Polypeptide backbone (or the main chain)

Size: px
Start display at page:

Download "Polypeptide backbone (or the main chain)"

Transcription

1 Polypeptide backbone (or the main chain) [IUPA-IUB ommission on Biochemical omenclature, Abbreviations and Symbols for the Description of the onfor mation of Polypeptide hains. Eur. J. Biochem., 969, 7, 93-2] Graham Kemp, halmers University of Technology

2 Dihedral angle A D B Graham Kemp, halmers University of Technology

3 Ramachandran steric map [o, K.., Thomas, A. and Brasseur, R., Protein Science, 23, 2: ] Graham Kemp, halmers University of Technology

4 Protein Data Bank entry (extract) MPD TRISE PSPATE ISMERASE (E ) SURE IKE (GALLUS GALLUS) BREAST MUSLE AUTR D.W.BAER,A..BLMER,G.A.PETSK,D..PILLIPS, AUTR 2 I.A.WILS : JRL AUT D.W.BAER,A..BLMER,G.A.PETSK,D..PILLIPS, JRL AUT 2 I.A.WILS JRL TITL ATMI RDIATES FR TRISE PSPATE ISMERASE JRL TITL 2 FRM IKE MUSLE JRL REF BIEM.BIPYS.RES.MM. V JRL REF ASTM BBRA9 US ISS 6-29X 46 : REMARK 2 RESLUTI. 2.5 AGSTRMS. : SEQRES A 247 ALA PR ARG LYS PE PE VAL GLY GLY AS TRP LYS MET SEQRES 2 A 247 AS GLY LYS ARG LYS SER LEU GLY GLU LEU ILE IS TR : ATM ALA A ATM 2 A ALA A ATM 3 ALA A ATM 4 ALA A ATM 5 B ALA A ATM 6 PR A ATM 7 A PR A ATM 8 PR A ATM 9 PR A : Graham Kemp, halmers University of Technology

5 ydrog en bonds in β-sheets A A A A A A A A A A A A A A A A A A A A A A A A A A A A Graham Kemp, halmers University of Technology

6 DSSP ydrogen bond energy E = q q 2 d() + d() d() d() f Antiparallel bridge: [ hbond(i,j) and hbond(j,i) ] or [ hbond(i-,j+) and hbond(j-,i+) ] Parallel bridge: [ hbond(i-,j) and hbond(j,i+) ] or hbond(j-,i) and hbond(i,j+) ] Graham Kemp, halmers University of Technology

7 DSSP summary codes 4-helix (α-helix) B residue in isolated β-br idge E extended strand, participates in β-ladder G 3-helix I 5-helix T -bonded turn S bend rambin (R) TTPSIVARSFVRLPGTPEAIATYTGIIIPGATPGDYA EE SSTT S EE SSS TTS Graham Kemp, halmers University of Technology

8 Protein stability good stereochemistry; no steric clashes; buried charged atoms must be paired; enough hydrophobic surface must be bur ied, and the interior must be sufficiently densely packed, to provide thermodynamic stability. Modular proteins multi-domain proteins, often with many copies of related domains; domains recur in many proteins in different structural contexts. Graham Kemp, halmers University of Technology

9 3D Transformations Tr anslation T (d x, d y, d z ) = d x d y d z Scaling S(s x, s y, s z ) = s x s y s z Rotation R x (θ) = cos(θ) sin(θ) sin(θ) cos(θ) R y (θ) = cos(θ) sin(θ) sin(θ) cos(θ) R z (θ) = cos(θ) sin(θ) sin(θ) cos(θ) Graham Kemp, halmers University of Technology

10 omparing molecular fragments Set A Set B Fit Set A onto Set B 3-D transfor mation to map Set A onto Set B Root Mean Square (RMS) distance Graham Kemp, halmers University of Technology

11 Domain definitions "The definition of protein domains var ies widely across the discipline of biology. Domains are defined simultaneously as: () regions that display a significant level of sequence homology; (2) a minimal part of the gene that is capable of perfor ming a function; (3) a region of the protein with an exper imentally assigned function; (4) par ts of structures that have significant structural similarity; and (5) compact spatially distinct units of protein structure." [Veretnik S, Bour ne PE, Alexandrov, Shindyalov I. To w ard consistent assignment of structural domains in proteins. J Mol Biol. 24 Jun 4;339(3): ] Graham Kemp, halmers University of Technology

12 DMAK (Dmain MAKer) [Siddiqui AS, Bar ton GJ. ontinuous and discontinuous domains: an algor ithm for the automatic generation of reliable protein domain definitions. Protein Sci. 995 May;4(5): ] Based on the principle that the residues comprising a domain make more contacts between themselves (internal contacts) than they do with the rest of the protein (exter nal contacts). Tw o residues make contact if a heavy atom of one is within 5angstrom of a heavy atom of the other. int A ext AB int B ext AB an deal with domains consisting of two segments. Graham Kemp, halmers University of Technology

13 STRUDL (STRUctural Domain Limits) [Wer nisch L, unting M, Wodak SJ. Identification of structural domains in proteins by a graph heuristic. Proteins. 999 May 5;35(3): ] Algor ithm designed to identify domains with any number of noncontiguous chain segments. Uses the Ker nighan-lin graph heuristic to partition the protein into residue sets which display minimum interactions between them. Interactions are deduced from contact areas between atoms in the weighted Voronoi diagram. The radius of the "accessible sphere" around each atom is the van der Waals radius of the atom increased by.4angstrom. Graham Kemp, halmers University of Technology

14 onflicting domain assignments "The major factors responsible for conflicting domain assignments between methods, both exper ts and automatic, are: () the definition of ver y small domains; (2) splitting secondary str uctures between domains; (3) the size and number of discontinuous domains; (4) closely packed or convoluted domain-domain interfaces; (5) str uctures with large and complex architectures; and (6) the level of significance placed upon structural, functional and evolutionar y concepts in considering structural domain definitions." [Veretnik S, Bour ne PE, Alexandrov, Shindyalov I. To w ard consistent assignment of structural domains in proteins. J Mol Biol. 24 Jun 4;339(3): ] Graham Kemp, halmers University of Technology

Dr. R. Sankar, BSE 631 (2018)

Dr. R. Sankar, BSE 631 (2018) Pauling, Corey and Branson Diffraction of DNA http://www.nature.com/scitable/topicpage/dna-is-a-structure-that-encodes-biological-6493050 In short, stereochemistry is important in determining which helices

More information

Virtual bond representation

Virtual bond representation Today s subjects: Virtual bond representation Coordination number Contact maps Sidechain packing: is it an instrumental way of selecting and consolidating a fold? ASA of proteins Interatomic distances

More information

Packing of Secondary Structures

Packing of Secondary Structures 7.88 Lecture Notes - 5 7.24/7.88J/5.48J The Protein Folding and Human Disease Packing of Secondary Structures Packing of Helices against sheets Packing of sheets against sheets Parallel Orthogonal Table:

More information

Programme Good morning and summary of last week Levels of Protein Structure - I Levels of Protein Structure - II

Programme Good morning and summary of last week Levels of Protein Structure - I Levels of Protein Structure - II Programme 8.00-8.10 Good morning and summary of last week 8.10-8.30 Levels of Protein Structure - I 8.30-9.00 Levels of Protein Structure - II 9.00-9.15 Break 9.15-11.15 Exercise: Building a protein model

More information

If you wish to have extra practice with swiss pdb viewer or to familiarize yourself with how to use the program here is a tutorial:

If you wish to have extra practice with swiss pdb viewer or to familiarize yourself with how to use the program here is a tutorial: Name (s): Swiss PDB viewer assignment chapter 4. If you wish to have extra practice with swiss pdb viewer or to familiarize yourself with how to use the program here is a tutorial: http://spdbv.vital-it.ch/themolecularlevel/spvtut/index.html

More information

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Secondary Structure Prediction

CMPS 6630: Introduction to Computational Biology and Bioinformatics. Secondary Structure Prediction CMPS 6630: Introduction to Computational Biology and Bioinformatics Secondary Structure Prediction Secondary Structure Annotation Given a macromolecular structure Identify the regions of secondary structure

More information

Structural bioinformatics

Structural bioinformatics Structural bioinformatics Why structures? The representation of the molecules in 3D is more informative New properties of the molecules are revealed, which can not be detected by sequences Eran Eyal Plant

More information

Fundamentals of Protein Structure

Fundamentals of Protein Structure Outline Fundamentals of Protein Structure Yu (Julie) Chen and Thomas Funkhouser Princeton University CS597A, Fall 2005 Protein structure Primary Secondary Tertiary Quaternary Forces and factors Levels

More information

Introduction to Proteins

Introduction to Proteins Introduction to Proteins Lecture 4 Module I: Molecular Structure & Metabolism Molecular Cell Biology Core Course (GSND5200) Matthew Neiditch - Room E450U ICPH matthew.neiditch@umdnj.edu What is a protein?

More information

Problem Set Unit The base ratios in the DNA and RNA for an onion (Allium cepa) are given below.

Problem Set Unit The base ratios in the DNA and RNA for an onion (Allium cepa) are given below. Problem Set Unit 3 Name 1. Which molecule is found in both DNA and RNA? A. Ribose B. Uracil C. Phosphate D. Amino acid 2. Which molecules form the nucleotide marked in the diagram? A. phosphate, deoxyribose

More information

Computational Methods for Protein Structure Prediction

Computational Methods for Protein Structure Prediction Computational Methods for Protein Structure Prediction Ying Xu 2017/12/6 1 Outline introduction to protein structures the problem of protein structure prediction why it is possible to predict protein structures

More information

In silico measurements of twist and bend. moduli for beta solenoid protein self-

In silico measurements of twist and bend. moduli for beta solenoid protein self- In silico measurements of twist and bend moduli for beta solenoid protein self- assembly units Leonard P. Heinz, Krishnakumar M. Ravikumar, and Daniel L. Cox Department of Physics and Institute for Complex

More information

1) The penicillin family of antibiotics, discovered by Alexander Fleming in 1928, has the following general structure: O O

1) The penicillin family of antibiotics, discovered by Alexander Fleming in 1928, has the following general structure: O O ame: TF ame: LS1a Fall 06 Problem Set #3 Due Friday 10/13 at noon in your TF s drop box on the 2 nd floor of the Science Center All questions including the (*extra*) ones should be turned in 1) The penicillin

More information

Nucleic acid and protein Flow of genetic information

Nucleic acid and protein Flow of genetic information Nucleic acid and protein Flow of genetic information References: Glick, BR and JJ Pasternak, 2003, Molecular Biotechnology: Principles and Applications of Recombinant DNA, ASM Press, Washington DC, pages.

More information

Alpha-helices, beta-sheets and U-turns within a protein are stabilized by (hint: two words).

Alpha-helices, beta-sheets and U-turns within a protein are stabilized by (hint: two words). 1 Quiz1 Q1 2011 Alpha-helices, beta-sheets and U-turns within a protein are stabilized by (hint: two words) Value Correct Answer 1 noncovalent interactions 100% Equals hydrogen bonds (100%) Equals H-bonds

More information

Problem: The GC base pairs are more stable than AT base pairs. Why? 5. Triple-stranded DNA was first observed in 1957. Scientists later discovered that the formation of triplestranded DNA involves a type

More information

IB HL Biology Test: Topics 1 and 3

IB HL Biology Test: Topics 1 and 3 October 26, 2011 IB HL Biology Test: Topics 1 and 3 Multiple Choice Identify the choice that best completes the statement or answers the question. 1. What conditions must be met for the t-test to be applied?

More information

Amino Acid Sequences and Evolutionary Relationships

Amino Acid Sequences and Evolutionary Relationships Amino Acid Sequences and Evolutionary Relationships One technique used to determine evolutionary relationships is to study the biochemical similarity of organisms. Though molds, aardvarks, and humans appear

More information

Suppl. Figure 1: RCC1 sequence and sequence alignments. (a) Amino acid

Suppl. Figure 1: RCC1 sequence and sequence alignments. (a) Amino acid Supplementary Figures Suppl. Figure 1: RCC1 sequence and sequence alignments. (a) Amino acid sequence of Drosophila RCC1. Same colors are for Figure 1 with sequence of β-wedge that interacts with Ran in

More information

Solutions to 7.02 Quiz II 10/27/05

Solutions to 7.02 Quiz II 10/27/05 Solutions to 7.02 Quiz II 10/27/05 Class Average = 83 Standard Deviation = 9 Range Grade % 87-100 A 43 74-86 B 39 55-73 C 17 > 54 D 1 Question 1 (56 points) While studying deep sea bacteria, you discover

More information

LABS 9 AND 10 DNA STRUCTURE AND REPLICATION; RNA AND PROTEIN SYNTHESIS

LABS 9 AND 10 DNA STRUCTURE AND REPLICATION; RNA AND PROTEIN SYNTHESIS LABS 9 AND 10 DNA STRUCTURE AND REPLICATION; RNA AND PROTEIN SYNTHESIS OBJECTIVE 1. OBJECTIVE 2. OBJECTIVE 3. OBJECTIVE 4. Describe the structure of DNA. Explain how DNA replicates. Understand the structure

More information

Protein Structure/Function Relationships

Protein Structure/Function Relationships Protein Structure/Function Relationships W. M. Grogan, Ph.D. OBJECTIVES 1. Describe and cite examples of fibrous and globular proteins. 2. Describe typical tertiary structural motifs found in proteins.

More information

Structure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München

Structure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Structure formation and association of biomolecules Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Motivation Many biomolecules are chemically synthesized

More information

DNA stands for deoxyribose nucleic acid

DNA stands for deoxyribose nucleic acid 1 DNA 2 DNA stands for deoxyribose nucleic acid This chemical substance is present in the nucleus of all cells in all living organisms DNA controls all the chemical changes which take place in cells The

More information

Basic concepts of molecular biology

Basic concepts of molecular biology Basic concepts of molecular biology Gabriella Trucco Email: gabriella.trucco@unimi.it Life The main actors in the chemistry of life are molecules called proteins nucleic acids Proteins: many different

More information

Amino Acid Sequences and Evolutionary Relationships

Amino Acid Sequences and Evolutionary Relationships Amino Acid Sequences and Evolutionary Relationships Pre-Lab Discussion Homologous structures -- those structures believed to have a common origin but not necessarily a common function -- provide some of

More information

BIOLOGY 200 Molecular Biology Students registered for the 9:30AM lecture should NOT attend the 4:30PM lecture.

BIOLOGY 200 Molecular Biology Students registered for the 9:30AM lecture should NOT attend the 4:30PM lecture. BIOLOGY 200 Molecular Biology Students registered for the 9:30AM lecture should NOT attend the 4:30PM lecture. Midterm date change! The midterm will be held on October 19th (likely 6-8PM). Contact Kathy

More information

Protein Structure Analysis

Protein Structure Analysis BINF 731 Protein Structure Analysis http://binf.gmu.edu/vaisman/binf731/ Secondary Structure: Computational Problems Secondary structure characterization Secondary structure assignment Secondary structure

More information

Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor

Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Focus concept Purification of a novel seed storage protein allows sequence analysis and determination of the protein

More information

Structural Bioinformatics (C3210) Conformational Analysis Protein Folding Protein Structure Prediction

Structural Bioinformatics (C3210) Conformational Analysis Protein Folding Protein Structure Prediction Structural Bioinformatics (C3210) Conformational Analysis Protein Folding Protein Structure Prediction Conformational Analysis 2 Conformational Analysis Properties of molecules depend on their three-dimensional

More information

03-511/711 Computational Genomics and Molecular Biology, Fall

03-511/711 Computational Genomics and Molecular Biology, Fall 03-511/711 Computational Genomics and Molecular Biology, Fall 2011 1 Problem Set 0 Due Tuesday, September 6th This homework is intended to be a self-administered placement quiz, to help you (and me) determine

More information

2018 Protein Modeling Exam Key

2018 Protein Modeling Exam Key 2018 Protein Modeling Exam Key Multiple Choice: 1. Which of the following amino acids has a negative charge at ph 7? a. Gln b. Glu c. Ser d. Cys 2. Which of the following is an example of secondary structure?

More information

CFSSP: Chou and Fasman Secondary Structure Prediction server

CFSSP: Chou and Fasman Secondary Structure Prediction server Wide Spectrum, Vol. 1, No. 9, (2013) pp 15-19 CFSSP: Chou and Fasman Secondary Structure Prediction server T. Ashok Kumar Department of Bioinformatics, Noorul Islam College of Arts and Science, Kumaracoil

More information

Antibody-Antigen recognition. Structural Biology Weekend Seminar Annegret Kramer

Antibody-Antigen recognition. Structural Biology Weekend Seminar Annegret Kramer Antibody-Antigen recognition Structural Biology Weekend Seminar 10.07.2005 Annegret Kramer Contents Function and structure of antibodies Features of antibody-antigen interfaces Examples of antibody-antigen

More information

7.013 Spring 2005 Problem Set 1

7.013 Spring 2005 Problem Set 1 MIT Department of Biology 7.013: Introductory Biology Spring 005 Instructors: rofessor azel Sive, rofessor Tyler Jacks, Dr. laudette Gardel AME TA Section # 7.013 Spring 005 roblem Set 1 FRIDAY February

More information

Basic concepts of molecular biology

Basic concepts of molecular biology Basic concepts of molecular biology Gabriella Trucco Email: gabriella.trucco@unimi.it What is life made of? 1665: Robert Hooke discovered that organisms are composed of individual compartments called cells

More information

Zool 3200: Cell Biology Exam 3 3/6/15

Zool 3200: Cell Biology Exam 3 3/6/15 Name: Trask Zool 3200: Cell Biology Exam 3 3/6/15 Answer each of the following questions in the space provided; circle the correct answer or answers for each multiple choice question and circle either

More information

Gene Expression Translation U C A G A G

Gene Expression Translation U C A G A G Why? ene Expression Translation How do cells synthesize polypeptides and convert them to functional proteins? The message in your DN of who you are and how your body works is carried out by cells through

More information

Protein Folding Problem I400: Introduction to Bioinformatics

Protein Folding Problem I400: Introduction to Bioinformatics Protein Folding Problem I400: Introduction to Bioinformatics November 29, 2004 Protein biomolecule, macromolecule more than 50% of the dry weight of cells is proteins polymer of amino acids connected into

More information

7.014 Problem Set 4 Answers to this problem set are to be turned in. Problem sets will not be accepted late. Solutions will be posted on the web.

7.014 Problem Set 4 Answers to this problem set are to be turned in. Problem sets will not be accepted late. Solutions will be posted on the web. MIT Department of Biology 7.014 Introductory Biology, Spring 2005 Name: Section : 7.014 Problem Set 4 Answers to this problem set are to be turned in. Problem sets will not be accepted late. Solutions

More information

Residue Contact Prediction for Protein Structure using 2-Norm Distances

Residue Contact Prediction for Protein Structure using 2-Norm Distances Residue Contact Prediction for Protein Structure using 2-Norm Distances Nikita V Mahajan Department of Computer Science &Engg GH Raisoni College of Engineering, Nagpur LGMalik Department of Computer Science

More information

Amino Acid Sequences and Evolutionary Relationships. How do similarities in amino acid sequences of various species provide evidence for evolution?

Amino Acid Sequences and Evolutionary Relationships. How do similarities in amino acid sequences of various species provide evidence for evolution? Amino Acid Sequences and Evolutionary Relationships Name: How do similarities in amino acid sequences of various species provide evidence for evolution? An important technique used in determining evolutionary

More information

Supporting Information Contents

Supporting Information Contents Supporting Information Choy Theng Loh, Kiyoshi Ozawa, Kellie L. Tuck, Nicholas Barlow, Thomas Huber, Gottfried Otting, and Bim Graham Lanthanide tags for site-specific ligation to an unnatural amino acid

More information

Lecture 9 (10/2/17) Lecture 9 (10/2/17)

Lecture 9 (10/2/17) Lecture 9 (10/2/17) Lecture 9 (10/2/17) Reading: Ch4; 119-122, 125-126, 131-133 (a-helix) Ch4; 123-124, 130-131, 133, 137-138 (b-sheets) Problems: Ch4 (text); 2, 3, 4, 8, 13, 14 NEXT Reading: Ch4; 125, 138-141, 141-142 Problems:

More information

Protein Structure Prediction by Constraint Logic Programming

Protein Structure Prediction by Constraint Logic Programming MPRI C2-19 Protein Structure Prediction by Constraint Logic Programming François Fages, Constraint Programming Group, INRIA Rocquencourt mailto:francois.fages@inria.fr http://contraintes.inria.fr/ Molecules

More information

What is DNA??? DNA = Deoxyribonucleic acid IT is a molecule that contains the code for an organism s growth and function

What is DNA??? DNA = Deoxyribonucleic acid IT is a molecule that contains the code for an organism s growth and function Review DNA and RNA 1) DNA and RNA are important organic compounds found in cells, called nucleic acids 2) Both DNA and RNA molecules contain the following chemical elements: carbon, hydrogen, oxygen, nitrogen

More information

Protein 3D Structure Prediction

Protein 3D Structure Prediction Protein 3D Structure Prediction Michael Tress CNIO ?? MREYKLVVLGSGGVGKSALTVQFVQGIFVDE YDPTIEDSYRKQVEVDCQQCMLEILDTAGTE QFTAMRDLYMKNGQGFALVYSITAQSTFNDL QDLREQILRVKDTEDVPMILVGNKCDLEDER VVGKEQGQNLARQWCNCAFLESSAKSKINVN

More information

Pacific Symposium on Biocomputing 4: (1999)

Pacific Symposium on Biocomputing 4: (1999) Applications of Knowledge Discovery to Molecular Biology: Identifying Structural Regularities in Proteins Shaobing Su, Diane J. Cook, and Lawrence B. Holder University of Texas at Arlington sandy su@sabre.com,

More information

6-Foot Mini Toober Activity

6-Foot Mini Toober Activity Big Idea The interaction between the substrate and enzyme is highly specific. Even a slight change in shape of either the substrate or the enzyme may alter the efficient and selective ability of the enzyme

More information

Pacific Symposium on Biocomputing 4: (1999)

Pacific Symposium on Biocomputing 4: (1999) U S I N G I N F O R M A T I O N T H E O R Y T O D I S C O V E R S I D E C H A I N R O T A M E R C L A S S E S : A N A L Y S I S O F T H E E F F E C T S O F L O C A L B A C K B O N E S T R U C T U R E J

More information

Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005

Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005 Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 9 September 005 Focus concept Purification of a novel seed storage protein allows sequence analysis and

More information

Ch Biophysical Chemistry

Ch Biophysical Chemistry Ch 247.53. Biophysical Chemistry Nina Rosario L. Rojas 2012-2013 sem 1 Review of Protein Structure Why structure? Primary, secondary, tertiary structure Disulfide bonds scheme 2 STRUCTURE- REGULAR STRUCTURE

More information

7.014 Solution Set 4

7.014 Solution Set 4 7.014 Solution Set 4 Question 1 Shown below is a fragment of the sequence of a hypothetical bacterial gene. This gene encodes production of HWDWN, protein essential for metabolizing sugar yummose. The

More information

Fundamentals of Biochemistry

Fundamentals of Biochemistry Donald Voet Judith G. Voet Charlotte W. Pratt Fundamentals of Biochemistry Second Edition Chapter 6: Proteins: Three-Dimensional Structure Copyright 2006 by John Wiley & Sons, Inc. 1958, John Kendrew Any

More information

Solutions to Problem Set 1

Solutions to Problem Set 1 MIT Department of Biology 7.014 Introductory Biology, Spring 004 Question 1 Solutions to 7.014 Problem Set 1 a) Describe the conditions of the atmosphere on prebiotic earth and how these conditions differ

More information

466 Asn (N) to Ala (A) Generate beta dimer Interface

466 Asn (N) to Ala (A) Generate beta dimer Interface Table S1: Amino acid changes to the HexA α-subunit to convert the dimer interface from α to β and to introduce the putative GM2A binding surface from β- onto the α- subunit Residue position (α-numbering)

More information

Learning to Use PyMOL (includes instructions for PS #2)

Learning to Use PyMOL (includes instructions for PS #2) Learning to Use PyMOL (includes instructions for PS #2) To begin, download the saved PyMOL session file, 4kyz.pse from the Chem 391 Assignments web page: http://people.reed.edu/~glasfeld/chem391/assign.html

More information

Ch 10 Molecular Biology of the Gene

Ch 10 Molecular Biology of the Gene Ch 10 Molecular Biology of the Gene For Next Week Lab -Hand in questions from 4 and 5 by TUES in my mailbox (Biology Office) -Do questions for Lab 6 for next week -Lab practical next week Lecture Read

More information

Amino Acids and Proteins

Amino Acids and Proteins Various Functions of Proteins SB203 Amino Acids and Proteins Jirundon Yuvaniyama, Ph.D. Department of Biochemistry Faculty of Science Mahidol University Enzymes Transport proteins utrient and storage proteins

More information

Algorithms in Bioinformatics ONE Transcription Translation

Algorithms in Bioinformatics ONE Transcription Translation Algorithms in Bioinformatics ONE Transcription Translation Sami Khuri Department of Computer Science San José State University sami.khuri@sjsu.edu Biology Review DNA RNA Proteins Central Dogma Transcription

More information

Protein Structure Prediction

Protein Structure Prediction Homology Modeling Protein Structure Prediction Ingo Ruczinski M T S K G G G Y F F Y D E L Y G V V V V L I V L S D E S Department of Biostatistics, Johns Hopkins University Fold Recognition b Initio Structure

More information

BIRKBECK COLLEGE (University of London)

BIRKBECK COLLEGE (University of London) BIRKBECK COLLEGE (University of London) SCHOOL OF BIOLOGICAL SCIENCES M.Sc. EXAMINATION FOR INTERNAL STUDENTS ON: Postgraduate Certificate in Principles of Protein Structure MSc Structural Molecular Biology

More information

Proteins Higher Order Structures

Proteins Higher Order Structures Proteins Higher Order Structures Dr. Mohammad Alsenaidy Department of Pharmaceutics College of Pharmacy King Saud University Office: AA 101 msenaidy@ksu.edu.sa Previously on PHT 426!! Protein Structures

More information

Protein NMR II. Lecture 5

Protein NMR II. Lecture 5 Protein NMR II Lecture 5 Standard and NMR chemical shifts in proteins Residue N A A B O Ala 123.8 4.35 52.5 19.0 177.1 ys 118.8 4.65 58.8 28.6 174.8 Asp 120.4 4.76 54.1 40.8 177.2 Glu 120.2 4.29 56.7 29.7

More information

STRUCTURAL BIOLOGY. α/β structures Closed barrels Open twisted sheets Horseshoe folds

STRUCTURAL BIOLOGY. α/β structures Closed barrels Open twisted sheets Horseshoe folds STRUCTURAL BIOLOGY α/β structures Closed barrels Open twisted sheets Horseshoe folds The α/β domains Most frequent domain structures are α/β domains: A central parallel or mixed β sheet Surrounded by α

More information

CS273: Algorithms for Structure Handout # 5 and Motion in Biology Stanford University Tuesday, 13 April 2004

CS273: Algorithms for Structure Handout # 5 and Motion in Biology Stanford University Tuesday, 13 April 2004 CS273: Algorithms for Structure Handout # 5 and Motion in Biology Stanford University Tuesday, 13 April 2004 Lecture #5: 13 April 2004 Topics: Sequence motif identification Scribe: Samantha Chui 1 Introduction

More information

Immune system IgGs. Carla Cortinas, Eva Espigulé, Guillem Lopez-Grado, Margalida Roig, Valentina Salas. Group 2

Immune system IgGs. Carla Cortinas, Eva Espigulé, Guillem Lopez-Grado, Margalida Roig, Valentina Salas. Group 2 Immune system IgGs Carla Cortinas, Eva Espigulé, Guillem Lopez-Grado, Margalida Roig, Valentina Salas Group 2 Index 1. Introduction 1.1. 1.2. 1.3. 1.4. 2. Immunoglobulins IgG formation IgG subclasses Structural

More information

Proteomics Informatics (BMSC-GA 4437)

Proteomics Informatics (BMSC-GA 4437) Proteomics Informatics (BMSC-GA 4437) Instructor David Fenyö Contact information David@FenyoLab.org htt://fenyolab.org/resentations/proteomics_informatics_2013/ Learning Objectives Be able analyze a roteomics

More information

Honors Research in Molecular Genetics Part 1

Honors Research in Molecular Genetics Part 1 Third Base Honors Research in Molecular enetics Part 1 ll bout ene Expression How do cells synthesize polypeptides and convert them to functional proteins? The message in your DN of who you are and how

More information

Bioinformatics. ONE Introduction to Biology. Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012

Bioinformatics. ONE Introduction to Biology. Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012 Bioinformatics ONE Introduction to Biology Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012 Biology Review DNA RNA Proteins Central Dogma Transcription Translation

More information

Ali Yaghi. Tamara Wahbeh. Mamoun Ahram

Ali Yaghi. Tamara Wahbeh. Mamoun Ahram 28 Ali Yaghi Tamara Wahbeh Mamoun Ahram This sheet is a continuation of protein purification methods. Isoelectric focusing Separation of proteins based on Isoelectric points(charge),and it is a horizontal

More information

a) Give the sequence of the mrna transcribed from this gene and indicate the 5 and 3 ends of the mrna.

a) Give the sequence of the mrna transcribed from this gene and indicate the 5 and 3 ends of the mrna. ame: Section : 7.014 Problem Set 4 nswers to this problem set are to be turned in at the box outside 68120 by 11:45 am, Wednesday, March 9. Problem sets will not be accepted late. Solutions will be posted

More information

Molecular design principles underlying β-strand swapping. in the adhesive dimerization of cadherins

Molecular design principles underlying β-strand swapping. in the adhesive dimerization of cadherins Supplementary information for: Molecular design principles underlying β-strand swapping in the adhesive dimerization of cadherins Jeremie Vendome 1,2,3,5, Shoshana Posy 1,2,3,5,6, Xiangshu Jin, 1,3 Fabiana

More information

Lecture for Wednesday. Dr. Prince BIOL 1408

Lecture for Wednesday. Dr. Prince BIOL 1408 Lecture for Wednesday Dr. Prince BIOL 1408 THE FLOW OF GENETIC INFORMATION FROM DNA TO RNA TO PROTEIN Copyright 2009 Pearson Education, Inc. Genes are expressed as proteins A gene is a segment of DNA that

More information

Recitation Section 20 April 25-26, Immunology. MIT Department of Biology Introductory Biology, Spring A. Antibody production

Recitation Section 20 April 25-26, Immunology. MIT Department of Biology Introductory Biology, Spring A. Antibody production MIT Department of Biology 7.014 Introductory Biology, Spring 005. ntibody duction Immunology Recitation Section 0 pril 56, 005 Shown below is a schematic of the duction of a heavy chain polypeptide for

More information

All Rights Reserved. U.S. Patents 6,471,520B1; 5,498,190; 5,916, North Market Street, Suite CC130A, Milwaukee, WI 53202

All Rights Reserved. U.S. Patents 6,471,520B1; 5,498,190; 5,916, North Market Street, Suite CC130A, Milwaukee, WI 53202 Secondary Structure In the previous protein folding activity, you created a hypothetical 15-amino acid protein and learned that basic principles of chemistry determine how each protein spontaneously folds

More information

Chapter 8. One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model. Sebastian Kmiecik and Andrzej Kolinski.

Chapter 8. One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model. Sebastian Kmiecik and Andrzej Kolinski. Chapter 8 One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model Abstract Despite the significant increase in computational power, molecular modeling of protein structure using

More information

Unit 1. DNA and the Genome

Unit 1. DNA and the Genome Unit 1 DNA and the Genome Gene Expression Key Area 3 Vocabulary 1: Transcription Translation Phenotype RNA (mrna, trna, rrna) Codon Anticodon Ribosome RNA polymerase RNA splicing Introns Extrons Gene Expression

More information

Folding simulation: self-organization of 4-helix bundle protein. yellow = helical turns

Folding simulation: self-organization of 4-helix bundle protein. yellow = helical turns Folding simulation: self-organization of 4-helix bundle protein yellow = helical turns Protein structure Protein: heteropolymer chain made of amino acid residues R + H 3 N - C - COO - H φ ψ Chain of amino

More information

7.014 Quiz II Handout

7.014 Quiz II Handout 7.014 Quiz II Handout Quiz II: Wednesday, March 17 12:05-12:55 54-100 **This will be a closed book exam** Quiz Review Session: Friday, March 12 7:00-9:00 pm room 54-100 Open Tutoring Session: Tuesday,

More information

Visualizing proteins with PyMol

Visualizing proteins with PyMol Visualizing proteins with PyMol Structural Bioinformatics GENOME 541 Spring 2018 Lecture 1: Protein Structure Frank DiMaio (dimaio@uw.edu) Obtaining PyMOL We will use an educational build of PyMOL that

More information

DNA stands for deoxyribose nucleic acid DNA is a very large molecule made up of a long chain of sub-units The sub-units are called nucleotides Each

DNA stands for deoxyribose nucleic acid DNA is a very large molecule made up of a long chain of sub-units The sub-units are called nucleotides Each 1 DNA stands for deoxyribose nucleic acid DNA is a very large molecule made up of a long chain of sub-units The sub-units are called nucleotides Each nucleotide is made up of a sugar called deoxyribose

More information

Sequence Analysis '17 -- lecture Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction

Sequence Analysis '17 -- lecture Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction Sequence Analysis '17 -- lecture 16 1. Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction Alpha helix Right-handed helix. H-bond is from the oxygen at i to the nitrogen

More information

The Double Helix. DNA and RNA, part 2. Part A. Hint 1. The difference between purines and pyrimidines. Hint 2. Distinguish purines from pyrimidines

The Double Helix. DNA and RNA, part 2. Part A. Hint 1. The difference between purines and pyrimidines. Hint 2. Distinguish purines from pyrimidines DNA and RNA, part 2 Due: 3:00pm on Wednesday, September 24, 2014 You will receive no credit for items you complete after the assignment is due. Grading Policy The Double Helix DNA, or deoxyribonucleic

More information

Proteins: Wide range of func2ons. Polypep2des. Amino Acid Monomers

Proteins: Wide range of func2ons. Polypep2des. Amino Acid Monomers Proteins: Wide range of func2ons Proteins coded in DNA account for more than 50% of the dry mass of most cells Protein func9ons structural support storage transport cellular communica9ons movement defense

More information

Proteins the primary biological macromolecules of living organisms

Proteins the primary biological macromolecules of living organisms Proteins the primary biological macromolecules of living organisms Protein structure and folding Primary Secondary Tertiary Quaternary structure of proteins Structure of Proteins Protein molecules adopt

More information

Protein Structure. Protein Structure Tertiary & Quaternary

Protein Structure. Protein Structure Tertiary & Quaternary Lecture 4 Protein Structure Protein Structure Tertiary & Quaternary Dr. Sameh Sarray Hlaoui Primary structure: The linear sequence of amino acids held together by peptide bonds. Secondary structure: The

More information

LIST OF ACRONYMS & ABBREVIATIONS

LIST OF ACRONYMS & ABBREVIATIONS LIST OF ACRONYMS & ABBREVIATIONS ALA ARG ASN ATD CRD CYS GLN GLU GLY GPCR HIS hstr ILE LEU LYS MET mglur1 NHDC PDB PHE PRO SER T1R2 T1R3 TMD TRP TYR THR 7-TM VFTM ZnSO 4 Alanine, A Arginine, R Asparagines,

More information

CS 4491/CS 7990 SPECIAL TOPICS IN BIOINFORMATICS

CS 4491/CS 7990 SPECIAL TOPICS IN BIOINFORMATICS 1 CS 4491/CS 7990 SPECIAL TOPICS IN BIOINFORMATICS * Some contents are adapted from Dr. Jean Gao at UT Arlington Mingon Kang, PhD Computer Science, Kennesaw State University 2 Genetics The discovery of

More information

36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L-

36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L- 36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L- 37. The essential fatty acids are A. palmitic acid B. linoleic acid C. linolenic

More information

Protein Structure Databases, cont. 11/09/05

Protein Structure Databases, cont. 11/09/05 11/9/05 Protein Structure Databases (continued) Prediction & Modeling Bioinformatics Seminars Nov 10 Thurs 3:40 Com S Seminar in 223 Atanasoff Computational Epidemiology Armin R. Mikler, Univ. North Texas

More information

DNA.notebook March 08, DNA Overview

DNA.notebook March 08, DNA Overview DNA Overview Deoxyribonucleic Acid, or DNA, must be able to do 2 things: 1) give instructions for building and maintaining cells. 2) be copied each time a cell divides. DNA is made of subunits called nucleotides

More information

Fourier-based classification of protein secondary structures

Fourier-based classification of protein secondary structures Source: Biochemical and Biophysical Research Communications, Vol. 485, No. 4, pp. 731-735, 2017; DOI:./j.bbrc.2017.02.7 Fourier-based classification of protein secondary structures Jian-Jun SHU, Kian Yan

More information

Comparative Modeling Part 1. Jaroslaw Pillardy Computational Biology Service Unit Cornell Theory Center

Comparative Modeling Part 1. Jaroslaw Pillardy Computational Biology Service Unit Cornell Theory Center Comparative Modeling Part 1 Jaroslaw Pillardy Computational Biology Service Unit Cornell Theory Center Function is the most important feature of a protein Function is related to structure Structure is

More information

蛋白質體學. Proteomics Amino acids, Peptides and Proteins 陳威戎 & 21

蛋白質體學. Proteomics Amino acids, Peptides and Proteins 陳威戎 & 21 蛋白質體學 Proteomics 2015 Amino acids, Peptides and Proteins 陳威戎 2015. 09. 14 & 21 Outline 1. Amino Acids 2. Peptides and Proteins 3. Covalent Structure of Proteins Amino Acids Proteins are polymers of amino

More information

Steroids. Steroids. Proteins: Wide range of func6ons. lipids characterized by a carbon skeleton consis3ng of four fused rings

Steroids. Steroids. Proteins: Wide range of func6ons. lipids characterized by a carbon skeleton consis3ng of four fused rings Steroids Steroids lipids characterized by a carbon skeleton consis3ng of four fused rings 3 six sided, and 1 five sided Cholesterol important steroid precursor component in animal cell membranes Although

More information

Protein Structure Prediction. christian studer , EPFL

Protein Structure Prediction. christian studer , EPFL Protein Structure Prediction christian studer 17.11.2004, EPFL Content Definition of the problem Possible approaches DSSP / PSI-BLAST Generalization Results Definition of the problem Massive amounts of

More information

KEMM15 Lecture note in structural bioinformatics: A practical guide. S Al-Karadaghi, Biochemistry & Structural Biology, Lund University

KEMM15 Lecture note in structural bioinformatics: A practical guide. S Al-Karadaghi, Biochemistry & Structural Biology, Lund University KEMM15 Lecture note in structural bioinformatics: A practical guide S Al-Karadaghi, Biochemistry & Structural Biology, Lund University 1 BASICS OF PROTEIN STRUCTURE 3 SOME DEFINITIONS 3 THE 20 AMINO ACIDS

More information

A Crash Course in Genetics. A Crash Course in Genetics. General Overview: General Overview: DNA Is Structured Hierarchically

A Crash Course in Genetics. A Crash Course in Genetics. General Overview: General Overview: DNA Is Structured Hierarchically DN Structure DN Structure RN RN DN Replication DN Replication Encoding Proteins Encoding Proteins Protein Folding Protein Folding Types of DN Types of DN Manipulating DN Manipulating DN DN Is Structured

More information

Structure of the C-cadherin ectodomain and implications for the mechanism of cell adhesion

Structure of the C-cadherin ectodomain and implications for the mechanism of cell adhesion Structure of the C-cadherin ectodomain and implications for the mechanism of cell adhesion Titus J. Boggon, John Murray, Sophie Chappuis-Flament, Ellen Wong, Barry M. Gumbiner, and Lawrence Shapiro Ref.

More information