Polypeptide backbone (or the main chain)
|
|
- Benjamin May
- 6 years ago
- Views:
Transcription
1 Polypeptide backbone (or the main chain) [IUPA-IUB ommission on Biochemical omenclature, Abbreviations and Symbols for the Description of the onfor mation of Polypeptide hains. Eur. J. Biochem., 969, 7, 93-2] Graham Kemp, halmers University of Technology
2 Dihedral angle A D B Graham Kemp, halmers University of Technology
3 Ramachandran steric map [o, K.., Thomas, A. and Brasseur, R., Protein Science, 23, 2: ] Graham Kemp, halmers University of Technology
4 Protein Data Bank entry (extract) MPD TRISE PSPATE ISMERASE (E ) SURE IKE (GALLUS GALLUS) BREAST MUSLE AUTR D.W.BAER,A..BLMER,G.A.PETSK,D..PILLIPS, AUTR 2 I.A.WILS : JRL AUT D.W.BAER,A..BLMER,G.A.PETSK,D..PILLIPS, JRL AUT 2 I.A.WILS JRL TITL ATMI RDIATES FR TRISE PSPATE ISMERASE JRL TITL 2 FRM IKE MUSLE JRL REF BIEM.BIPYS.RES.MM. V JRL REF ASTM BBRA9 US ISS 6-29X 46 : REMARK 2 RESLUTI. 2.5 AGSTRMS. : SEQRES A 247 ALA PR ARG LYS PE PE VAL GLY GLY AS TRP LYS MET SEQRES 2 A 247 AS GLY LYS ARG LYS SER LEU GLY GLU LEU ILE IS TR : ATM ALA A ATM 2 A ALA A ATM 3 ALA A ATM 4 ALA A ATM 5 B ALA A ATM 6 PR A ATM 7 A PR A ATM 8 PR A ATM 9 PR A : Graham Kemp, halmers University of Technology
5 ydrog en bonds in β-sheets A A A A A A A A A A A A A A A A A A A A A A A A A A A A Graham Kemp, halmers University of Technology
6 DSSP ydrogen bond energy E = q q 2 d() + d() d() d() f Antiparallel bridge: [ hbond(i,j) and hbond(j,i) ] or [ hbond(i-,j+) and hbond(j-,i+) ] Parallel bridge: [ hbond(i-,j) and hbond(j,i+) ] or hbond(j-,i) and hbond(i,j+) ] Graham Kemp, halmers University of Technology
7 DSSP summary codes 4-helix (α-helix) B residue in isolated β-br idge E extended strand, participates in β-ladder G 3-helix I 5-helix T -bonded turn S bend rambin (R) TTPSIVARSFVRLPGTPEAIATYTGIIIPGATPGDYA EE SSTT S EE SSS TTS Graham Kemp, halmers University of Technology
8 Protein stability good stereochemistry; no steric clashes; buried charged atoms must be paired; enough hydrophobic surface must be bur ied, and the interior must be sufficiently densely packed, to provide thermodynamic stability. Modular proteins multi-domain proteins, often with many copies of related domains; domains recur in many proteins in different structural contexts. Graham Kemp, halmers University of Technology
9 3D Transformations Tr anslation T (d x, d y, d z ) = d x d y d z Scaling S(s x, s y, s z ) = s x s y s z Rotation R x (θ) = cos(θ) sin(θ) sin(θ) cos(θ) R y (θ) = cos(θ) sin(θ) sin(θ) cos(θ) R z (θ) = cos(θ) sin(θ) sin(θ) cos(θ) Graham Kemp, halmers University of Technology
10 omparing molecular fragments Set A Set B Fit Set A onto Set B 3-D transfor mation to map Set A onto Set B Root Mean Square (RMS) distance Graham Kemp, halmers University of Technology
11 Domain definitions "The definition of protein domains var ies widely across the discipline of biology. Domains are defined simultaneously as: () regions that display a significant level of sequence homology; (2) a minimal part of the gene that is capable of perfor ming a function; (3) a region of the protein with an exper imentally assigned function; (4) par ts of structures that have significant structural similarity; and (5) compact spatially distinct units of protein structure." [Veretnik S, Bour ne PE, Alexandrov, Shindyalov I. To w ard consistent assignment of structural domains in proteins. J Mol Biol. 24 Jun 4;339(3): ] Graham Kemp, halmers University of Technology
12 DMAK (Dmain MAKer) [Siddiqui AS, Bar ton GJ. ontinuous and discontinuous domains: an algor ithm for the automatic generation of reliable protein domain definitions. Protein Sci. 995 May;4(5): ] Based on the principle that the residues comprising a domain make more contacts between themselves (internal contacts) than they do with the rest of the protein (exter nal contacts). Tw o residues make contact if a heavy atom of one is within 5angstrom of a heavy atom of the other. int A ext AB int B ext AB an deal with domains consisting of two segments. Graham Kemp, halmers University of Technology
13 STRUDL (STRUctural Domain Limits) [Wer nisch L, unting M, Wodak SJ. Identification of structural domains in proteins by a graph heuristic. Proteins. 999 May 5;35(3): ] Algor ithm designed to identify domains with any number of noncontiguous chain segments. Uses the Ker nighan-lin graph heuristic to partition the protein into residue sets which display minimum interactions between them. Interactions are deduced from contact areas between atoms in the weighted Voronoi diagram. The radius of the "accessible sphere" around each atom is the van der Waals radius of the atom increased by.4angstrom. Graham Kemp, halmers University of Technology
14 onflicting domain assignments "The major factors responsible for conflicting domain assignments between methods, both exper ts and automatic, are: () the definition of ver y small domains; (2) splitting secondary str uctures between domains; (3) the size and number of discontinuous domains; (4) closely packed or convoluted domain-domain interfaces; (5) str uctures with large and complex architectures; and (6) the level of significance placed upon structural, functional and evolutionar y concepts in considering structural domain definitions." [Veretnik S, Bour ne PE, Alexandrov, Shindyalov I. To w ard consistent assignment of structural domains in proteins. J Mol Biol. 24 Jun 4;339(3): ] Graham Kemp, halmers University of Technology
Dr. R. Sankar, BSE 631 (2018)
Pauling, Corey and Branson Diffraction of DNA http://www.nature.com/scitable/topicpage/dna-is-a-structure-that-encodes-biological-6493050 In short, stereochemistry is important in determining which helices
More informationVirtual bond representation
Today s subjects: Virtual bond representation Coordination number Contact maps Sidechain packing: is it an instrumental way of selecting and consolidating a fold? ASA of proteins Interatomic distances
More informationPacking of Secondary Structures
7.88 Lecture Notes - 5 7.24/7.88J/5.48J The Protein Folding and Human Disease Packing of Secondary Structures Packing of Helices against sheets Packing of sheets against sheets Parallel Orthogonal Table:
More informationProgramme Good morning and summary of last week Levels of Protein Structure - I Levels of Protein Structure - II
Programme 8.00-8.10 Good morning and summary of last week 8.10-8.30 Levels of Protein Structure - I 8.30-9.00 Levels of Protein Structure - II 9.00-9.15 Break 9.15-11.15 Exercise: Building a protein model
More informationIf you wish to have extra practice with swiss pdb viewer or to familiarize yourself with how to use the program here is a tutorial:
Name (s): Swiss PDB viewer assignment chapter 4. If you wish to have extra practice with swiss pdb viewer or to familiarize yourself with how to use the program here is a tutorial: http://spdbv.vital-it.ch/themolecularlevel/spvtut/index.html
More informationCMPS 6630: Introduction to Computational Biology and Bioinformatics. Secondary Structure Prediction
CMPS 6630: Introduction to Computational Biology and Bioinformatics Secondary Structure Prediction Secondary Structure Annotation Given a macromolecular structure Identify the regions of secondary structure
More informationStructural bioinformatics
Structural bioinformatics Why structures? The representation of the molecules in 3D is more informative New properties of the molecules are revealed, which can not be detected by sequences Eran Eyal Plant
More informationFundamentals of Protein Structure
Outline Fundamentals of Protein Structure Yu (Julie) Chen and Thomas Funkhouser Princeton University CS597A, Fall 2005 Protein structure Primary Secondary Tertiary Quaternary Forces and factors Levels
More informationIntroduction to Proteins
Introduction to Proteins Lecture 4 Module I: Molecular Structure & Metabolism Molecular Cell Biology Core Course (GSND5200) Matthew Neiditch - Room E450U ICPH matthew.neiditch@umdnj.edu What is a protein?
More informationProblem Set Unit The base ratios in the DNA and RNA for an onion (Allium cepa) are given below.
Problem Set Unit 3 Name 1. Which molecule is found in both DNA and RNA? A. Ribose B. Uracil C. Phosphate D. Amino acid 2. Which molecules form the nucleotide marked in the diagram? A. phosphate, deoxyribose
More informationComputational Methods for Protein Structure Prediction
Computational Methods for Protein Structure Prediction Ying Xu 2017/12/6 1 Outline introduction to protein structures the problem of protein structure prediction why it is possible to predict protein structures
More informationIn silico measurements of twist and bend. moduli for beta solenoid protein self-
In silico measurements of twist and bend moduli for beta solenoid protein self- assembly units Leonard P. Heinz, Krishnakumar M. Ravikumar, and Daniel L. Cox Department of Physics and Institute for Complex
More information1) The penicillin family of antibiotics, discovered by Alexander Fleming in 1928, has the following general structure: O O
ame: TF ame: LS1a Fall 06 Problem Set #3 Due Friday 10/13 at noon in your TF s drop box on the 2 nd floor of the Science Center All questions including the (*extra*) ones should be turned in 1) The penicillin
More informationNucleic acid and protein Flow of genetic information
Nucleic acid and protein Flow of genetic information References: Glick, BR and JJ Pasternak, 2003, Molecular Biotechnology: Principles and Applications of Recombinant DNA, ASM Press, Washington DC, pages.
More informationAlpha-helices, beta-sheets and U-turns within a protein are stabilized by (hint: two words).
1 Quiz1 Q1 2011 Alpha-helices, beta-sheets and U-turns within a protein are stabilized by (hint: two words) Value Correct Answer 1 noncovalent interactions 100% Equals hydrogen bonds (100%) Equals H-bonds
More informationProblem: The GC base pairs are more stable than AT base pairs. Why? 5. Triple-stranded DNA was first observed in 1957. Scientists later discovered that the formation of triplestranded DNA involves a type
More informationIB HL Biology Test: Topics 1 and 3
October 26, 2011 IB HL Biology Test: Topics 1 and 3 Multiple Choice Identify the choice that best completes the statement or answers the question. 1. What conditions must be met for the t-test to be applied?
More informationAmino Acid Sequences and Evolutionary Relationships
Amino Acid Sequences and Evolutionary Relationships One technique used to determine evolutionary relationships is to study the biochemical similarity of organisms. Though molds, aardvarks, and humans appear
More informationSuppl. Figure 1: RCC1 sequence and sequence alignments. (a) Amino acid
Supplementary Figures Suppl. Figure 1: RCC1 sequence and sequence alignments. (a) Amino acid sequence of Drosophila RCC1. Same colors are for Figure 1 with sequence of β-wedge that interacts with Ran in
More informationSolutions to 7.02 Quiz II 10/27/05
Solutions to 7.02 Quiz II 10/27/05 Class Average = 83 Standard Deviation = 9 Range Grade % 87-100 A 43 74-86 B 39 55-73 C 17 > 54 D 1 Question 1 (56 points) While studying deep sea bacteria, you discover
More informationLABS 9 AND 10 DNA STRUCTURE AND REPLICATION; RNA AND PROTEIN SYNTHESIS
LABS 9 AND 10 DNA STRUCTURE AND REPLICATION; RNA AND PROTEIN SYNTHESIS OBJECTIVE 1. OBJECTIVE 2. OBJECTIVE 3. OBJECTIVE 4. Describe the structure of DNA. Explain how DNA replicates. Understand the structure
More informationProtein Structure/Function Relationships
Protein Structure/Function Relationships W. M. Grogan, Ph.D. OBJECTIVES 1. Describe and cite examples of fibrous and globular proteins. 2. Describe typical tertiary structural motifs found in proteins.
More informationStructure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München
Structure formation and association of biomolecules Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Motivation Many biomolecules are chemically synthesized
More informationDNA stands for deoxyribose nucleic acid
1 DNA 2 DNA stands for deoxyribose nucleic acid This chemical substance is present in the nucleus of all cells in all living organisms DNA controls all the chemical changes which take place in cells The
More informationBasic concepts of molecular biology
Basic concepts of molecular biology Gabriella Trucco Email: gabriella.trucco@unimi.it Life The main actors in the chemistry of life are molecules called proteins nucleic acids Proteins: many different
More informationAmino Acid Sequences and Evolutionary Relationships
Amino Acid Sequences and Evolutionary Relationships Pre-Lab Discussion Homologous structures -- those structures believed to have a common origin but not necessarily a common function -- provide some of
More informationBIOLOGY 200 Molecular Biology Students registered for the 9:30AM lecture should NOT attend the 4:30PM lecture.
BIOLOGY 200 Molecular Biology Students registered for the 9:30AM lecture should NOT attend the 4:30PM lecture. Midterm date change! The midterm will be held on October 19th (likely 6-8PM). Contact Kathy
More informationProtein Structure Analysis
BINF 731 Protein Structure Analysis http://binf.gmu.edu/vaisman/binf731/ Secondary Structure: Computational Problems Secondary structure characterization Secondary structure assignment Secondary structure
More informationCase 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor
Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Focus concept Purification of a novel seed storage protein allows sequence analysis and determination of the protein
More informationStructural Bioinformatics (C3210) Conformational Analysis Protein Folding Protein Structure Prediction
Structural Bioinformatics (C3210) Conformational Analysis Protein Folding Protein Structure Prediction Conformational Analysis 2 Conformational Analysis Properties of molecules depend on their three-dimensional
More information03-511/711 Computational Genomics and Molecular Biology, Fall
03-511/711 Computational Genomics and Molecular Biology, Fall 2011 1 Problem Set 0 Due Tuesday, September 6th This homework is intended to be a self-administered placement quiz, to help you (and me) determine
More information2018 Protein Modeling Exam Key
2018 Protein Modeling Exam Key Multiple Choice: 1. Which of the following amino acids has a negative charge at ph 7? a. Gln b. Glu c. Ser d. Cys 2. Which of the following is an example of secondary structure?
More informationCFSSP: Chou and Fasman Secondary Structure Prediction server
Wide Spectrum, Vol. 1, No. 9, (2013) pp 15-19 CFSSP: Chou and Fasman Secondary Structure Prediction server T. Ashok Kumar Department of Bioinformatics, Noorul Islam College of Arts and Science, Kumaracoil
More informationAntibody-Antigen recognition. Structural Biology Weekend Seminar Annegret Kramer
Antibody-Antigen recognition Structural Biology Weekend Seminar 10.07.2005 Annegret Kramer Contents Function and structure of antibodies Features of antibody-antigen interfaces Examples of antibody-antigen
More information7.013 Spring 2005 Problem Set 1
MIT Department of Biology 7.013: Introductory Biology Spring 005 Instructors: rofessor azel Sive, rofessor Tyler Jacks, Dr. laudette Gardel AME TA Section # 7.013 Spring 005 roblem Set 1 FRIDAY February
More informationBasic concepts of molecular biology
Basic concepts of molecular biology Gabriella Trucco Email: gabriella.trucco@unimi.it What is life made of? 1665: Robert Hooke discovered that organisms are composed of individual compartments called cells
More informationZool 3200: Cell Biology Exam 3 3/6/15
Name: Trask Zool 3200: Cell Biology Exam 3 3/6/15 Answer each of the following questions in the space provided; circle the correct answer or answers for each multiple choice question and circle either
More informationGene Expression Translation U C A G A G
Why? ene Expression Translation How do cells synthesize polypeptides and convert them to functional proteins? The message in your DN of who you are and how your body works is carried out by cells through
More informationProtein Folding Problem I400: Introduction to Bioinformatics
Protein Folding Problem I400: Introduction to Bioinformatics November 29, 2004 Protein biomolecule, macromolecule more than 50% of the dry weight of cells is proteins polymer of amino acids connected into
More information7.014 Problem Set 4 Answers to this problem set are to be turned in. Problem sets will not be accepted late. Solutions will be posted on the web.
MIT Department of Biology 7.014 Introductory Biology, Spring 2005 Name: Section : 7.014 Problem Set 4 Answers to this problem set are to be turned in. Problem sets will not be accepted late. Solutions
More informationResidue Contact Prediction for Protein Structure using 2-Norm Distances
Residue Contact Prediction for Protein Structure using 2-Norm Distances Nikita V Mahajan Department of Computer Science &Engg GH Raisoni College of Engineering, Nagpur LGMalik Department of Computer Science
More informationAmino Acid Sequences and Evolutionary Relationships. How do similarities in amino acid sequences of various species provide evidence for evolution?
Amino Acid Sequences and Evolutionary Relationships Name: How do similarities in amino acid sequences of various species provide evidence for evolution? An important technique used in determining evolutionary
More informationSupporting Information Contents
Supporting Information Choy Theng Loh, Kiyoshi Ozawa, Kellie L. Tuck, Nicholas Barlow, Thomas Huber, Gottfried Otting, and Bim Graham Lanthanide tags for site-specific ligation to an unnatural amino acid
More informationLecture 9 (10/2/17) Lecture 9 (10/2/17)
Lecture 9 (10/2/17) Reading: Ch4; 119-122, 125-126, 131-133 (a-helix) Ch4; 123-124, 130-131, 133, 137-138 (b-sheets) Problems: Ch4 (text); 2, 3, 4, 8, 13, 14 NEXT Reading: Ch4; 125, 138-141, 141-142 Problems:
More informationProtein Structure Prediction by Constraint Logic Programming
MPRI C2-19 Protein Structure Prediction by Constraint Logic Programming François Fages, Constraint Programming Group, INRIA Rocquencourt mailto:francois.fages@inria.fr http://contraintes.inria.fr/ Molecules
More informationWhat is DNA??? DNA = Deoxyribonucleic acid IT is a molecule that contains the code for an organism s growth and function
Review DNA and RNA 1) DNA and RNA are important organic compounds found in cells, called nucleic acids 2) Both DNA and RNA molecules contain the following chemical elements: carbon, hydrogen, oxygen, nitrogen
More informationProtein 3D Structure Prediction
Protein 3D Structure Prediction Michael Tress CNIO ?? MREYKLVVLGSGGVGKSALTVQFVQGIFVDE YDPTIEDSYRKQVEVDCQQCMLEILDTAGTE QFTAMRDLYMKNGQGFALVYSITAQSTFNDL QDLREQILRVKDTEDVPMILVGNKCDLEDER VVGKEQGQNLARQWCNCAFLESSAKSKINVN
More informationPacific Symposium on Biocomputing 4: (1999)
Applications of Knowledge Discovery to Molecular Biology: Identifying Structural Regularities in Proteins Shaobing Su, Diane J. Cook, and Lawrence B. Holder University of Texas at Arlington sandy su@sabre.com,
More information6-Foot Mini Toober Activity
Big Idea The interaction between the substrate and enzyme is highly specific. Even a slight change in shape of either the substrate or the enzyme may alter the efficient and selective ability of the enzyme
More informationPacific Symposium on Biocomputing 4: (1999)
U S I N G I N F O R M A T I O N T H E O R Y T O D I S C O V E R S I D E C H A I N R O T A M E R C L A S S E S : A N A L Y S I S O F T H E E F F E C T S O F L O C A L B A C K B O N E S T R U C T U R E J
More informationCase 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005
Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 9 September 005 Focus concept Purification of a novel seed storage protein allows sequence analysis and
More informationCh Biophysical Chemistry
Ch 247.53. Biophysical Chemistry Nina Rosario L. Rojas 2012-2013 sem 1 Review of Protein Structure Why structure? Primary, secondary, tertiary structure Disulfide bonds scheme 2 STRUCTURE- REGULAR STRUCTURE
More information7.014 Solution Set 4
7.014 Solution Set 4 Question 1 Shown below is a fragment of the sequence of a hypothetical bacterial gene. This gene encodes production of HWDWN, protein essential for metabolizing sugar yummose. The
More informationFundamentals of Biochemistry
Donald Voet Judith G. Voet Charlotte W. Pratt Fundamentals of Biochemistry Second Edition Chapter 6: Proteins: Three-Dimensional Structure Copyright 2006 by John Wiley & Sons, Inc. 1958, John Kendrew Any
More informationSolutions to Problem Set 1
MIT Department of Biology 7.014 Introductory Biology, Spring 004 Question 1 Solutions to 7.014 Problem Set 1 a) Describe the conditions of the atmosphere on prebiotic earth and how these conditions differ
More information466 Asn (N) to Ala (A) Generate beta dimer Interface
Table S1: Amino acid changes to the HexA α-subunit to convert the dimer interface from α to β and to introduce the putative GM2A binding surface from β- onto the α- subunit Residue position (α-numbering)
More informationLearning to Use PyMOL (includes instructions for PS #2)
Learning to Use PyMOL (includes instructions for PS #2) To begin, download the saved PyMOL session file, 4kyz.pse from the Chem 391 Assignments web page: http://people.reed.edu/~glasfeld/chem391/assign.html
More informationCh 10 Molecular Biology of the Gene
Ch 10 Molecular Biology of the Gene For Next Week Lab -Hand in questions from 4 and 5 by TUES in my mailbox (Biology Office) -Do questions for Lab 6 for next week -Lab practical next week Lecture Read
More informationAmino Acids and Proteins
Various Functions of Proteins SB203 Amino Acids and Proteins Jirundon Yuvaniyama, Ph.D. Department of Biochemistry Faculty of Science Mahidol University Enzymes Transport proteins utrient and storage proteins
More informationAlgorithms in Bioinformatics ONE Transcription Translation
Algorithms in Bioinformatics ONE Transcription Translation Sami Khuri Department of Computer Science San José State University sami.khuri@sjsu.edu Biology Review DNA RNA Proteins Central Dogma Transcription
More informationProtein Structure Prediction
Homology Modeling Protein Structure Prediction Ingo Ruczinski M T S K G G G Y F F Y D E L Y G V V V V L I V L S D E S Department of Biostatistics, Johns Hopkins University Fold Recognition b Initio Structure
More informationBIRKBECK COLLEGE (University of London)
BIRKBECK COLLEGE (University of London) SCHOOL OF BIOLOGICAL SCIENCES M.Sc. EXAMINATION FOR INTERNAL STUDENTS ON: Postgraduate Certificate in Principles of Protein Structure MSc Structural Molecular Biology
More informationProteins Higher Order Structures
Proteins Higher Order Structures Dr. Mohammad Alsenaidy Department of Pharmaceutics College of Pharmacy King Saud University Office: AA 101 msenaidy@ksu.edu.sa Previously on PHT 426!! Protein Structures
More informationProtein NMR II. Lecture 5
Protein NMR II Lecture 5 Standard and NMR chemical shifts in proteins Residue N A A B O Ala 123.8 4.35 52.5 19.0 177.1 ys 118.8 4.65 58.8 28.6 174.8 Asp 120.4 4.76 54.1 40.8 177.2 Glu 120.2 4.29 56.7 29.7
More informationSTRUCTURAL BIOLOGY. α/β structures Closed barrels Open twisted sheets Horseshoe folds
STRUCTURAL BIOLOGY α/β structures Closed barrels Open twisted sheets Horseshoe folds The α/β domains Most frequent domain structures are α/β domains: A central parallel or mixed β sheet Surrounded by α
More informationCS273: Algorithms for Structure Handout # 5 and Motion in Biology Stanford University Tuesday, 13 April 2004
CS273: Algorithms for Structure Handout # 5 and Motion in Biology Stanford University Tuesday, 13 April 2004 Lecture #5: 13 April 2004 Topics: Sequence motif identification Scribe: Samantha Chui 1 Introduction
More informationImmune system IgGs. Carla Cortinas, Eva Espigulé, Guillem Lopez-Grado, Margalida Roig, Valentina Salas. Group 2
Immune system IgGs Carla Cortinas, Eva Espigulé, Guillem Lopez-Grado, Margalida Roig, Valentina Salas Group 2 Index 1. Introduction 1.1. 1.2. 1.3. 1.4. 2. Immunoglobulins IgG formation IgG subclasses Structural
More informationProteomics Informatics (BMSC-GA 4437)
Proteomics Informatics (BMSC-GA 4437) Instructor David Fenyö Contact information David@FenyoLab.org htt://fenyolab.org/resentations/proteomics_informatics_2013/ Learning Objectives Be able analyze a roteomics
More informationHonors Research in Molecular Genetics Part 1
Third Base Honors Research in Molecular enetics Part 1 ll bout ene Expression How do cells synthesize polypeptides and convert them to functional proteins? The message in your DN of who you are and how
More informationBioinformatics. ONE Introduction to Biology. Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012
Bioinformatics ONE Introduction to Biology Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012 Biology Review DNA RNA Proteins Central Dogma Transcription Translation
More informationAli Yaghi. Tamara Wahbeh. Mamoun Ahram
28 Ali Yaghi Tamara Wahbeh Mamoun Ahram This sheet is a continuation of protein purification methods. Isoelectric focusing Separation of proteins based on Isoelectric points(charge),and it is a horizontal
More informationa) Give the sequence of the mrna transcribed from this gene and indicate the 5 and 3 ends of the mrna.
ame: Section : 7.014 Problem Set 4 nswers to this problem set are to be turned in at the box outside 68120 by 11:45 am, Wednesday, March 9. Problem sets will not be accepted late. Solutions will be posted
More informationMolecular design principles underlying β-strand swapping. in the adhesive dimerization of cadherins
Supplementary information for: Molecular design principles underlying β-strand swapping in the adhesive dimerization of cadherins Jeremie Vendome 1,2,3,5, Shoshana Posy 1,2,3,5,6, Xiangshu Jin, 1,3 Fabiana
More informationLecture for Wednesday. Dr. Prince BIOL 1408
Lecture for Wednesday Dr. Prince BIOL 1408 THE FLOW OF GENETIC INFORMATION FROM DNA TO RNA TO PROTEIN Copyright 2009 Pearson Education, Inc. Genes are expressed as proteins A gene is a segment of DNA that
More informationRecitation Section 20 April 25-26, Immunology. MIT Department of Biology Introductory Biology, Spring A. Antibody production
MIT Department of Biology 7.014 Introductory Biology, Spring 005. ntibody duction Immunology Recitation Section 0 pril 56, 005 Shown below is a schematic of the duction of a heavy chain polypeptide for
More informationAll Rights Reserved. U.S. Patents 6,471,520B1; 5,498,190; 5,916, North Market Street, Suite CC130A, Milwaukee, WI 53202
Secondary Structure In the previous protein folding activity, you created a hypothetical 15-amino acid protein and learned that basic principles of chemistry determine how each protein spontaneously folds
More informationChapter 8. One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model. Sebastian Kmiecik and Andrzej Kolinski.
Chapter 8 One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model Abstract Despite the significant increase in computational power, molecular modeling of protein structure using
More informationUnit 1. DNA and the Genome
Unit 1 DNA and the Genome Gene Expression Key Area 3 Vocabulary 1: Transcription Translation Phenotype RNA (mrna, trna, rrna) Codon Anticodon Ribosome RNA polymerase RNA splicing Introns Extrons Gene Expression
More informationFolding simulation: self-organization of 4-helix bundle protein. yellow = helical turns
Folding simulation: self-organization of 4-helix bundle protein yellow = helical turns Protein structure Protein: heteropolymer chain made of amino acid residues R + H 3 N - C - COO - H φ ψ Chain of amino
More information7.014 Quiz II Handout
7.014 Quiz II Handout Quiz II: Wednesday, March 17 12:05-12:55 54-100 **This will be a closed book exam** Quiz Review Session: Friday, March 12 7:00-9:00 pm room 54-100 Open Tutoring Session: Tuesday,
More informationVisualizing proteins with PyMol
Visualizing proteins with PyMol Structural Bioinformatics GENOME 541 Spring 2018 Lecture 1: Protein Structure Frank DiMaio (dimaio@uw.edu) Obtaining PyMOL We will use an educational build of PyMOL that
More informationDNA stands for deoxyribose nucleic acid DNA is a very large molecule made up of a long chain of sub-units The sub-units are called nucleotides Each
1 DNA stands for deoxyribose nucleic acid DNA is a very large molecule made up of a long chain of sub-units The sub-units are called nucleotides Each nucleotide is made up of a sugar called deoxyribose
More informationSequence Analysis '17 -- lecture Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction
Sequence Analysis '17 -- lecture 16 1. Secondary structure 3. Sequence similarity and homology 2. Secondary structure prediction Alpha helix Right-handed helix. H-bond is from the oxygen at i to the nitrogen
More informationThe Double Helix. DNA and RNA, part 2. Part A. Hint 1. The difference between purines and pyrimidines. Hint 2. Distinguish purines from pyrimidines
DNA and RNA, part 2 Due: 3:00pm on Wednesday, September 24, 2014 You will receive no credit for items you complete after the assignment is due. Grading Policy The Double Helix DNA, or deoxyribonucleic
More informationProteins: Wide range of func2ons. Polypep2des. Amino Acid Monomers
Proteins: Wide range of func2ons Proteins coded in DNA account for more than 50% of the dry mass of most cells Protein func9ons structural support storage transport cellular communica9ons movement defense
More informationProteins the primary biological macromolecules of living organisms
Proteins the primary biological macromolecules of living organisms Protein structure and folding Primary Secondary Tertiary Quaternary structure of proteins Structure of Proteins Protein molecules adopt
More informationProtein Structure. Protein Structure Tertiary & Quaternary
Lecture 4 Protein Structure Protein Structure Tertiary & Quaternary Dr. Sameh Sarray Hlaoui Primary structure: The linear sequence of amino acids held together by peptide bonds. Secondary structure: The
More informationLIST OF ACRONYMS & ABBREVIATIONS
LIST OF ACRONYMS & ABBREVIATIONS ALA ARG ASN ATD CRD CYS GLN GLU GLY GPCR HIS hstr ILE LEU LYS MET mglur1 NHDC PDB PHE PRO SER T1R2 T1R3 TMD TRP TYR THR 7-TM VFTM ZnSO 4 Alanine, A Arginine, R Asparagines,
More informationCS 4491/CS 7990 SPECIAL TOPICS IN BIOINFORMATICS
1 CS 4491/CS 7990 SPECIAL TOPICS IN BIOINFORMATICS * Some contents are adapted from Dr. Jean Gao at UT Arlington Mingon Kang, PhD Computer Science, Kennesaw State University 2 Genetics The discovery of
More information36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L-
36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L- 37. The essential fatty acids are A. palmitic acid B. linoleic acid C. linolenic
More informationProtein Structure Databases, cont. 11/09/05
11/9/05 Protein Structure Databases (continued) Prediction & Modeling Bioinformatics Seminars Nov 10 Thurs 3:40 Com S Seminar in 223 Atanasoff Computational Epidemiology Armin R. Mikler, Univ. North Texas
More informationDNA.notebook March 08, DNA Overview
DNA Overview Deoxyribonucleic Acid, or DNA, must be able to do 2 things: 1) give instructions for building and maintaining cells. 2) be copied each time a cell divides. DNA is made of subunits called nucleotides
More informationFourier-based classification of protein secondary structures
Source: Biochemical and Biophysical Research Communications, Vol. 485, No. 4, pp. 731-735, 2017; DOI:./j.bbrc.2017.02.7 Fourier-based classification of protein secondary structures Jian-Jun SHU, Kian Yan
More informationComparative Modeling Part 1. Jaroslaw Pillardy Computational Biology Service Unit Cornell Theory Center
Comparative Modeling Part 1 Jaroslaw Pillardy Computational Biology Service Unit Cornell Theory Center Function is the most important feature of a protein Function is related to structure Structure is
More information蛋白質體學. Proteomics Amino acids, Peptides and Proteins 陳威戎 & 21
蛋白質體學 Proteomics 2015 Amino acids, Peptides and Proteins 陳威戎 2015. 09. 14 & 21 Outline 1. Amino Acids 2. Peptides and Proteins 3. Covalent Structure of Proteins Amino Acids Proteins are polymers of amino
More informationSteroids. Steroids. Proteins: Wide range of func6ons. lipids characterized by a carbon skeleton consis3ng of four fused rings
Steroids Steroids lipids characterized by a carbon skeleton consis3ng of four fused rings 3 six sided, and 1 five sided Cholesterol important steroid precursor component in animal cell membranes Although
More informationProtein Structure Prediction. christian studer , EPFL
Protein Structure Prediction christian studer 17.11.2004, EPFL Content Definition of the problem Possible approaches DSSP / PSI-BLAST Generalization Results Definition of the problem Massive amounts of
More informationKEMM15 Lecture note in structural bioinformatics: A practical guide. S Al-Karadaghi, Biochemistry & Structural Biology, Lund University
KEMM15 Lecture note in structural bioinformatics: A practical guide S Al-Karadaghi, Biochemistry & Structural Biology, Lund University 1 BASICS OF PROTEIN STRUCTURE 3 SOME DEFINITIONS 3 THE 20 AMINO ACIDS
More informationA Crash Course in Genetics. A Crash Course in Genetics. General Overview: General Overview: DNA Is Structured Hierarchically
DN Structure DN Structure RN RN DN Replication DN Replication Encoding Proteins Encoding Proteins Protein Folding Protein Folding Types of DN Types of DN Manipulating DN Manipulating DN DN Is Structured
More informationStructure of the C-cadherin ectodomain and implications for the mechanism of cell adhesion
Structure of the C-cadherin ectodomain and implications for the mechanism of cell adhesion Titus J. Boggon, John Murray, Sophie Chappuis-Flament, Ellen Wong, Barry M. Gumbiner, and Lawrence Shapiro Ref.
More information