Table S1. List of primers used in this study
|
|
|
- Aileen Hensley
- 6 years ago
- Views:
Transcription
1 Table S1. List of primers used in this study Name KanMx-F2 KanMx-A2 FEN1-DG-S FEN1-DG-A SUR4-DG-S SUR4-DG-A CaARG4-R1130 CaARG4-F61 CaHIS1-DR CaHIS1-ter CaFEN1-US1 CaFEN1-UA1 CaFEN1-DS2 CaFEN1-DA2 CaFEN1-DG-S CaFEN1-DG-R1 CaFEN12-US1 CaFEN12-UA1 CaFEN12-DS2 CaFEN12-DA2 Sequence (5-3 ) a CTATGGAACTGCCTCGGTG TTGATGGTCGGAAGAGGC GTTGGTGAAACTCTCGAGC GCGCTAAAATAACGCCAG TTACGCATTTGGCTTGTC TCGTGGCAAGTAAAGTGG GCCAACATATCCATAGTTAAAGC GGTGCCACTGATCCATTG AACTTCTGTCTCCTCATCCTCC CTACCACCTTGATGTACACACC CAATCATCGCACATAAAACC GACCTGCAGCGTACGAAGATACTTGTGGGAACTCAGTTGG CTCGAATTCATCGATGATATCAGAGAGAGGTATGACGGTTGTTG GGTGATACATTTTTCGGAG CTCAATAGTCATCGACACG GTGGTAGTCAAACCACTCCAC ATAATGGAAGAGGGAAGGC GACCTGCAGCGTACGAAGGTAAAAGAAATTGCAGACCAG CTCGAATTCATCGATGATATCAGACCAACCATGTCAAGATGAG GTCATGTAGTTCCTGCTACC
2 CaFEN12-DG-S GAAGGATATGGAACATTCG CaFEN12-DG-R1 TCCATACTGCTCATGTTGAAG a Underlined sequences are homologous to HAH2 cassette for fusion of PCR amplified upstream or downstream flanking regions to HAH2.
3 Fig. S1. Diagnostic PCR to confirm deletion of FEN1 gene in putative deletant obtained from Euroscarf. Primers specific to regions flanking deleted FEN1 ORF were used in combination with primers specific for KanMX deletion cassette. The size of the PCR products obtained with forward primer (FEN1-DG-S) upstream of deleted FEN1 ORF and reverse primer from KanMX cassette (KanMx-A2), and forward primer of KanMX cassette (KanMx-F2) and reverse primer (FEN1-DG-A) downstream of deleted FEN1 ORF are comparable to the expected size of the PCR products, i.e., 1039 bp and 690 bp respectively, confirming the strain as true deletant of FEN1 gene.
4 Fig. S2. Diagnostic PCRs to confirm deletion of SUR4 gene in putative deletant obtained from Euroscarf. Primers specific to regions flanking deleted SUR4 ORF were used in combination with primers specific for KanMX deletion cassette. The size of the PCR products obtained with forward primer (SUR4-DG-S) upstream of deleted SUR4 ORF and reverse primer from kanamycin cassette (KanMx-A2 ), and forward primer from kanamycin cassette (KanMx-F2) and reverse primer (SUR4-DG-A) downstream of deleted SUR4 ORF are comparable to expected size of products, i.e., 938 bp and 738 bp, respectively, confirming the strain as true deletant of SUR4 gene.
5 Fig. S3. Deletion of both alleles of a target gene after a single transformation with HAH2 cassette. As is seen with UAU1 cassette, as much as half of the Arg + His + segregants can retain a wild-type copy of the target gene, besides the two deleted alleles, e.g, due to trisomy. Such undesired segregants have to be identified by diagnostic PCR and discarded. If the target gene is essential, then all the segregants will retain a wild-type copy of the gene.
6 Fig. S4. Eviction of HAH2 and HIS1 markers by recombination between LoxLE and LoxRE sites (depicted as red boxes) by Cre recombinase.
7 Fig. S5. Sequence of the CaFEN1 locus after eviction of markers by recombination at LoxLE and LoxRE. The complete ORF including 130bp upstream of start codon and 25bp downstream of stop codon has been deleted. The deleted region was PCR amplified with flanking primers (CaFEN1-DG-S and CaFEN1- DG-R1), and sequenced (with primer CaFEN1-DG-R1). The orange bar indicates the sequence of the scar left behind after the recombination, which includes the recombined LoxLE/RE (red bar) and the flanking primer binding regions from HAH2. Rest of the sequence corresponds to the upstream and downstream regions of CaFEN1
8 Fig. S6. Sequence of the CaFEN12 locus after eviction of markers by recombination at LoxLE and LoxRE. The complete ORF including 84bp upstream of start codon and 15bp downstream of stop codon has been deleted. The deleted region was PCR amplified with flanking primers (CaFEN12-DG-S and CaFEN12-DG-R1) and sequenced (with primer CaFEN12-DG-R1). The orange bar indicates the sequence of the scar left behind after the recombination, which includes the recombined LoxLE/RE (red bar) and the flanking primer binding regions from HAH2. Rest of the sequence corresponds to the upstream and downstream regions of CaFEN12
Construct Design and Cloning Guide for Cas9-triggered homologous recombination
Construct Design and Cloning Guide for Cas9-triggered homologous recombination Written by Dan Dickinson (ddickins@live.unc.edu) and last updated December 2013. Reference: Dickinson DJ, Ward JD, Reiner
Supporting Information
Supporting Information Kilian et al. 10.1073/pnas.1105861108 SI Materials and Methods Determination of the Electric Field Strength Required for Successful Electroporation. The transformation construct
Schematic representation of the endogenous PALB2 locus and gene-disruption constructs
Supplementary Figures Supplementary Figure 1. Generation of PALB2 -/- and BRCA2 -/- /PALB2 -/- DT40 cells. (A) Schematic representation of the endogenous PALB2 locus and gene-disruption constructs carrying
Supplemental Fig. S1. Key to underlines: Key to amino acids:
AspA-F1 AspA 1 MKQMETKGYGYFRKTKAYGLVCGIT--------------LAGALTLGTTSVSADDVTTLNPATNLTTLQTPPTADQTQLAHQAGQQSGELVSEVSNTEWD 86 SspB 1 MQKREV--FG-FRKSKVAKTLCGAV-LGAALIAIADQQVLADEVTETNSTANVAVTTTGNPATNLPEAQGEATEAASQSQAQAGSKDGALPVEVSADDLN
Simple Deletion: a vector- and marker-free method to generate and isolate site-directed
Electronic supplementary materials Simple Deletion: a vector- and marker-free method to generate and isolate site-directed deletion mutants Yasuhiro Inoue 1, Seiji Tsuge 2 1 National Agriculture and Food
amplification of the 5 flanking region of CAT1 with a tail for the geneticin resistance gene cassette fusion CAT1-3F
Supplementary materials Table S1. Primer list. Primer Sequence a (5-3 ) Description CAT1-5F CAT1-5R ATACGGATAAGGAAGCGATAGCAGCA gcacaggtacacttgtttagagagcgatccggattttaagtgaacg amplification of the 5 flanking
A Low salt diet. C Low salt diet + mf4-31c1 3. D High salt diet + mf4-31c1 3. B High salt diet
A Low salt diet GV [AU]:. [mmhg]: 0..... 09 9 7 B High salt diet GV [AU]:. [mmhg]: 7 8...0. 7.8 8.. 0 8 7 C Low salt diet + mf-c GV [AU]:. [mmhg]:.0.9 8.7.7. 7 8 0 D High salt diet + mf-c E Lymph capillary
TRANSGENIC ANIMALS. -transient transfection of cells -stable transfection of cells. - Two methods to produce transgenic animals:
TRANSGENIC ANIMALS -transient transfection of cells -stable transfection of cells - Two methods to produce transgenic animals: 1- DNA microinjection - random insertion 2- embryonic stem cell-mediated gene
Supplementary Figures and Figure legends
Supplementary Figures and Figure legends 3 Supplementary Figure 1. Conditional targeting construct for the murine Satb1 locus with a modified FLEX switch. Schematic of the wild type Satb1 locus; the conditional
Use of In-Fusion Cloning for Simple and Efficient Assembly of Gene Constructs No restriction enzymes or ligation reactions necessary
No restriction enzymes or ligation reactions necessary Background The creation of genetic circuits and artificial biological systems typically involves the use of modular genetic components biological
Historical Perspective
Genetic transformation of E.Coli and selection, DNA recombination without ligase: topoisomerase, cre-lox recombination, Gate way method etc. DNA library: genomic library, cdna library, expression library,
SUPPLEMENTARY INFORMATION
AS-NMD modulates FLM-dependent thermosensory flowering response in Arabidopsis NATURE PLANTS www.nature.com/natureplants 1 Supplementary Figure 1. Genomic sequence of FLM along with the splice sites. Sequencing
File name: Supplementary Information. Description: Supplementary Figures, Supplementary Tables and Supplementary References.
1 2 File name: Supplementary Information Description: Supplementary Figures, Supplementary Tables and Supplementary References. 3 1 4 Supplementary Figures 5 6 7 Figure S1 Comparison of the One-Step-Assembly
Analysis of gene function
Genome 371, 22 February 2010, Lecture 12 Analysis of gene function Gene knockouts PHASE TWO: INTERPRETATION I THINK I FOUND A CORNER PIECE. 3 BILLION PIECES Analysis of a disease gene Gene knockout or
Phenotype test of metk modification:
Figure S1 Phenotype test of metk modification: Strain with metk replaced by SAM transporter could grow on LB medium with SAM added, and could not grow on LB medium without SAM added. Beginning strain MG1655
Hernday Lab C. albicans CRISPR System Background:
Hernday Lab C. albicans CRISPR System Background: This document covers the plasmids and protocols used for the Hernday lab Candida albicans CRISPR system. This system allows the user to edit virtually
SUPPLEMENTARY INFORMATION
Gene replacements and insertions in rice by intron targeting using CRISPR Cas9 Table of Contents Supplementary Figure 1. sgrna-induced targeted mutations in the OsEPSPS gene in rice protoplasts. Supplementary
Supplementary material
Supplementary material Δ10(E)-Sphingolipid Desaturase Involved in Fusaruside Mycosynthesis and Stress Adaptation in Fusarium graminearum Yuan Tian, Guo Y. Zhao, Wei Fang, Qiang Xu, and Ren X. Tan * Institute
In this protocol, DNA Strider for Mac is used for demonstration. The design of oligos for deleting Adephagia gp73 is used as an example.
Phagehunting Program Designing Oligos for BRED Gene Deletion OBJECTIVE BACKGROUND To design oligonucleotides for gene deletion with BRED. Bacteriophage recombineering with electroporated DNA (BRED) a system
Easi CRISPR for conditional and insertional alleles
Easi CRISPR for conditional and insertional alleles C.B Gurumurthy, University Of Nebraska Medical Center Omaha, NE cgurumurthy@unmc.edu Types of Genome edits Gene disruption/inactivation Types of Genome
Functional Genomics Research Stream. Research Meeting: June 5, 2012 Summer Goals
Functional Genomics Research Stream Research Meeting: June 5, 2012 Summer Goals Meetings Tuesdays - NHB 3.202 June 5 through July 24 Required 3:00pm to 4:30pm Alternate - TBA Expectations Respect hourly
Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of
Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of xylose, inducing expression of gfp-tola, localization
Melton, D.W. (1994) Gene targeting in the mouse. Bioessays 16:633-8
Reverse genetics - Knockouts Paper to read for this section : Melton, D.W. (1994) Gene targeting in the mouse. Bioessays 16:633-8 Up until now, we ve concentrated on ways to get a cloned gene. We ve seen
The RRPA knock-in allele was generated by homologous recombination in TC1 ES cells.
Supplemental Materials Materials & Methods Generation of RRPA and RAPA Knock-in Mice The RRPA knock-in allele was generated by homologous recombination in TC1 ES cells. Targeted ES clones in which the
Using mutants to clone genes
Using mutants to clone genes Objectives 1. What is positional cloning? 2. What is insertional tagging? 3. How can one confirm that the gene cloned is the same one that is mutated to give the phenotype
Supplementary Figure 1 Generation of migg1-yf mice. (A) Targeting strategy. Upper panel: schematic organization of the murine ɣ1 immunoglobulin
Supplementary Figure 1 Generation of migg1-yf mice. (A) Targeting strategy. Upper panel: schematic organization of the murine ɣ1 immunoglobulin locus. The EcoRI restriction site between exons M1 and M2
Shah, N.R., et al., Supplemental Data SUPPLEMENTAL TEXT. Cloning:
Shah, N.R., et al., Supplemental Data SUPPLEMENTAL TEXT Cloning: pnmlgmab: the region containing lgma,lgmb, and the intergenic region upstream of lgma was amplified by PCR using genomic DNA of B. pertussis
Supplemental Data Genetic and Epigenetic Regulation of the FLO Gene Family Generates Cell-Surface Variation in Yeast
Supplemental Data Genetic and Epigenetic Regulation of the FLO Gene Family Generates Cell-Surface Variation in Yeast S1 Adrian Halme, Stacie Bumgarner, Cora Styles and Gerald R. Fink Yeast Strain Construction
To investigate the heredity of the WFP gene, we selected plants that were homozygous
Supplementary information Supplementary Note ST-12 WFP allele is semi-dominant To investigate the heredity of the WFP gene, we selected plants that were homozygous for chromosome 1 of Nipponbare and heterozygous
Using mutants to clone genes
Using mutants to clone genes Objectives: 1. What is positional cloning? 2. What is insertional tagging? 3. How can one confirm that the gene cloned is the same one that is mutated to give the phenotype
The plasmid for the HLY production was constructed by using the MutliSite Gateway TM
Supplementary methods and table The plasmid for the HLY production 1 1 1 The plasmid for the HLY production was constructed by using the MutliSite Gateway TM system (Mabashi et al. 00). The HLY gene was
Name Order # 1234 Company Received 03/15/16 Reported 03/16/16. Sample
Well Name Order # 1234 Company Received 03/15/16 E-Mail Reported 03/16/16 Strain Name Sample Name Flp Cyp2r 1 Cre A1 Strain A 1 Wild Het A2 Strain A 2 Wild Het A3 Strain A 3 Wild Het A4 Strain A 4 Wild
Ramp1 EPD0843_4_B11. EUCOMM/KOMP-CSD Knockout-First Genotyping
EUCOMM/KOMP-CSD Knockout-First Genotyping Introduction The majority of animals produced from the EUCOMM/KOMP-CSD ES cell resource contain the Knockout-First-Reporter Tagged Insertion allele. As well as
Usp14 EPD0582_2_G09. EUCOMM/KOMP-CSD Knockout-First Genotyping
EUCOMM/KOMP-CSD Knockout-First Genotyping Introduction The majority of animals produced from the EUCOMM/KOMP-CSD ES cell resource contain the Knockout-First-Reporter Tagged Insertion allele. As well as
R1 12 kb R1 4 kb R1. R1 10 kb R1 2 kb R1 4 kb R1
Bcor101 Sample questions Midterm 3 1. The maps of the sites for restriction enzyme EcoR1 (R1) in the wild type and mutated cystic fibrosis genes are shown below: Wild Type R1 12 kb R1 4 kb R1 _ _ CF probe
Enzyme that uses RNA as a template to synthesize a complementary DNA
Biology 105: Introduction to Genetics PRACTICE FINAL EXAM 2006 Part I: Definitions Homology: Comparison of two or more protein or DNA sequence to ascertain similarities in sequences. If two genes have
Designing and creating your gene knockout Background The rada gene was identified as a gene, that when mutated, caused cells to become hypersensitive
Designing and creating your gene knockout Background The rada gene was identified as a gene, that when mutated, caused cells to become hypersensitive to ionizing radiation. However, why these mutants are
CHAPTER FOUR. Characterization of parasporal genes in. Paenibacillus popilliae and Paenibacillus lentimorbus. Abstract
CHAPTER FOUR Characterization of parasporal genes in Paenibacillus popilliae and Paenibacillus lentimorbus Abstract The parasporal gene, cry18aa1, was cloned and sequenced by Zhang et al. (4) from the
Supplementary Information
Supplementary Information MicroRNA-212/132 family is required for epithelial stromal interactions necessary for mouse mammary gland development Ahmet Ucar, Vida Vafaizadeh, Hubertus Jarry, Jan Fiedler,
Allele-specific locus binding and genome editing by CRISPR at the
Supplementary Information Allele-specific locus binding and genome editing by CRISPR at the p6ink4a locus Toshitsugu Fujita, Miyuki Yuno, and Hodaka Fujii Supplementary Figure Legends Supplementary Figure
BurrH: a new modular DNA binding protein for genome engineering
Supplementary information for: BurrH: a new modular protein for genome engineering Alexandre Juillerat, Claudia Bertonati, Gwendoline Dubois, Valérie Guyot, Séverine Thomas, Julien Valton, Marine Beurdeley,
Supplementary Figure 1 An overview of pirna biogenesis during fetal mouse reprogramming. (a) (b)
Supplementary Figure 1 An overview of pirna biogenesis during fetal mouse reprogramming. (a) A schematic overview of the production and amplification of a single pirna from a transposon transcript. The
Protocol for cloning SEC-based repair templates using Gibson assembly and ccdb negative selection
Protocol for cloning SEC-based repair templates using Gibson assembly and ccdb negative selection Written by Dan Dickinson (daniel.dickinson@austin.utexas.edu) and last updated January 2018. A version
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Genome-scale engineering of Saccharomyces cerevisiae with single nucleotide precision Zehua Bao, 1 Mohammad HamediRad, 2 Pu Xue, 2 Han Xiao, 1,7 Ipek Tasan, 3 Ran Chao, 2 Jing
Nature Biotechnology: doi: /nbt.4166
Supplementary Figure 1 Validation of correct targeting at targeted locus. (a) by immunofluorescence staining of 2C-HR-CRISPR microinjected embryos cultured to the blastocyst stage. Embryos were stained
Noncrossovers at the Psmb9 hotspot in B10.A SGR hybrids determined by analysis of DNA isolated from ovaries and sperm, respectively.
Supplementary Figure 1 s at the Psmb9 hotspot in B1.A SGR hybrids determined by analysis of DNA isolated from ovaries and sperm, respectively. s were identified on the B1.A chromosome at the seven queried
Recombinant DNA Libraries and Forensics
MIT Department of Biology 7.014 Introductory Biology, Spring 2005 A. Library construction Recombinant DNA Libraries and Forensics Recitation Section 18 Answer Key April 13-14, 2005 Recall that earlier
Nature Genetics: doi: /ng Supplementary Figure 1. ChIP-seq genome browser views of BRM occupancy at previously identified BRM targets.
Supplementary Figure 1 ChIP-seq genome browser views of BRM occupancy at previously identified BRM targets. Gene structures are shown underneath each panel. Supplementary Figure 2 pref6::ref6-gfp complements
Supplementary Information for:
Supplementary Information for: An Orthogonal DNA Replication System in Yeast Arjun Ravikumar 1, Adrian Arrieta 1, Chang C. Liu 1,2,3,* 1 Department of Biomedical Engineering, University of California,
Nature Genetics: doi: /ng Supplementary Figure 1
Supplementary Figure 1 Ihh interacts preferentially with its upstream neighboring gene Nhej1. Genes are indicated by gray lines, and Ihh and Nhej1 are highlighted in blue. 4C seq performed in E14.5 limbs
Supplementary Material for StairSTEPS Manuscript
Supplementary Material for StairSTEPS Manuscript S1. Supplementary Materials and Methods S1.1 Plasmid vector construction All plasmids for expression of dcas9 were derived from the pjed103 vector series
ksierzputowska.com Research Title: Using novel TALEN technology to engineer precise mutations in the genome of D. melanogaster
Research Title: Using novel TALEN technology to engineer precise mutations in the genome of D. melanogaster Research plan: Specific aims: 1. To successfully engineer transgenic Drosophila expressing TALENs
MUTANT: A mutant is a strain that has suffered a mutation and exhibits a different phenotype from the parental strain.
OUTLINE OF GENETICS LECTURE #1 A. TERMS PHENOTYPE: Phenotype refers to the observable properties of an organism, such as morphology, growth rate, ability to grow under different conditions or media. For
amplify the conditional allele (2-lox) and recombined allele (1-lox) following tamoxifen
Supplementary data Supplementary Table 1. Real-time PCR primer sequences Supplementary Fig. 1. (A) Genomic map of the Vhl (2-lox) conditional allele. Numbered boxes represent exon 1, which is targeted
SUPPLEMENTAL MATERIAL
SUPPLEMENTAL MATERIAL MATERIALS AND METHODS Generation of TSPOΔ/Δ murine embryonic fibroblasts Embryos were harvested from 13.5-day pregnant TSPOfl/fl mice. After dissection to eviscerate and remove the
Molecular Biology Techniques Supporting IBBE
Molecular Biology Techniques Supporting IBBE Jared Cartwright Protein Production Lab Head Contact Details: email jared.cartwright@york.ac.uk Phone 01904 328797 Presentation Aims Gene synthesis Cloning
SUPPLEMENTARY INFORMATION SUPPLEMENTARY FIGURES
SUPPLEMENTARY INFORMATION SUPPLEMENTARY FIGURES Supplementary Figure 1. Generation of inducible BICD2 knock-out mice. A) The mouse BICD2 locus and gene targeting constructs. To generate an inducible Bicd2
Functional complementation in Saccharomyces cerevisiae under control of the natural yeast promoter
Electronic Journal of Biotechnology ISSN: 0717-3458 Vol.10 No.2, Issue of April 15, 2007 2007 by Pontificia Universidad Católica de Valparaíso -- Chile Received August 16, 2006 / Accepted December 20,
BRED: Bacteriophage Recombineering with Electroporated DNA
Phagehunting Program BRED: Bacteriophage Recombineering with Electroporated DNA Introduction We have developed a system for generating mutations in lytically replicating mycobacteriophages that we have
Required Reading. Functional Genomics Research Stream. Pay Attention III III
Required Reading Functional Genomics Research Stream Research Meeting: March 1, 2011 PCR Mediated Gene Deletion, Transformation of Yeast Screening for Gene Deletions by PCR Genomics Research Agenda Pay
CGAGACCTTGTCACATTGGCGTCAACTC hoga Down GATGCCTCCTGTCAAGATTGCAATGAAC
Supplemental Table 1. PCR and qrt-pcr primers used in this study Primer designation Oligonucleotide sequence (5-3 ) PCR primers 5 SphI hoga GCATGCGAAGACTGATTCAGATAATTAGTTC 5 SalI hoga GTCGACCTGATGATCTCCACTGTCTGAAC
Supporting Information
Supporting Information Park et al. 10.1073/pnas.1410555111 5 -TCAAGTCCATCTACATGGCC-3 5 -CAGCTGCCCGGCTACTACTA-3 5 -TGCAGCTGCCCGGCTACTAC-3 5 -AAGCTGGACATCACCTCCCA-3 5 -TGACAGGAACACCTACAAGT-3 5 -AAGGCACCTTTCTGTCTCCA-3
pri 201 DNA Series (High-Expression Vectors for Plant Transformation)
For Research Use Cat #. 3264 3265 3266 3267 pri 201 DNA Series (High-Expression Vectors for Plant Transformation) Product Manual Table of Contents I. Description... 3 II. Product Information... 3 III.
SUPPLEMENTARY INFORMATION
doi: 10.1038/nature06403 Supplementary Information: Nanog safeguards pluripotency and mediates germline development Supplementary Tables SUPPLEMENTARY INFORMATION mrna Forward primer Reverse primer Annealing
Supplemental Material. Supplemental Tables. Table S1. Strains used in this study.
Supplemental Material Supplemental Tables Table S1. Strains used in this study. Strain Genotype Reference E. coli strains S17-1λpir Wild-type (1) BL21(DE3) Wild-type Life Technologies DH10B Wild-type Life
Problem Set 4
7.016- Problem Set 4 Question 1 Arginine biosynthesis is an example of multi-step biochemical pathway where each step is catalyzed by a specific enzyme (E1, E2 and E3) as is outlined below. E1 E2 E3 A
Map-Based Cloning of Qualitative Plant Genes
Map-Based Cloning of Qualitative Plant Genes Map-based cloning using the genetic relationship between a gene and a marker as the basis for beginning a search for a gene Chromosome walking moving toward
Revised: RG-RV2 by Fukuhara et al.
Supplemental Figure 1 The generation of Spns2 conditional knockout mice. (A) Schematic representation of the wild type Spns2 locus (Spns2 + ), the targeted allele, the floxed allele (Spns2 f ) and the
Regulation of ARE transcript 3 end processing by the. yeast Cth2 mrna decay factor
Regulation of ARE transcript 3 end processing by the yeast Cth2 mrna decay factor Manoël Prouteau, Marie-Claire Daugeron and Bertrand Séraphin Supplementary Information Material and Methods Plasmid construction
File S1. Detailed protocol for CRISPR/Cas9 mediated genome editing with dual marker cassettes
File S1 Detailed protocol for CRISPR/Cas9 mediated genome editing with dual marker cassettes A) Preparing sgrna vectors We ve modified the strategy to create new sgrna vectors starting with the klp 12
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature09937 a Name Position Primersets 1a 1b 2 3 4 b2 Phenotype Genotype b Primerset 1a D T C R I E 10000 8000 6000 5000 4000 3000 2500 2000 1500 1000 800 Donor (D)
A universal chassis plasmid pwh34 was first constructed to facilitate the
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 File name: Supplementary method Plasmids construction A universal chassis plasmid pwh34 was first constructed to facilitate the construction
Expanded View Figures
Molecular Systems iology Pooled-matri interaction maps via arcode Fusion Nozomu Yachie et al Epanded View Figures O59 O6 O61 O62 O63 O64 O65 O66 ait-c1 ait-c2 Prey-C1 Prey-C2 In-yeast assembly En masse
Mcbio 316: Exam 3. (10) 2. Compare and contrast operon vs gene fusions.
Mcbio 316: Exam 3 Name (15) 1. Transposons provide useful tools for genetic analysis. List 5 different uses of transposon insertions. ANSWER: Many answers are possible, however, if multiple items on the
PBG 430/530 Exam
1 PBG 430/530 Exam 2 2013 1. In a deoxyribonucleotide, 5 and 3 refer to the a. start site for transcription. b. start site for translation. c. carbons where (respectively) the phosphate and hydroxyl groups
T H E J O U R N A L O F C E L L B I O L O G Y
Supplemental material Wang et al., http://www.jcb.org/cgi/content/full/jcb.201405026/dc1 T H E J O U R N A L O F C E L L B I O L O G Y Figure S1. Generation and characterization of unc-40 alleles. (A and
Percent survival. Supplementary fig. S3 A.
Supplementary fig. S3 A. B. 100 Percent survival 80 60 40 20 Ml 0 0 100 C. Fig. S3 Comparison of leukaemia incidence rate in the triple targeted chimaeric mice and germline-transmission translocator mice
Capsule deletion via a λ-red knockout system perturbs biofilm formation and fimbriae expression in Klebsiella pneumoniae MGH
Capsule deletion via a λ-red knockout system perturbs biofilm formation and fimbriae expression in Klebsiella pneumoniae MGH 78578 Tzu-Wen Huang 1,2, Irene Lam 2, Hwan-You Chang 3, Shih-Feng Tsai 1, Bernhard
Large scale genome editing for. Senior Scientist, GenScript
Large scale genome editing for metabolic engineering of E. coli YifanLi Li, Ph.D PhD Senior Scientist, GenScript Metabolic engineering Cell factory Remove inhibition Substrate Overexpressing pathway genes
Phenotype analysis: biological-biochemical analysis. Genotype analysis: molecular and physical analysis
1 Genetic Analysis Phenotype analysis: biological-biochemical analysis Behaviour under specific environmental conditions Behaviour of specific genetic configurations Behaviour of progeny in crosses - Genotype
FtsEX is required for CwlO peptidoglycan hydrolase activity during cell wall elongation in Bacillus subtilis
FtsEX is required for CwlO peptidoglycan hydrolase activity during cell wall elongation in Bacillus subtilis Jeffrey Meisner, Paula Montero Llopis, Lok-To Sham, Ethan Garner, Thomas G. Bernhardt, David
Generation of Non-typeable Haemophilus influenzae Directed Gene Deletion Mutants Jeroen D. Langereis *
Generation of Non-typeable Haemophilus influenzae Directed Gene Deletion Mutants Jeroen D. Langereis * Laboratory of Pediatric Infectious Diseases, Department of Pediatrics and Laboratory of Medical Immunology,
Effect of Genomic Integration Location on Heterologous Protein. Expression and Metabolic Engineering in E. coli. Supporting Information
Effect of Genomic Integration Location on Heterologous Protein Expression and Metabolic Engineering in E. coli. Supporting Information Supporting Figures Table S1. DNA primers used in this study Number
Donor DNA Utilization during Gene Targeting with Zinc- finger Nucleases
Donor DNA Utilization during Gene Targeting with Zinc- finger Nucleases Kelly J. Beumer, Jonathan K. Trautman, Kusumika Mukherjee and Dana Carroll Department of Biochemistry University of Utah School of
beta-galactosidase (A420) ctrl
0.6 beta-galactosidase (A420) 0.4 0.2 ctrl 2A 22A 35B 36B 58A 64A 68E 75C 86Fa 86Fb 102F Fig. S1. Levels of induced expression at various attp sites. The induced β-galactosidase activity was measured from
Supplemental Figure Legends
Supplemental Figure Legends Fig. S1 Genetic linkage maps of T. gondii chromosomes using F1 progeny from the ME49 and VAND genetic cross. All the recombination points were identified by whole genome sequencing
Table S1. Primers and PCR digestion schemes used in this study
Table S1. Primers and schemes used in this study PS locus promoter region Primer sequence (5-3 ) Product size (bp) Enzyme Fragment sizes (bp) when promoter is on off psa TGTGTAAATGATAGGAGGCTAGGG GTTGACGGAAATGATCGGTATAG
Abcam.com. hutton.ac.uk. Ipmdss.dk. Bo Gong and Eva Chou
Abcam.com Bo Gong and Eva Chou Ipmdss.dk hutton.ac.uk What is a homeotic gene? A gene which regulates the developmental fate of anatomical structures in an organism Why study them? Understand the underlying
A novel tool for monitoring endogenous alpha-synuclein transcription by NanoLuciferase
A novel tool for monitoring endogenous alpha-synuclein transcription by NanoLuciferase tag insertion at the 3 end using CRISPR-Cas9 genome editing technique Sambuddha Basu 1, 3, Levi Adams 1, 3, Subhrangshu
Phenotype analysis: biological-biochemical analysis. Genotype analysis: molecular and physical analysis
1 Genetic Analysis Phenotype analysis: biological-biochemical analysis Behaviour under specific environmental conditions Behaviour of specific genetic configurations Behaviour of progeny in crosses - Genotype
Cassette denotes the ORFs expressed by the expression cassette targeted by the PCR primers used to
Stanyon, C.A., Limjindaporn, T., and Finley, Jr., R.L. Simultaneous transfer of open reading frames into several different expression vectors. Biotechniques, 35, 520-536, 2003. http://www.biotechniques.com
Western blot showing expression of mutant Sec63p. The strains used in Figure 7 were treated
Supplemntary figure legend Western blot showing expression of mutant Sec63p. The strains used in Figure 7 were treated with methionine to repress transcription of genomic SEC63, and total protein extracts
Δsig. ywa. yjbm. rela -re. rela
A wt A. A, P rela -re la A/Δ yjbm A/Δ ywa C A, P hy-s igd, D (A, P IPTG hy-s igd, ) D D (+ IPTG ) D/Δ rela Figure S1 SigD B. Figure S1. SigD levels and swimming motility in (p)ppgpp synthetase mutants.
*** *** * *** *** *** * *** ** ***
Figure S: OsMADS6 over- or down-expression is stable across generations A, OsMADS6 expression in overexpressing (OX, OX, dark bars) and corresponding control (OX, WT, white bars) T4 plants. B, OsMADS6
Problem Set 8. Answer Key
MCB 102 University of California, Berkeley August 11, 2009 Isabelle Philipp Online Document Problem Set 8 Answer Key 1. The Genetic Code (a) Are all amino acids encoded by the same number of codons? no
Supporting information
Supporting information Construction of strains and plasmids To create ptc67, a PCR product obtained with primers cc2570-162f (gcatgggcaagcttgaggacggcgtcatgt) and cc2570+512f (gaggccgtggtaccatagaggcgggcg),
B. Transgenic plants with strong phenotype (%)
A. TCTAGTTGTTGTTGTTATGGTCTAGTTGTTGTTGTTATGGTCTAATTT AAATATGGTCTAAAGAAGAAGAATATGGTCTAAAGAAGAAGAATATGG 2XP35S STTM165 5 GGGGGATGAAGctaCCTGGTCCGA3 3 CCCCCUACUUC---GGACCAGGCU5 mir165 HindIII mir165 96 nt GTTGTTGTTGTTATGGTCTAGTTGTTGTTGTTATGGTCTAATTT
Supplementary Information
Supplementary Information Vidigal and Ventura a wt locus 5 region 3 region CCTCTGCCACTGCGAGGGCGTCCAATGGTGCTTG(...)AACAGGTGGAATATCCCTACTCTA predicted deletion clone 1 clone 2 clone 3 CCTCTGCCACTGCGAGGGCGTC-AGGTGGAATATCCCTACTCTA
Different Upstream Activators Stimulate Transcription Through Distinct Coactivator Complexes
Supplemental Material for Different Upstream Activators Stimulate Transcription Through Distinct Coactivator Complexes Dong-ki Lee, Soyoun Kim, and John T. Lis Due to be published as a Research Communication
Title. So, JCC; Chan, AYY; Ma, ESK. Citation Hemoglobin, 2014, v. 38 n. 3, p Issued Date
Title Novel point mutation of the α2-globin gene (HBA2) and a rare 2.4kb deletion of the α1-globin gene (HBA1), identified in two chinese patients with Hb H disease Author(s) So, JCC; Chan, AYY; Ma, ESK