdrawal. Data represent means ± SD from 3 independent experiments.
5 Figure S3. Viral homologs of Myxoma virus M11L. Sequence alignment (using ClustalW) of the most relevant BlastP hits (indicated by + in Fig. S1). Fully conserved (*), highly conserved (:) and well conserved (.) residues are marked. & - residues forming the M11L binding groove (Fig. 3A). Residues shaded in yellow form part of the M11L binding groove and are fully conserved. # highlights valine 79 in M11L; this position is usually an arginine (R) in Bcl-2 family proteins (see Fig. 3A). Note the high conservation of key residues that form the hydrophobic groove of M11L.
Like Bcl-2, Mcl-1 is an important survival factor for
Published Online: 21 January, 2008 Supp Info: http://doi.org/10.1083/jcb.200708096 Downloaded from jcb.rupress.org on August 19, 2018 JCB: ARTICLE A novel BH3 ligand that selectively targets Mcl-1 reveals
More informationSupplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/-
#1074683s 1 Supplemental Online Material Materials and Methods Cell lines and tissue culture The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- knock-out animals
More informationSupplementary Figure 1 (related to Figure 1) a. SVEC cells stably expressing egfp tbid 2A BCL xl were analysed by Western blot for expression of egfp
Supplementary Figure 1 (related to Figure 1) a. SVEC cells stably expressing egfp tbid 2A BCL xl were analysed by Western blot for expression of egfp tbid and BCL xl. TOM20 was used as a loading control.
More informationEndogenous MYC was detected by Western blotting using the N-262 polyclonal antibody (Santa
SUPPLEMENTARY METHODS Antibodies Endogenous MYC was detected by Western blotting using the N-262 polyclonal antibody (Santa Cruz) or the 9E10 monoclonal antibody (Vanderbilt Antibody and Protein Resource).
More informationBcl-2 family member Bcl-G is not a pro-apoptotic BH3-only protein
Bcl-2 family member Bcl-G is not a pro-apoptotic BH3-only protein Maybelline Giam 1,2, Toru Okamoto 1,2,3, Justine D. Mintern 1,2,4, Andreas Strasser 1,2 and Philippe Bouillet 1, 2 1 The Walter and Eliza
More informationThe retroviral vectors encoding WT human SIRT1 or a mutant of SIRT in which a
Supporting online material Constructs The retroviral vectors encoding WT human SIRT1 or a mutant of SIRT in which a critical histidine in the deacetylase domain of SIRT1 has been replaced by a tyrosine
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature09732 Supplementary Figure 1: Depletion of Fbw7 results in elevated Mcl-1 abundance. a, Total thymocytes from 8-wk-old Lck-Cre/Fbw7 +/fl (Control) or Lck-Cre/Fbw7 fl/fl (Fbw7 KO) mice
More informationNature Medicine doi: /nm.3554
SUPPLEMENTARY FIGURES LEGENDS Supplementary Figure 1: Generation, purification and characterization of recombinant mouse IL-35 (ril-35). High-Five insect cells expressing high levels of the bicistronic
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/330/6009/1390/dc1 Supporting Online Material for BID, BIM, and PUMA Are Essential for Activation of the BAX- and BAK-Dependent Cell Death Program Decheng Ren, Ho-Chou
More informationused at a final concentration of 5 ng/ml. Rabbit anti-bim and mouse anti-mkp2 antibodies were
1 Supplemental Methods Reagents and chemicals: TGFβ was a generous gift from Genzyme Inc. (Cambridge, MA) and was used at a final concentration of 5 ng/ml. Rabbit anti-bim and mouse anti-mkp2 antibodies
More informationSupplemental Figure Legends:
Supplemental Figure Legends: Fig S1. GFP-ABRO1 localization. U2OS cells were infected with retrovirus expressing GFP- ABRO1. The cells were fixed with 3.6% formaldehyde and stained with antibodies against
More informationMaterials and Methods
Materials and Methods Construction of noxa / mice and genotyping The targeting vector (see Fig. S) was prepared from a C57BL/6 DNA λ phage library (Stratagene) by replacing a 2.7 kb region encompassing
More informationGFP CCD2 GFP IP:GFP
D1 D2 1 75 95 148 178 492 GFP CCD1 CCD2 CCD2 GFP D1 D2 GFP D1 D2 Beclin 1 IB:GFP IP:GFP Supplementary Figure 1: Mapping domains required for binding to HEK293T cells are transfected with EGFP-tagged mutant
More informationSupplementary Information. A novel human endogenous retroviral protein inhibits cell-cell fusion. Supplementary Figures:
Supplementary Information A novel human endogenous retroviral protein inhibits cell-cell fusion Jun Sugimoto, Makiko Sugimoto, Helene Bernstein, Yoshihiro Jinno and Danny J. Schust Supplementary Figures:
More informationCell culture and drug treatment. HEK 293 cells were cultured in DMEM (Gibco-BRL)
Supplementary materials Detailed methods Cell culture and drug treatment. HEK 293 cells were cultured in DMEM (Gibco-BRL) supplemented with 10% fetal bovine serum. To inhibit glucosidase Ι and ΙΙ, castanospermine
More informationINVESTIGATION OF THE BINDING SPECIFICITY OF IGF-IR USING MONOCLONAL ANTIBODIES
INVESTIGATION OF THE BINDING SPECIFICITY OF IGF-IR USING MONOCLONAL ANTIBODIES By Mehrnaz Keyhanfar, Pharm.D. A thesis submitted to the University of Adelaide, South Australia in fulfilment of the requirements
More informationSupplementary Table 1. Primers used to construct full-length or various truncated mutants of ISG12b2.
Supplementary Table 1. Primers used to construct full-length or various truncated mutants of ISG12b2. Construct name ISG12b2 (No tag) HA-ISG12b2 (N-HA) ISG12b2-HA (C-HA; FL-HA) 94-283-HA (FL-GFP) 93-GFP
More informationSupplementary Information
Supplementary Information Peroxiredoxin-2 and STAT3 form a redox relay for H 2 O 2 signaling Mirko C. Sobotta 1, Willy Liou 1, Sarah Stöcker 1, Deepti Talwar 1, Michael Oehler 1, Thomas Ruppert 2, Annette
More informationChapter 17: Immunization & Immune Testing. 1. Immunization 2. Diagnostic Immunology
Chapter 17: Immunization & Immune Testing 1. Immunization 2. Diagnostic Immunology 1. Immunization Chapter Reading pp. 505-511 What is Immunization? A method of inducing artificial immunity by exposing
More information1. Immunization. What is Immunization? 12/9/2016. Chapter 17: Immunization & Immune Testing. 1. Immunization 2. Diagnostic Immunology
Chapter 17: Immunization & Immune Testing 1. Immunization 2. Diagnostic Immunology 1. Immunization Chapter Reading pp. 505-511 What is Immunization? A method of inducing artificial immunity by exposing
More informationSUPPLEMENTAL FIGURE LEGENDS. Figure S1: Homology alignment of DDR2 amino acid sequence. Shown are
SUPPLEMENTAL FIGURE LEGENDS Figure S1: Homology alignment of DDR2 amino acid sequence. Shown are the amino acid sequences of human DDR2, mouse DDR2 and the closest homologs in zebrafish and C. Elegans.
More informationb alternative classical none
Supplementary Figure. 1: Related to Figure.1 a d e b alternative classical none NIK P-IkBa Total IkBa Tubulin P52 (Lighter) P52 (Darker) RelB (Lighter) RelB (Darker) HDAC1 Control-Sh RelB-Sh NF-kB2-Sh
More informationTo examine the silencing effects of Celsr3 shrna, we co transfected 293T cells with expression
Supplemental figures Supplemental Figure. 1. Silencing expression of Celsr3 by shrna. To examine the silencing effects of Celsr3 shrna, we co transfected 293T cells with expression plasmids for the shrna
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/1154040/dc1 Supporting Online Material for Selective Blockade of MicroRNA Processing by Lin-28 Srinivas R. Viswanathan, George Q. Daley,* Richard I. Gregory* *To whom
More informationA Structural Viral Mimic of Prosurvival Bcl-2: A Pivotal Role for Sequestering Proapoptotic Bax and Bak
Short Article A Structural Viral Mimic of Prosurvival Bcl-2: A Pivotal Role for Sequestering Proapoptotic Bax and Bak Marc Kvansakul, 1 Mark F. van Delft, 1,2 Erinna F. Lee, 1,2 Jacqueline M. Gulbis, 1
More informationAnna A. Sablina, Wen Chen, Jason D. Arroyo, Laura Corral, Melissa Hector, Sara E. Bulmer, James A. DeCaprio, and William C. Hahn
Cell, Volume 129 Supplemental Data The Tumor Suppressor PP2A Aβ Regulates the RalA GTPase Anna A. Sablina, Wen Chen, Jason D. Arroyo, Laura Corral, Melissa Hector, Sara E. Bulmer, James A. DeCaprio, and
More informationDescription of supplementary material file
Description of supplementary material file In the supplementary results we show that the VHL-fibronectin interaction is indirect, mediated by fibronectin binding to COL4A2. This provides additional information
More informationSupplementary Methods
Supplementary Methods Reverse transcribed Quantitative PCR. Total RNA was isolated from bone marrow derived macrophages using RNeasy Mini Kit (Qiagen), DNase-treated (Promega RQ1), and reverse transcribed
More informationRecombinant adenoviruses. A TRB3-expressing adenovirus was generated through
Materials and Methods Recombinant adenoviruses. A -expressing adenovirus was generated through homologous recombination between a linearized transfer vector pad-track and the adenoviral backbone vector
More informationESTABLISHMENT OF OKADAIC ACID RESISTANT CELL CLONES USING CDNA LIBRARY EXPRESSION CLONING
Miami Nature Biotechnology Short Reports TheScientificWorld (2001) 1(S3), 42SR ISSN 1532-2246; DOI 10.1100/tsw.2001.149 ESTABLISHMENT OF OKADAIC ACID RESISTANT CELL CLONES USING CDNA LIBRARY EXPRESSION
More informationOnline Supplementary Information
Online Supplementary Information NLRP4 negatively regulates type I interferon signaling by targeting TBK1 for degradation via E3 ubiquitin ligase DTX4 Jun Cui 1,4,6,7, Yinyin Li 1,5,6,7, Liang Zhu 1, Dan
More informationLINGO-1, A TRANSMEMBRANE SIGNALING PROTEIN, INHIBITS OLIGODENDROCYTE DIFFERENTIATION AND MYELINATION THROUGH INTERCELLULAR SELF- INTERACTIONS.
Supplemental Data: LINGO-1, A TRANSMEMBRANE SIGNALING PROTEIN, INHIBITS OLIGODENDROCYTE DIFFERENTIATION AND MYELINATION THROUGH INTERCELLULAR SELF- INTERACTIONS. Scott Jepson, Bryan Vought, Christian H.
More informationSUPPLEMENTAL MATERIALS SIRTUIN 1 PROMOTES HYPEROXIA-INDUCED LUNG EPITHELIAL DEATH INDEPENDENT OF NRF2 ACTIVATION
SUPPLEMENTAL MATERIALS SIRTUIN PROMOTES HYPEROXIA-INDUCED LUNG EPITHELIAL DEATH INDEPENDENT OF NRF ACTIVATION Haranatha R. Potteti*, Subbiah Rajasekaran*, Senthilkumar B. Rajamohan*, Chandramohan R. Tamatam,
More informationFig. S1 TGF RI inhibitor SB effectively blocks phosphorylation of Smad2 induced by TGF. FET cells were treated with TGF in the presence of
Fig. S1 TGF RI inhibitor SB525334 effectively blocks phosphorylation of Smad2 induced by TGF. FET cells were treated with TGF in the presence of different concentrations of SB525334. Cells were lysed and
More informationCD93 and dystroglycan cooperation in human endothelial cell adhesion and migration
/, Supplementary Advance Publications Materials 2016 CD93 and dystroglycan cooperation in human endothelial cell adhesion and migration Supplementary Materials Supplementary Figure S1: In ECs CD93 silencing
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/4/167/ra20/dc1 Supplementary Materials for Poly(ADP-Ribose) (PAR) Binding to Apoptosis-Inducing Factor Is Critical for PAR Polymerase-1 Dependent Cell Death (Parthanatos)
More informationSupplementary Fig. S1. SAMHD1c has a more potent dntpase activity than. SAMHD1c. Purified recombinant SAMHD1c and SAMHD1c proteins (with
Supplementary Fig. S1. SAMHD1c has a more potent dntpase activity than SAMHD1c. Purified recombinant SAMHD1c and SAMHD1c proteins (with concentration of 800nM) were incubated with 1mM dgtp for the indicated
More informationSupplemental Information. DNp63 Inhibits Oxidative Stress-Induced Cell. Death, Including Ferroptosis, and Cooperates with
Cell Reports, Volume 21 Supplemental Information DNp63 Inhibits Oxidative Stress-Induced Cell Death, Including Ferroptosis, and Cooperates with the BCL-2 Family to Promote Clonogenic Survival Gary X. Wang,
More informationSuggested Method Reprogramming MEF Cells into pips Cells using the Stemgent Recombinant Human Protein Set: OSKM-11R
Page 1 Reprogramming MEF Cells into pips Cells using the Cat. No. 00-0062 OVERVIEW The procedure outlined below describes the reprogramming of mouse embryonic fibroblasts (MEF) by the addition of four
More informationSupplemental Material: Rev1 promotes replication through UV lesions in conjunction with DNA
Supplemental Material: Rev1 promotes replication through UV lesions in conjunction with DNA polymerases,, and, but not with DNA polymerase Jung-Hoon Yoon, Jeseong Park, Juan Conde, Maki Wakamiya, Louise
More informationSupplementary Information (Ha, et. al) Supplementary Figures Supplementary Fig. S1
Supplementary Information (Ha, et. al) Supplementary Figures Supplementary Fig. S1 a His-ORMDL3 ~ 17 His-ORMDL3 GST-ORMDL3 - + - + IPTG GST-ORMDL3 ~ b Integrated Density (ORMDL3/ -actin) 0.4 0.3 0.2 0.1
More informationsirna Overview and Technical Tips
1 sirna Overview and Technical Tips 2 CONTENTS 3 4 5 7 8 10 11 13 14 18 19 20 21 Introduction Applications How Does It Work? Handy Tips Troubleshooting Conclusions Further References Contact Us 3 INTRODUCTION
More informationSupplementary methods
Supplementary methods Cell culture, infection, transfection, and RNA interference HEK293 cells and its derivatives were grown in DMEM supplemented with 10% FBS. Various constructs were introduced into
More informationSupporting Information
Supporting Information Krieg et al. 10.1073/pnas.0907131106 SI Text Reagents. Recombinant human TNF- was from Peprotech. Monoclonal rat anti-rip2 was purchased from Alexis, whereas monoclonal mouse anti-xiap
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Han et al., http://www.jcb.org/cgi/content/full/jcb.201311007/dc1 Figure S1. SIVA1 interacts with PCNA. (A) HEK293T cells were transiently
More informationCell proliferation was measured with Cell Counting Kit-8 (Dojindo Laboratories, Kumamoto, Japan).
1 2 3 4 5 6 7 8 Supplemental Materials and Methods Cell proliferation assay Cell proliferation was measured with Cell Counting Kit-8 (Dojindo Laboratories, Kumamoto, Japan). GCs were plated at 96-well
More informationSupporting Online Material Y. Tang et al., published 1/24/03
Y. Tang SOM, p. 1 Supporting Online Material Y. Tang et al., published 1/24/03 MATERIALS AND METHODS Construction of the Targeting Vector and Generation of Mice Carrying Mutations Targeting vector. Recombinant
More informationSupplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons
Neuron, Volume 61 Supplemental Data LMO4 Controls the Balance between Excitatory and Inhibitory Spinal V2 Interneurons Kaumudi Joshi, Seunghee Lee, Bora Lee, Jae W. Lee, and Soo-Kyung Lee Supplemental
More informationSupporting Information
Supporting Information Chan et al. 10.1073/pnas.0903849106 SI Text Protein Purification. PCSK9 proteins were expressed either transiently in 2936E cells (1), or stably in HepG2 cells. Conditioned culture
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature10928 Materials and Methods 1. Plant material and growth conditions. All plant lines used were in Col-0 background unless otherwise specified. pif4-101 mutant
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/323/5911/256/dc1 Supporting Online Material for HDAC4 Regulates Neuronal Survival in Normal and Diseased Retinas Bo Chen and Constance L. Cepko E-mail: bochen@genetics.med.harvard.edu,
More informationSupplementary Information
Supplementary Information Supplementary Figures Supplementary Figure 1. MLK1-4 phosphorylate MEK in the presence of RAF inhibitors. (a) H157 cells were transiently transfected with Flag- or HA-tagged MLK1-4
More informationPE11, a PE/PPE family protein of Mycobacterium tuberculosis is involved in cell wall remodeling and virulence
PE11, a PE/PPE family protein of Mycobacterium tuberculosis is involved in cell wall remodeling and virulence Parul Singh 1,2, Rameshwaram Nagender Rao 1, Jala Ram Chandra Reddy 3, R.B.N. Prasad 3, Sandeep
More informationsupplementary information
DOI: 10.1038/ncb2172 Figure S1 p53 regulates cellular NADPH and lipid levels via inhibition of G6PD. (a) U2OS cells stably expressing p53 shrna or a control shrna were transfected with control sirna or
More informationFigure S1. Sequence alignments of ATRIP and ATR TopBP1 interacting regions.
A H. sapiens 204 TKLQTS--ERANKLAAPSVSH VSPRKNPSVVIKPEACS-PQFGKTSFPTKESFSANMS LP 259 B. taurus 201 TKLQSS--ERANKLAVPTVSH VSPRKSPSVVIKPEACS-PQFGKPSFPTKESFSANKS LP 257 M. musculus 204 TKSQSN--GRTNKPAAPSVSH
More informationSupplementary Figure 1. α-synuclein is truncated in PD and LBD brains. Nature Structural & Molecular Biology: doi: /nsmb.
Supplementary Figure 1 α-synuclein is truncated in PD and LBD brains. (a) Specificity of anti-n103 antibody. Anti-N103 antibody was coated on an ELISA plate and different concentrations of full-length
More informationSupporting Information
Supporting Information Drugs Modulate Interactions Between the First Nucleotide-Binding Domain and the Fourth Cytoplasmic Loop of Human P-glycoprotein Tip W. Loo and David M. Clarke Department of Medicine
More informationHyper sensitive protein detection by Tandem-HTRF reveals Cyclin D1
Hyper sensitive protein detection by Tandem-HTRF reveals Cyclin D1 dynamics in adult mouse Alexandre Zampieri, Julien Champagne, Baptiste Auzemery, Ivanna Fuentes, Benjamin Maurel and Frédéric Bienvenu
More informationASPP1 Fw GGTTGGGAATCCACGTGTTG ASPP1 Rv GCCATATCTTGGAGCTCTGAGAG
Supplemental Materials and Methods Plasmids: the following plasmids were used in the supplementary data: pwzl-myc- Lats2 (Aylon et al, 2006), pretrosuper-vector and pretrosuper-shp53 (generous gift of
More informationProduct Data Sheet - TRUEMAB
888.267.4436 techsupport@origene.com www.origene.com Name:LHX1 (LIM1) mouse monoclonal antibody, clone OTI2D5 (formerly 2D5) Product Data Sheet - TRUEMAB Catalog: TA504527 Components: LHX1 (LIM1) mouse
More informationSupplementary Information: Materials and Methods. GST and GST-p53 were purified according to standard protocol after
Supplementary Information: Materials and Methods Recombinant protein expression and in vitro kinase assay. GST and GST-p53 were purified according to standard protocol after induction with.5mm IPTG for
More informationCode No Retrovirus Packaging Kit Ampho
Code No. 6161 Retrovirus Packaging Kit Ampho Precautions for the use of this product Please follow the guideline for experiments using recombinant DNA issued by the relevant authorities and the safety
More informationNature Structural & Molecular Biology: doi: /nsmb.1969
Supplementary Methods Structure determination All the diffraction data sets were collected on BL-41XU (using ADSC Quantum 315 HE CCD detector) at SPring8 (Harima, Japan) or on BL5A (using ADSC Quantum
More informationNature Biotechnology: doi: /nbt Supplementary Figure 1
Supplementary Figure 1 Generation of the AARE-Gene system construct. (a) Position and sequence alignment of AAREs extracted from human Trb3, Chop or Atf3 promoters. AARE core sequences are boxed in grey.
More information(a) Immunoblotting to show the migration position of Flag-tagged MAVS
Supplementary Figure 1 Characterization of six MAVS isoforms. (a) Immunoblotting to show the migration position of Flag-tagged MAVS isoforms. HEK293T Mavs -/- cells were transfected with constructs expressing
More informationSolutions to 7.02 Quiz II 10/27/05
Solutions to 7.02 Quiz II 10/27/05 Class Average = 83 Standard Deviation = 9 Range Grade % 87-100 A 43 74-86 B 39 55-73 C 17 > 54 D 1 Question 1 (56 points) While studying deep sea bacteria, you discover
More informationGα i Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Gα i Activation Assay Kit Catalog Number 80301 20 assays NewEast Biosciences, Inc 1 Table of Content Product
More informationSupplemental Figure 1
Supplemental Figure 1 A C19 B Mα p27 TL p27-/- p27-/- Supplemental Figure 1: Altered expression of p27 and p27 in the brain. Immunostaining for p27 was performed on brain frozen sections. Brain sections
More informationJCB Online Supplemental Material
JCB Online Supplemental Material Schinzel et al. Results At least one positive charge at the very COOH terminus is needed for mitochondrial sorting It has been reported that two consecutive positive charges
More informationUSP19 modulates autophagy and antiviral immune responses by. deubiquitinating Beclin-1
USP19 modulates autophagy and antiviral immune responses by deubiquitinating Beclin-1 Shouheng Jin 1,2,, Shuo Tian 1,, Yamei Chen 1,, Chuanxia Zhang 1,2, Weihong Xie, 1 Xiaojun Xia 3,4, Jun Cui 1,3* &
More informationTranscriptional regulation of IFN-l genes in Hepatitis C virus-infected hepatocytes via IRF-3 IRF-7 NF- B complex
POSTER PRESENTATION Transcriptional regulation of IFN-l genes in Hepatitis C virus-infected hepatocytes via IRF-3 IRF-7 NF- B complex Hai-Chon Lee *, Je-In Youn, Kyungwha Lee, Hwanyul Yong, Seung-Yong
More informationtranscription and the promoter occupancy of Smad proteins. (A) HepG2 cells were co-transfected with the wwp-luc reporter, and FLAG-tagged FHL1,
Supplementary Data Supplementary Figure Legends Supplementary Figure 1 FHL-mediated TGFβ-responsive reporter transcription and the promoter occupancy of Smad proteins. (A) HepG2 cells were co-transfected
More informationTHE UNIVERSITY OF NEWCASTLE- DISCIPLINE OF MEDICAL BIOCHEMISTRY. STANDARD OPERATING PROCEDURE PROCEDURE NO: GLP 104 MOD: 1st Issue Page: 1 of 8
THE UNIVERSITY OF NEWCASTLE- DISCIPLINE OF MEDICAL BIOCHEMISTRY STANDARD OPERATING PROCEDURE PROCEDURE NO: GLP 104 MOD: 1st Issue Page: 1 of 8 Procedure Type: General Laboratory Procedure 1. Introduction
More informationCleavage of tau by asparagine endopeptidase mediates the neurofibrillary pathology in
Supplementary information Cleavage of tau by asparagine endopeptidase mediates the neurofibrillary pathology in Alzheimer s disease Zhentao Zhang, Mingke Song, Xia Liu, Seong Su Kang, Il-Sun Kwon, Duc
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/2/85/ra48/dc1 Supplementary Materials for The VDAC2-BAK Rheostat Controls Thymocyte Survival Decheng Ren, Hyungjin Kim, Ho-Chou Tu, Todd D. Westergard, Jill K.
More informationSupplementary Fig. 1 Identification of Nedd4 as an IRS-2-associated protein in camp-treated FRTL-5 cells.
Supplementary Fig. 1 Supplementary Fig. 1 Identification of Nedd4 as an IRS-2-associated protein in camp-treated FRTL-5 cells. (a) FRTL-5 cells were treated with 1 mm dibutyryl camp for 24 h, and the lysates
More informationSupplementary Information for Structural and Mechanistic Insights into Cooperative Assembly of Dimeric Notch Transcription Complexes
Supplementary Information for Structural and Mechanistic Insights into Cooperative Assembly of Dimeric Notch Transcription Complexes Kelly L. Arnett 1,2, Matthew Hass 3, Debbie G. McArthur 1,2, Ma. Xenia
More informationApoptosis And Anti-tumor Effect Induced By Mtor Inhibitor And Autophagy Inhibitor In Human Osteosarcoma Cells
Apoptosis And Anti-tumor Effect Induced By Mtor Inhibitor And Autophagy Inhibitor In Human Osteosarcoma Cells Ryosuke Horie. Kagawa University of medecine, Kita-gun, Japan. Disclosures: R. Horie: None.
More informationSupplementary Table 1. The Q-PCR primer sequence is summarized in the following table.
Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of
More informationThis is the author's accepted version of the manuscript.
This is the author's accepted version of the manuscript. The definitive version is published in Nature Communications Online Edition: 2015/4/16 (Japan time), doi:10.1038/ncomms7780. The final version published
More informationHeLa cells stably transfected with an empty pcdna3 vector (HeLa Neo) or with a plasmid
SUPPLEMENTAL MATERIALS AND METHODS Cell culture, transfection and treatments. HeLa cells stably transfected with an empty pcdna3 vector (HeLa Neo) or with a plasmid encoding vmia (HeLa vmia) 1 were cultured
More informationSupplementary Figure 1 - Characterization of rbag3 binding on macrophages cell surface.
Supplementary Figure 1 - Characterization of rbag3 binding on macrophages cell surface. (a) Human PDAC cell lines were treated as indicated in Figure 1 panel F. Cells were analyzed for FITC-rBAG3 binding
More informationSupplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53
Supplementary data Supplemental Figure 1 A sienigma #2 sienigma sicontrol a-enigma - + ++ - - - - - - + ++ - - - - - - ++ B sienigma F-Enigma F-EnigmaSM a-flag HLK3 cells - - - + ++ + ++ - + - + + - -
More informationSUPPLEMENTARY INFORMATION
DOI:.38/ncb327 a b Sequence coverage (%) 4 3 2 IP: -GFP isoform IP: GFP IP: -GFP IP: GFP Sequence coverage (%) 4 3 2 IP: -GFP IP: GFP 33 52 58 isoform 2 33 49 47 IP: Control IP: Peptide Sequence Start
More informationLoss of Cul3 in Primary Fibroblasts
PSU McNair Scholars Online Journal Volume 5 Issue 1 Humans Being: People, Places, Perspectives and Processes Article 15 2011 Loss of Cul3 in Primary Fibroblasts Paula Hanna Portland State University Let
More informationOriGene GFC-Arrays for High-throughput Overexpression Screening of Human Gene Phenotypes
OriGene GFC-Arrays for High-throughput Overexpression Screening of Human Gene Phenotypes High-throughput Gene Function Validation Tool Introduction sirna screening libraries enable scientists to identify
More informationMARCH 4, 2011 VOLUME 286 NUMBER 9 JOURNAL OF BIOLOGICAL CHEMISTRY 7123
THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 286, NO. 9, pp. 7123 7131, March 4, 2011 2011 by The American Society for Biochemistry and Molecular Biology, Inc. Printed in the U.S.A. Mutation to Bax beyond
More informationProtocol Reprogramming MEFs using the Dox Inducible Reprogramming Lentivirus Set: Mouse OKSM
STEMGENT Page 1 OVERVIEW The following protocol describes the reprogramming of one well of mouse embryonic fibroblasts (MEFs) into induced pluripotent stem (ips) cells in a 6-well format. Transduction
More informationmonoclonal antibody. (a) The specificity of the anti-rhbdd1 monoclonal antibody was examined in
Supplementary information Supplementary figures Supplementary Figure 1 Determination of the s pecificity of in-house anti-rhbdd1 mouse monoclonal antibody. (a) The specificity of the anti-rhbdd1 monoclonal
More informationProtocol Using the Reprogramming Ecotropic Retrovirus Set: Mouse OSKM to Reprogram MEFs into ips Cells
STEMGENT Page 1 OVERVIEW The following protocol describes the reprogramming of one well of mouse embryonic fibroblast (MEF) cells into induced pluripotent stem (ips) cells in a 6-well format. Transduction
More informationRNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by. 5 AGACACAAACACCAUUGUCACACUCCACAGC; Rand-2 OMe,
Materials and methods Oligonucleotides and DNA constructs RNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by Dharmacon Inc. (Lafayette, CO). The sequences were: 122-2 OMe, 5
More informationSupplementary figures
Relative intensity Relative intensity Relative intensity Supplementary figures a None Caffeine None Caffeine c None Caffeine 6 6 6 ISG 6 6 6 UBE1L 6 6 6 UBCH8 6 6 6 EFP 1 1 DOX (h) 1 1 CPT (h) 1 1 UV (h)
More informationSupplementary Figure 1. The chemical structure of compound A. Compound A has an amino terminal methyl alanine and compound B has an
Supplemental Data IAP Antagonists Target ciap1 to Induce TNFα-Dependent Apoptosis James E. Vince, W. Wei-Lynn Wong, Nufail Khan, Rebecca Feltham, Diep Chau, Afsar U. Ahmed, Christopher A. Benetatos, Srinivas
More informationTITLE: Targeted Elimination of PCDH-PC Expressing Prostate Cancer Cells for Control of Hormone-Resistant Prostate Cancer
AD Award Number: W81XWH-06-01-0061 TITLE: Targeted Elimination of PCDH-PC Expressing Prostate Cancer Cells for Control of Hormone-Resistant Prostate Cancer PRINCIPAL INVESTIGATOR: Ralph Buttyan, Ph.D.
More informationMCB 4211, Fall 2018, Practice Exam 1 Last, First name Student ID # Seat No. ***NOTE: Exam will have 40 multiple choice questions.
MCB 4211, Fall 2018, Practice Exam 1 Last, First name Student ID # Seat No. ***NOTE: Exam 1 2018 will have 40 multiple choice questions. READ ALL THE CHOICES AND SELECT THE BEST 1. Which of the following
More informationa. Hypoxanthine was present in the media. MCB 4211, Fall 2018, Practice Exam 1 Last, First name Student ID # Seat No.
MCB 4211, Fall 2018, Practice Exam 1 Last, First name Student ID # Seat No. ***NOTE: Exam 1 2018 will have 40 multiple choice questions. READ ALL THE CHOICES AND SELECT THE BEST 1. Which of the following
More informationSUPPLEMENTARY INFORMATION FIGURE LEGENDS
SUPPLEMENTARY INFORMATION FIGURE LEGENDS Fig. S1. Radiation-induced phosphorylation of Rad50 at a specific site. A. Rad50 is an in vitro substrate for ATM. A series of Rad50-GSTs covering the entire molecule
More informationSupplementary information
Supplementary information The E3 ligase RNF8 regulates KU80 removal and NHEJ repair Lin Feng 1, Junjie Chen 1 1 Department of Experimental Radiation Oncology, The University of Texas M. D. Anderson Cancer
More informationData Sheet. Hedgehog Signaling Pathway Gli Reporter NIH3T3 Cell Line Catalog #: 60409
Data Sheet Hedgehog Signaling Pathway Gli Reporter NIH3T3 Cell Line Catalog #: 60409 Product Description The Gli Reporter NIH3T3 Cell Line is designed for monitoring the activity of the hedgehog signaling
More informationData Sheet. Hedgehog Signaling Pathway Gli Reporter NIH3T3 Cell Line Catalog #: 60409
Data Sheet Hedgehog Signaling Pathway Gli Reporter NIH3T3 Cell Line Catalog #: 60409 Product Description The Gli Reporter NIH3T3 Cell Line is designed for monitoring the activity of the hedgehog signaling
More information