Supplemental materials

Size: px
Start display at page:

Download "Supplemental materials"

Transcription

1 1 2 Supplemental materials 3 4 The terminal oxidase cbb 3 functions in redox control of magnetite biomineralization in Magnetospirillum gryphiswaldense 5 Running title: Oxygen respiration and magnetite biomineralization Yingjie Li a, Oliver Raschdorf a,b, Karen T. Silva a, and Dirk Schüler a# a LudwigMaximiliansUniversität München, Department Biologie I, Mikrobiologie, Großhaderner Str. 24, PlaneggMartinsried, Germany; b Max Planck Institute of Biochemistry, Department of Molecular Structural Biology, Am Klopferspitz 18, Martinsried, Germany # To whom correspondence should be addressed. Dirk Schüler, Biozentrum der LMU, Großhaderner Str.24, PlaneggMartinsried, Tel.: ; Fax: ; dirk.schueler@lrz.unimuenchen.de. 1

2 16 17 Fig. S1 Biomineralization phenotypes of Δcbb 3 and Δaa 3 Δcbb 3 mutants incubated for 24 h (A and C) and 35 h (B and C) in microaerobic nitrate medium. Scale bar, 500 nm. 18 2

3 19 Table S1 Bacterial strains and plasmids used in this work Strain or plasmid Description Reference Strains E. coli DH5α F Φ80dlacZΔM15Δ(lacZYAargF)U169 deor reca1 enda1 hsdr17 (r k, m k +) phoa supe44 λ thi1 gyra96 rela1 E. coli BW29427 dap auxotroph derivative of E. coli strain B2155 Invitrogen K. Datsenko and B. L. Wanner, unpublished MSR1 WT Wild type R3/S1, but Rif r, Sm r (1) ΔMgfnr R3/S1, ΔMgfnr (Y. Li et al., submitted) Δaa 3 R3/S1, Δaa 3 This study Δbd R3/S1, Δbd This study Δcbb 3 R3/S1, Δcbb 3 This study ΔbdΔaa 3 R3/S1, ΔbdΔaa 3 This study Δaa 3 Δcbb 3 R3/S1, Δaa 3 Δcbb 3 This study ΔbdΔcbb 3 R3/S1, ΔbdΔcbb 3 This study Plasmids pbbr1mcs2 Km r, mobilizable broadhostrange vector (2) por093 mamx CXXCH (65,104)>AXXAH, pk19mobgii derivative, Km r (3) plyj97 pbbr1mcs2 plus gusa from pk19mobgii (4) plyj115 plyj97 plus cbb 3 promoter region This study plyj128 por093 plus 2kb fused flanking section of cconoqp This study plyj129 por093 plus 2kb fused flanking section of coxbac This study plyj130 por093 plus 2kb fused flanking section of cydab This study plyj135 plyj97 plus aa 3 promoter region This study plyj137 plyj97 plus bd promoter region This study plyj138 pbbr1mcs2 plus cbb 3 with its own promoter This study plyj139 pbbr1mcs2 plus aa 3 with its own promoter This study plyj140 pbbr1mcs2 plus bd with its own promoter This study 3

4 20 Table S2 BlastP analyses of operons encoding terminal oxidases in MTB and nonmtb using MSR1 as a query Protein in MSR1 mgr_2544 mgr_2545 mgr_2546 mgr_2547 Mgr_0911 Mgr_0912 Mgr_0914 Mgr_0697 Encoded gene product (aa, kda, pi) CcoN (532, 60.6, 9.09) CcoO (243, 27.0, 6.30) CcoQ (36, 4.4, 5.09) CcoP (291, 31.2, 5.90) CoxB (269, 30.1, 6.29) CoxA (526, 57.4, 7.96) CoxC (264, 29.5, 6.97) CydB (382, 41.3, 6.06) AMB1 (evalue, Amb4363 (4e137, 86%) Amb4364 (3e09, 91%) Amb4365 (8e133, 76%) Amb2170 (1e108, 76%) Amb2169 (0.0, 89%) Amb2168 (2e115, 79%) MS1 (evalue, WP_ (0.0, 93%) WP_ (7e137, 86%) MC1 (evalue, Mmc1_2353 (0.0, 80%) Mmc1_2354 (1e94, 70%) WP_ (1e134, 77%) WP_ (3e113, 77%) WP_ (0.0, 89%) WP_ (8e104, 78%) Mmc1_2355 (4e52, 49%) gene encoding the catalytic subunit of cbb 3 oxidase is not found in M. magneticum while the ccoq gene encoding a small membrane protein of unknown function is missing in Mc. marinus and the incomplete genome assembly of M. magnetotacticum. Mc. marinus strain RS1 harbors two cydab operons as well as another operon cyoabcde encoding a quinol oxidase bo 3 oxidase (DMR_14870, _14880, _14890, _14900, and _14910). RS1 (evalue, DMR_06970 (1e63, 54%) DMR_28310 (3e23, 43%) DMR_06960 (2e61, 46%) DMR_28300 Best hit in nonmtb (evalue, (0.0, 87%) (2e124, 82%) Rhodospirillum rubrum F11 (2e11, 88%) Phaeospirillum molischianum (5e123, 73%) (6e105, 77%) (0.0, 88%) Caenispirillum salinarum (7e105, 72%) (0.0, 87%) CydA Mgr_0698 (518, 57.6, 8.66) (0.0, 92%) (4e108, 55%) AMB1: Magnetospirillum magneticum; MS1: Magnetospirillum magnetotacticum; MC1: Magnetococcus marinus; RS1: Desulfovibrio magneticus.the ccon 4

5 25 26 Table S3 Growth (OD 565 nm ), magnetic response (C mag ), and magnetosome crystal size of various terminal oxidase mutants under different conditions. Strain OD 565 nm C mag Crystal size (nm) n 0% O 2 WT 0.13 ± ± ± Δaa ± ± ± Δbd 0.13 ± ± ± ΔbdΔaa ± ± ± Δcbb ± ± ± Δaa 3 Δcbb ± ± ± ΔbdΔcbb ± ± ± % O 2, +NO 3 WT 0.22 ± ± ± Δaa ± ± ± Δbd 0.20 ± ± ± ΔbdΔaa ± ± ± % O 2, +NH 4 WT 0.11 ± ± 0.1 Δaa ± ± 0.0 Δbd 0.10 ± ± 0.1 ΔbdΔaa ± ± 0.1 Number of crystals measured for each strain (n) is presented in the last column. 28 References Schultheiss D, Kube M, Schüler D Inactivation of the flagellin gene flaa in Magnetospirillum gryphiswaldense results in nonmagnetotactic mutants lacking flagellar filaments. Appl. Environ. Microbiol. 70: Kovach ME, Elzer PH, Hill DS, Robertson GT, Farris MA, Roop RM, Peterson KM Four new derivatives of the broadhostrange cloning vector pbbr1mcs, carrying different antibioticresistance cassettes. Gene 166: Raschdorf O, Müller FD, Posfai M, Plitzko JM, Schüler D The magnetosome proteins MamX, MamZ and MamH are involved in redox control of magnetite biomineralization in Magnetospirillum gryphiswaldense. Mol. Microbiol. 89: Li Y, Katzmann E, Borg S, Schüler D The periplasmic nitrate reductase Nap is required for anaerobic growth and involved in redox control of magnetite biomineralization in Magnetospirillum gryphiswaldense. J. Bacteriol. 194:

Optimization of gene expression cassette for M. gryphiswaldense

Optimization of gene expression cassette for M. gryphiswaldense Optimization of gene expression cassette for M. gryphiswaldense A) 325 bp P mamdc 270 bp 170 bp 102 bp 45 bp egfp Gradual truncation P mamdc45 egfp minimal transcriptionally active promoter B) P mamdc45

More information

Supplementary Material. Increased heterocyst frequency by patn disruption in Anabaena leads to enhanced photobiological

Supplementary Material. Increased heterocyst frequency by patn disruption in Anabaena leads to enhanced photobiological Supplementary Material Increased heterocyst frequency by patn disruption in Anabaena leads to enhanced photobiological hydrogen production at high light intensity and high cell density Applied Microbiology

More information

Deletion of a fur-like Gene Affects Iron Homeostasis and Magnetosome Formation in Magnetospirillum gryphiswaldense

Deletion of a fur-like Gene Affects Iron Homeostasis and Magnetosome Formation in Magnetospirillum gryphiswaldense JOURNAL OF BACTERIOLOGY, Aug. 2010, p. 4192 4204 Vol. 192, No. 16 0021-9193/10/$12.00 doi:10.1128/jb.00319-10 Copyright 2010, American Society for Microbiology. All Rights Reserved. Deletion of a fur-like

More information

Table S1. Bacterial strains (Related to Results and Experimental Procedures)

Table S1. Bacterial strains (Related to Results and Experimental Procedures) Table S1. Bacterial strains (Related to Results and Experimental Procedures) Strain number Relevant genotype Source or reference 1045 AB1157 Graham Walker (Donnelly and Walker, 1989) 2458 3084 (MG1655)

More information

TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter

TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter L M Guzman et al. (1995) Journal of Bacteriology 177: 4121-4130 Outline 1. Introduction 2. Objective 3.

More information

Supporting Information-Tables

Supporting Information-Tables Supporting Information-Tables Table S1. Bacterial strains and plasmids used in this work Bacterial strains Description Source of reference Streptococcus pneumoniae 1 Cp1015 non-capsulated and βl susceptible

More information

Supplemental Fig. S1. Key to underlines: Key to amino acids:

Supplemental Fig. S1. Key to underlines: Key to amino acids: AspA-F1 AspA 1 MKQMETKGYGYFRKTKAYGLVCGIT--------------LAGALTLGTTSVSADDVTTLNPATNLTTLQTPPTADQTQLAHQAGQQSGELVSEVSNTEWD 86 SspB 1 MQKREV--FG-FRKSKVAKTLCGAV-LGAALIAIADQQVLADEVTETNSTANVAVTTTGNPATNLPEAQGEATEAASQSQAQAGSKDGALPVEVSADDLN

More information

UNIVERSITY OF YORK BA, BSc, and MSc Degree Examinations

UNIVERSITY OF YORK BA, BSc, and MSc Degree Examinations Examination Candidate Number: Desk Number: UNIVERSITY OF YORK BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Bacterial pathogenesis Time Allowed: 2 hours Marking Scheme:

More information

Segregation of prokaryotic magnetosomes organelles is driven by treadmilling of a dynamic actin-like MamK filament. Toro-Nahuelpan et al.

Segregation of prokaryotic magnetosomes organelles is driven by treadmilling of a dynamic actin-like MamK filament. Toro-Nahuelpan et al. Segregation of prokaryotic magnetosomes organelles is driven by treadmilling of a dynamic actin-like MamK filament Toro-Nahuelpan et al. Toro-Nahuelpan et al. BMC Biology (2016) 14:88 DOI 10.1186/s12915-016-0290-1

More information

Confirming the Phenotypes of E. coli Strains

Confirming the Phenotypes of E. coli Strains Confirming the Phenotypes of E. coli Strains INTRODUCTION Before undertaking any experiments, we need to confirm that the phenotypes of the E. coli strains we intend to use in the planned experiments correspond

More information

Competence Modulation by the NADH Oxidase of Streptococcus pneumoniae Involves Signal Transduction

Competence Modulation by the NADH Oxidase of Streptococcus pneumoniae Involves Signal Transduction JOURNAL OF BACTERIOLOGY, Jan. 2001, p. 768 772 Vol. 183, No. 2 0021-9193/01/$04.00 0 DOI: 10.1128/JB.183.2.768 772.2001 Copyright 2001, American Society for Microbiology. All Rights Reserved. Competence

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/10/494/eaan6284/dc1 Supplementary Materials for Activation of master virulence regulator PhoP in acidic ph requires the Salmonella-specific protein UgtL Jeongjoon

More information

Figure S1. Figure S2. Figure S3 HB Anti-FSP27 (COOH-terminal peptide) Ab. Anti-GST-FSP27(45-127) Ab.

Figure S1. Figure S2. Figure S3 HB Anti-FSP27 (COOH-terminal peptide) Ab. Anti-GST-FSP27(45-127) Ab. / 36B4 mrna ratio Figure S1 * 2. 1.6 1.2.8 *.4 control TNFα BRL49653 Figure S2 Su bw AT p iw Anti- (COOH-terminal peptide) Ab Blot : Anti-GST-(45-127) Ab β-actin Figure S3 HB2 HW AT BA T Figure S4 A TAG

More information

Genome Sequence Assembly

Genome Sequence Assembly Genome Sequence Assembly Learning Goals: Introduce the field of bioinformatics Familiarize the student with performing sequence alignments Understand the assembly process in genome sequencing Introduction:

More information

Materials and methods. by University of Washington Yeast Resource Center) from several promoters, including

Materials and methods. by University of Washington Yeast Resource Center) from several promoters, including Supporting online material for Elowitz et al. report Materials and methods Strains and plasmids. Plasmids expressing CFP or YFP (wild-type codons, developed by University of Washington Yeast Resource Center)

More information

BA, BSc, and MSc Degree Examinations

BA, BSc, and MSc Degree Examinations Examination Candidate Number: Desk Number: BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Bacterial pathogenesis Time Allowed: 2 hours Marking Scheme: Total marks available

More information

MIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr.

MIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. MIT Department of Biology 7.01: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. Claudette Gardel iv) Would Xba I be useful for cloning? Why or why not?

More information

Pyochelin potentiates the inhibitory activity of gallium on Pseudomonas aeruginosa SUPPLEMENTAL MATERIAL

Pyochelin potentiates the inhibitory activity of gallium on Pseudomonas aeruginosa SUPPLEMENTAL MATERIAL Pyochelin potentiates the inhibitory activity of gallium on Pseudomonas aeruginosa by Frangipani E., Bonchi C., Minandri F., Imperi F., and Visca P. 3 4 SUPPLEMENTAL MATERIAL 5 6 TABLE S. Strains, plasmids

More information

Solutions to Quiz II

Solutions to Quiz II MIT Department of Biology 7.014 Introductory Biology, Spring 2005 Solutions to 7.014 Quiz II Class Average = 79 Median = 82 Grade Range % A 90-100 27 B 75-89 37 C 59 74 25 D 41 58 7 F 0 40 2 Question 1

More information

Initial Stages in Creating a laci Knockout in Escherichia coli C29 Using the Lambda Red Recombinase System

Initial Stages in Creating a laci Knockout in Escherichia coli C29 Using the Lambda Red Recombinase System Initial Stages in Creating a laci Knockout in Escherichia coli C29 Using the Lambda Red Recombinase System AMY JAEGER, PETER SIMS, ROBIN SIDSWORTH, AND NOA TINT Department of Microbiology & Immunology,

More information

HI-Control BL21(DE3) & HI-Control 10G Chemically Competent Cells

HI-Control BL21(DE3) & HI-Control 10G Chemically Competent Cells HI-Control BL21(DE3) & HI-Control 10G Chemically Competent Cells FOR RESEARCH USE ONLY. NOT FOR HUMAN OR DIAGNOSTIC USE MA156 Rev.31OCT2016 Table of Contents Components & Storage Conditions... 3 HI-Control

More information

Cytochrome c Maturation and the Physiological Role of c-type Cytochromes in Vibrio cholerae

Cytochrome c Maturation and the Physiological Role of c-type Cytochromes in Vibrio cholerae JOURNAL OF BACTERIOLOGY, Sept. 2005, p. 5996 6004 Vol. 187, No. 17 0021-9193/05/$08.00 0 doi:10.1128/jb.187.17.5996 6004.2005 Copyright 2005, American Society for Microbiology. All Rights Reserved. Cytochrome

More information

Human Cell-Free Protein Expression Maxi System

Human Cell-Free Protein Expression Maxi System Cat. # 3285 For Research Use Human Cell-Free Protein Expression Maxi System Product Manual Table of Contents I. Description... 3 II. Components... 4 III. Materials Required but not Provided... 5 IV. Storage...

More information

Franzens-Universitaet Graz, Humboldtstrasse 50, 8010 Graz. Phone: ++43 (0) Fax: ++43 (0)

Franzens-Universitaet Graz, Humboldtstrasse 50, 8010 Graz. Phone: ++43 (0) Fax: ++43 (0) Extracellular nucleases and extracellular DNA play important roles in Vibrio cholerae biofilm formation Andrea Seper 1, Vera H. I. Fengler 1, Sandro Roier 1, Heimo Wolinski 1, Sepp D. Kohlwein 1, Anne

More information

SUPPLEMENTAL MATERIAL FOR. Structure of Bacterial Transcription Factor SpoIIID and Evidence for a Novel

SUPPLEMENTAL MATERIAL FOR. Structure of Bacterial Transcription Factor SpoIIID and Evidence for a Novel SUPPLEMENTAL MATERIAL FOR Structure of Bacterial Transcription Factor SpoIIID and Evidence for a Novel Mode of DNA Binding Bin Chen, Paul Himes, Yu Liu, Yang Zhang, Zhenwei Lu, Aizhuo Liu, Honggao Yan,

More information

F 11/23 Happy Thanksgiving! 8 M 11/26 Gene identification in the genomic era Bamshad et al. Nature Reviews Genetics 12: , 2011

F 11/23 Happy Thanksgiving! 8 M 11/26 Gene identification in the genomic era Bamshad et al. Nature Reviews Genetics 12: , 2011 3 rd Edition 4 th Edition Lecture Day Date Topic Reading Problems Reading Problems 1 M 11/5 Complementation testing reveals that genes are distinct entities Ch. 7 224-232 2 W 11/7 One gene makes one protein

More information

Applied Microbiology and Biotechnology. De-bugging and maximizing plant cytochrome P450 production in Escherichia coli with C-terminal GFP-fusions

Applied Microbiology and Biotechnology. De-bugging and maximizing plant cytochrome P450 production in Escherichia coli with C-terminal GFP-fusions Applied Microbiology and Biotechnology De-bugging and maximizing plant cytochrome P450 production in Escherichia coli with C-terminal GFP-fusions Ulla Christensen 1, Dario V. Albacete 1, Karina M. Søgaard

More information

Midterm 2 Review Session. Megan McBee November 7th, 2006

Midterm 2 Review Session. Megan McBee November 7th, 2006 20.106 Midterm 2 Review Session Megan McBee November 7th, 2006 Topics Nitrogen Cycle Communities, symbiosis, genome reduction Horizontal Gene Transfer Biotechnology Nitrogen Cycle Important Reactions Nitrogen

More information

Strains for production of RcoM Bx -1 proteins and assay of in vivo activity.

Strains for production of RcoM Bx -1 proteins and assay of in vivo activity. Strains for production of RcoM Bx -1 proteins and assay of in vivo activity. The following plasmids and strains are components of the protein production and in vivo assay system for the CO-dependent RcoM-1

More information

Regulation of Quorum Sensing by RpoS in Pseudomonas aeruginosa

Regulation of Quorum Sensing by RpoS in Pseudomonas aeruginosa JOURNAL OF BACTERIOLOGY, Aug. 2000, p. 4356 4360 Vol. 182, No. 15 0021-9193/00/$04.00 0 Copyright 2000, American Society for Microbiology. All Rights Reserved. Regulation of Quorum Sensing by RpoS in Pseudomonas

More information

7.013 Problem Set 3 FRIDAY October 8th, 2004

7.013 Problem Set 3 FRIDAY October 8th, 2004 MIT Biology Department 7.012: Introductory Biology - Fall 2004 Instructors: Professor Eric Lander, Professor Robert. Weinberg, Dr. laudette ardel Name: T: 7.013 Problem Set 3 FRIDY October 8th, 2004 Problem

More information

Respiration of Escherichia coli in the Mouse Intestine

Respiration of Escherichia coli in the Mouse Intestine INFECTION AND IMMUNITY, Oct. 2007, p. 4891 4899 Vol. 75, No. 10 0019-9567/07/$08.00 0 doi:10.1128/iai.00484-07 Copyright 2007, American Society for Microbiology. All Rights Reserved. Respiration of Escherichia

More information

Genome research in eukaryotes

Genome research in eukaryotes Functional Genomics Genome and EST sequencing can tell us how many POTENTIAL genes are present in the genome Proteomics can tell us about proteins and their interactions The goal of functional genomics

More information

Supplementary Material

Supplementary Material Supplementary Material Gene Inactivation Study on gntk, a Putative C-methyltransferase Gene in Gentamicin Biosynthesis from Micromonospora echinospora Suman Karki Jin-Yong Kim Si-Hyung Park Hyung-Jin Kwon

More information

Building Better Algae

Building Better Algae Building Better Algae Craig Marcus, Ph.D. Dept. of Environmental & Molecular Toxicology Domestication of Algae as a New Crop Must develop a rapid process (corn first domesticated ~4000 B.C.) Requires a

More information

SI Results Peculiarities in the consumption of ammonium and glucose by AmtB- strains SI Materials and Methods Strain Construction

SI Results Peculiarities in the consumption of ammonium and glucose by AmtB- strains SI Materials and Methods Strain Construction SI Results Peculiarities in the consumption of ammonium and glucose by AmtB - strains. The AmtB - strain failed to consume all the ammonium in the medium under NH 3 -limiting conditions (.5 mm total ammonium

More information

BacterioMatch II Two-Hybrid System XR Plasmid cdna Library

BacterioMatch II Two-Hybrid System XR Plasmid cdna Library BacterioMatch II Two-Hybrid System XR Plasmid cdna Library INSTRUCTION MANUAL BN #982000 Revision A For In Vitro Use Only 982000-12 LIMITED PRODUCT WARRANTY This warranty limits our liability to replacement

More information

AcrS is an Activator of acrd Expression in Escherichia coli K-12 Following Exposure to Sub-inhibitory Concentration of Kanamycin Pretreatment

AcrS is an Activator of acrd Expression in Escherichia coli K-12 Following Exposure to Sub-inhibitory Concentration of Kanamycin Pretreatment AcrS is an Activator of acrd Expression in Escherichia coli K-12 Following Exposure to Sub-inhibitory Concentration of Kanamycin Pretreatment Mariam Emami, Stella Xu, Thomas Chan Department Microbiology

More information

Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions

Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Supporting Information Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Lise Schoonen, b Sjors Maassen, b Roeland J. M. Nolte b and Jan C. M. van

More information

Genetic Background Page 1 PHAGE P22

Genetic Background Page 1 PHAGE P22 Genetic Background Page 1 PHAGE P22 Growth of P22. P22 is a temperate phage that infects Salmonella by binding to the O-antigen, part of the lipopolysaccharide on the outer membrane. After infection, P22

More information

History of the CFTR chase

History of the CFTR chase Module II: Molecular and cellular phenotype Discuss the history of the gene. When was the gene discovered? How was the gene cloned? (Be brief.) Discuss the cellular phenotype. What cells or tissues are

More information

Cloning and Characterization of E. meningoseptica Beta Lactamase

Cloning and Characterization of E. meningoseptica Beta Lactamase Cloning and Characterization of E. meningoseptica Beta Lactamase Authors: Lindsey Purcell, Jessica Matts, Patricia Canaan* Department of Biochemistry and Molecular Biology Abstract Elizabethkingia meningoseptica

More information

TransforMax EPI300 Electrocompetent E. coli TransforMax EPI300 Chemically Competent E. coli

TransforMax EPI300 Electrocompetent E. coli TransforMax EPI300 Chemically Competent E. coli TransforMax EPI300 Electrocompetent E. coli TransforMax EPI300 Chemically Competent E. coli Cat. Nos. EC300102, EC300110, EC300150, and C300C105 Available exclusively thru Lucigen. lucigen.com/epibio www.lucigen.com

More information

encodes a sigma factor to modify the recognition of the E.coli RNA polymerase (Several other answers would also be acceptable for each phage)

encodes a sigma factor to modify the recognition of the E.coli RNA polymerase (Several other answers would also be acceptable for each phage) Name Student ID# Bacterial Genetics, BIO 4443/6443 Spring Semester 2001 Final Exam 1.) Different bacteriophage utilize different mechanisms to ensure that their own genes (and not host s genes) are transcribed

More information

Gateway Vectors for BiFC

Gateway Vectors for BiFC Gateway Vectors for BiFC 1. The enhanced YFP (EYFP) are used (Split EYFP). 2. The Fusion fusion gene is expressed by CaMV35S promoter. 3. The N- or C-terminal fragments of EYFP are fused subsequent to

More information

BA, BSc, and MSc Degree Examinations

BA, BSc, and MSc Degree Examinations Examination Candidate Number: Desk Number: BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Genetics Time Allowed: 1 hour and 30 minutes Marking Scheme: Total marks available

More information

Received: 13 November 2013 / Revised: 2 April 2014 / Accepted: 9 April 2014 / Published online: 24 April 2014 Springer-Verlag Berlin Heidelberg 2014

Received: 13 November 2013 / Revised: 2 April 2014 / Accepted: 9 April 2014 / Published online: 24 April 2014 Springer-Verlag Berlin Heidelberg 2014 Arch Microbiol (2014) 196:481 488 DOI 10.1007/s00203-014-0984-0 Original Paper Subcellular localization of the magnetosome protein MamC in the marine magnetotactic bacterium Magnetococcus marinus strain

More information

Microbial Biotechnology agustin krisna wardani

Microbial Biotechnology agustin krisna wardani Microbial Biotechnology agustin krisna wardani 1. The Structure of Microbes Microbes (microorganisms) are tiny organisms that are too small to be seen individually by the naked eye and must be viewed with

More information

Diagnosis Sanger. Interpreting and Troubleshooting Chromatograms. Volume 1: Help! No Data! GENEWIZ Technical Support

Diagnosis Sanger. Interpreting and Troubleshooting Chromatograms. Volume 1: Help! No Data! GENEWIZ Technical Support Diagnosis Sanger Interpreting and Troubleshooting Chromatograms GENEWIZ Technical Support DNAseq@genewiz.com Troubleshooting This troubleshooting guide is based on common issues seen from samples within

More information

FINDING GENES AND EXPLORING THE GENE PAGE AND RUNNING A BLAST (Exercise 1)

FINDING GENES AND EXPLORING THE GENE PAGE AND RUNNING A BLAST (Exercise 1) FINDING GENES AND EXPLORING THE GENE PAGE AND RUNNING A BLAST (Exercise 1) 1.1 Finding a gene using text search. Note: For this exercise use http://www.plasmodb.org a. Find all possible kinases in Plasmodium.

More information

Chapter 11. Restriction mapping. Objectives

Chapter 11. Restriction mapping. Objectives Restriction mapping Restriction endonucleases (REs) are part of bacterial defense systems. REs recognize and cleave specific sites in DNA molecules. REs are an indispensable tool in molecular biology for

More information

TECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits

TECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits Catalog Numbers APPA001 In Vitro Bacterial Split GFP "Fold 'n' Glow" Solubility Assay Kit (Green) APPA008 In Vitro Bacterial

More information

The GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity

The GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity Promega Notes Magazine Number 62, 1997, p. 02 The GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity By Christine Andrews and Scott Lesley Promega

More information

Guangdong Province Key Laboratory of Pharmacodynamic Constituents of TCM and New Drugs Research, Jinan University, Guangzhou, , China

Guangdong Province Key Laboratory of Pharmacodynamic Constituents of TCM and New Drugs Research, Jinan University, Guangzhou, , China Development of a versatile and conventional technique for gene disruption in filamentous fungi based on CRISPR-Cas9 technology Yan-Mei Zheng, 1, + Fu-Long Lin, 1, + Hao Gao, 1, * Gen Zou, 2 Jiang-Wei Zhang,

More information

TransforMax EPI300 Electrocompetent E. coli TransforMax EPI300 Chemically Competent E. coli

TransforMax EPI300 Electrocompetent E. coli TransforMax EPI300 Chemically Competent E. coli TransforMax EPI300 Electrocompetent E. coli TransforMax EPI300 Chemically Competent E. coli Cat. Nos. EC300105, EC300110, EC300150, and C300C105 Connect with Epicentre on our blog (epicentral.blogspot.com),

More information

A Discovery Laboratory Investigating Bacterial Gene Regulation

A Discovery Laboratory Investigating Bacterial Gene Regulation Chapter 8 A Discovery Laboratory Investigating Bacterial Gene Regulation Robert Moss Wofford College 429 N. Church Street Spartanburg, SC 29307 mosssre@wofford.edu Bob Moss is an Associate Professor of

More information

Lambda DASH II Library

Lambda DASH II Library Lambda DASH II Library INSTRUCTION MANUAL Revision A For In Vitro Use Only 945301-12 LIMITED PRODUCT WARRANTY This warranty limits our liability to replacement of this product. No other warranties of any

More information

Designing and creating your gene knockout Background The rada gene was identified as a gene, that when mutated, caused cells to become hypersensitive

Designing and creating your gene knockout Background The rada gene was identified as a gene, that when mutated, caused cells to become hypersensitive Designing and creating your gene knockout Background The rada gene was identified as a gene, that when mutated, caused cells to become hypersensitive to ionizing radiation. However, why these mutants are

More information

Role of Cyclic Di-GMP during El Tor Biotype Vibrio cholerae Infection: Characterization of the In Vivo-Induced Cyclic Di-GMP Phosphodiesterase CdpA

Role of Cyclic Di-GMP during El Tor Biotype Vibrio cholerae Infection: Characterization of the In Vivo-Induced Cyclic Di-GMP Phosphodiesterase CdpA INFECTION AND IMMUNITY, Apr. 2008, p. 1617 1627 Vol. 76, No. 4 0019-9567/08/$08.00 0 doi:10.1128/iai.01337-07 Copyright 2008, American Society for Microbiology. All Rights Reserved. Role of Cyclic Di-GMP

More information

Answers to Module 1. An obligate aerobe is an organism that has an absolute requirement of oxygen for growth.

Answers to Module 1. An obligate aerobe is an organism that has an absolute requirement of oxygen for growth. Answers to Module 1 Short Answers 1) What is an obligate aerobe? An obligate aerobe is an organism that has an absolute requirement of oxygen for growth. What about facultative anaerobe? 2) Distinguish

More information

Matthew I. Hutchings, 1 Jason C. Crack, 2 Neil Shearer, 1 Benjamin J. Thompson, 1 Andrew J. Thomson, 2 and Stephen Spiro 1 *

Matthew I. Hutchings, 1 Jason C. Crack, 2 Neil Shearer, 1 Benjamin J. Thompson, 1 Andrew J. Thomson, 2 and Stephen Spiro 1 * JOURNAL OF BACTERIOLOGY, Jan. 2002, p. 503 508 Vol. 184, No. 2 0021-9193/02/$04.00 0 DOI: 10.1128/JB.184.2.503 508.2002 Copyright 2002, American Society for Microbiology. All Rights Reserved. Transcription

More information

KOD -Plus- Mutagenesis Kit

KOD -Plus- Mutagenesis Kit Instruction manual KOD -Plus- Mutagenesis Kit 0811 F0936K KOD -Plus- Mutagenesis Kit SMK-101 20 reactions Store at -20 C Contents [1] Introduction [2] Flow chart [3] Components [4] Notes [5] Protocol 1.

More information

1. DNA Cloning. Blunt-end DNA Cloning Kits TA DNA Cloning Kits Universal DNA Cloning Kits Chemically competent cells Mutagenesis Other compounds

1. DNA Cloning. Blunt-end DNA Cloning Kits TA DNA Cloning Kits Universal DNA Cloning Kits Chemically competent cells Mutagenesis Other compounds 1. DNA Cloning Blunt-end DNA Cloning Kits TA DNA Cloning Kits Universal DNA Cloning Kits Chemically competent cells Mutagenesis Other compounds Photo: Embryo of lily ovary 10 Accelerating your Molecular

More information

Certificate of Analysis

Certificate of Analysis Certificate of Analysis pet6xhn Expression Vector Set Contents Product Information... 1 pet6xhn-n, pet6xhn-c, and pet6xhn-gfpuv Vector Information... 2 Location of Features... 4 Additional Information...

More information

Mutating Asn-666 to Glu in the O-helix region of the taq DNA polymerase gene

Mutating Asn-666 to Glu in the O-helix region of the taq DNA polymerase gene Research in Pharmaceutical Sciences, April 2010; 5(1): 15-19 Received: Oct 2009 Accepted: Jan 2010 School of Pharmacy & Pharmaceutical Sciences 15 Isfahan University of Medical Sciences Original Article

More information

Practice Problems for Recombinant DNA, Session 4: cdna Libraries and Expression Libraries

Practice Problems for Recombinant DNA, Session 4: cdna Libraries and Expression Libraries Practice Problems for Recombinant DNA, Session 4: cdna Libraries and Expression Libraries Question 1 In a hypothetical scenario you wake up one morning to your roommate exclaiming about her sudden hair

More information

ETHYLBENZENE DEHYDROGENASE: OXIDATION OF HYDROCARBONS WITHOUT OXYGEN

ETHYLBENZENE DEHYDROGENASE: OXIDATION OF HYDROCARBONS WITHOUT OXYGEN ETHYLBENZENE DEHYDRGENASE: XIDATIN F HYDRCARBNS WITHUT XYGEN M. Szaleniec 1, B. Jobst 2, J. Heider 2 1. Institute of Catalysis and Surface Chemistry, PAS, Kraków, Poland 2. Mikrobiologie, Institut für

More information

Di erential regulation of amoa and amob gene copies in Nitrosomonas europaea

Di erential regulation of amoa and amob gene copies in Nitrosomonas europaea FEMS Microbiology Letters 192 (2000) 163^168 www.fems-microbiology.org Di erential regulation of amoa and amob gene copies in Nitrosomonas europaea Lisa Y. Stein, Luis A. Sayavedra-Soto, Norman G. Hommes,

More information

CopyCutter EPI400 Electrocompetent E. coli CopyCutter EPI400 Chemically Competent E. coli CopyCutter Induction Solution

CopyCutter EPI400 Electrocompetent E. coli CopyCutter EPI400 Chemically Competent E. coli CopyCutter Induction Solution CopyCutter EPI400 Electrocompetent E. coli CopyCutter EPI400 Chemically Competent E. coli CopyCutter Induction Solution Cat. Nos. C400EL10, C400CH10, and CIS40025 Available exclusively thru Lucigen. lucigen.com/epibio

More information

Biotechnology and Energy Conservation. Prof. Dr.oec.troph. Ir. Krishna Purnawan Candra, M.S. Program Magister Ilmu Lingkungan Universitas Mulawarman

Biotechnology and Energy Conservation. Prof. Dr.oec.troph. Ir. Krishna Purnawan Candra, M.S. Program Magister Ilmu Lingkungan Universitas Mulawarman Biotechnology and Energy Conservation Prof. Dr.oec.troph. Ir. Krishna Purnawan Candra, M.S. Program Magister Ilmu Lingkungan Universitas Mulawarman 12 th Lecture Genetic Engineering The Aim: Students can

More information

Functional and Topological Characterization of Novel Components of the comb DNA Transformation Competence System in Helicobacter pylori

Functional and Topological Characterization of Novel Components of the comb DNA Transformation Competence System in Helicobacter pylori JOURNAL OF BACTERIOLOGY, Feb. 2006, p. 882 893 Vol. 188, No. 3 0021-9193/06/$08.00 0 doi:10.1128/jb.188.3.882 893.2006 Copyright 2006, American Society for Microbiology. All Rights Reserved. Functional

More information

A Novel Regulatory Protein Involved in Motility of Vibrio cholerae

A Novel Regulatory Protein Involved in Motility of Vibrio cholerae JOURNAL OF BACTERIOLOGY, Nov. 2009, p. 7027 7038 Vol. 191, No. 22 0021-9193/09/$12.00 doi:10.1128/jb.00948-09 Copyright 2009, American Society for Microbiology. All Rights Reserved. A Novel Regulatory

More information

Vibrio fischeri Flagellin A Is Essential for Normal Motility and for Symbiotic Competence during Initial Squid Light Organ Colonization

Vibrio fischeri Flagellin A Is Essential for Normal Motility and for Symbiotic Competence during Initial Squid Light Organ Colonization JOURNAL OF BACTERIOLOGY, July 2004, p. 4315 4325 Vol. 186, No. 13 0021-9193/04/$08.00 0 DOI: 10.1128/JB.186.13.4315 4325.2004 Copyright 2004, American Society for Microbiology. All Rights Reserved. Vibrio

More information

Supplemental Data. Aung et al. (2011). Plant Cell /tpc

Supplemental Data. Aung et al. (2011). Plant Cell /tpc 35S pro:pmd1-yfp 10 µm Supplemental Figure 1. -terminal YFP fusion of PMD1 (PMD1-YFP, in green) is localized to the cytosol. grobacterium cells harboring 35S pro :PMD1-YFP were infiltrated into tobacco

More information

Computational Biology I LSM5191

Computational Biology I LSM5191 Computational Biology I LSM5191 Lecture 5 Notes: Genetic manipulation & Molecular Biology techniques Broad Overview of: Enzymatic tools in Molecular Biology Gel electrophoresis Restriction mapping DNA

More information

A-PG hydrolysis by PA0919

A-PG hydrolysis by PA0919 SUPPORTING INFORMATION Identification and characterization of a periplasmic Aminoacyl-Phosphatidylglycerol Hydrolase responsible for Pseudomonas aeruginosa lipid homeostasis* Wiebke Arendt 1, Maike K.

More information

Journal of Experimental Microbiology and Immunology (JEMI) Vol. 20: Copyright April 2016, M&I UBC

Journal of Experimental Microbiology and Immunology (JEMI) Vol. 20: Copyright April 2016, M&I UBC The Major Periplasmic Domain of YidC May Be Required for Polar Localization of a Green Fluorescence Protein Tagged YidC Variant Protein in Escherichia coli Peter Xu, Kevin He, Steven Yan Department of

More information

BIOCHEMISTRY 551: BIOCHEMICAL METHODS SYLLABUS

BIOCHEMISTRY 551: BIOCHEMICAL METHODS SYLLABUS BIOCHEMISTRY 551: BIOCHEMICAL METHODS SYLLABUS Course Description: Biochemistry 551 is an integrated lecture, lab and seminar course that covers biochemistry-centered theory and techniques. The course

More information

Synthetic Biology for

Synthetic Biology for Synthetic Biology for Plasmids and DNA Digestion Plasmids Plasmids are small DNA molecules that are separate from chromosomal DNA They are most commonly found as double stranded, circular DNA Typical plasmids

More information

REGISTRATION DOCUMENT FOR RECOMBINANT DNA RESEARCH

REGISTRATION DOCUMENT FOR RECOMBINANT DNA RESEARCH EHRS Date Received: Reg. Doc. No.: REGISTRATION DOCUMENT FOR RECOMBINANT DNA RESEARCH Principal Investigator: Penn ID#: Position Title: School: Department: Mailing Address: Mail Code: Telephone: FAX: E-mail:

More information

Synthetic Biology. Sustainable Energy. Therapeutics Industrial Enzymes. Agriculture. Accelerating Discoveries, Expanding Possibilities. Design.

Synthetic Biology. Sustainable Energy. Therapeutics Industrial Enzymes. Agriculture. Accelerating Discoveries, Expanding Possibilities. Design. Synthetic Biology Accelerating Discoveries, Expanding Possibilities Sustainable Energy Therapeutics Industrial Enzymes Agriculture Design Build Generate Solutions to Advance Synthetic Biology Research

More information

Cloning and Expression of a Haloacid Dehalogenase Enzyme. By: Skyler Van Senior Research Advisor: Dr. Anne Roberts

Cloning and Expression of a Haloacid Dehalogenase Enzyme. By: Skyler Van Senior Research Advisor: Dr. Anne Roberts Cloning and Expression of a Haloacid Dehalogenase Enzyme By: Skyler Van Senior Research Advisor: Dr. Anne Roberts utline The gene being cloned is JHP1130 from Helicobacter pylori (H. pylori) JHP1130 is

More information

GeneArt Site-Directed Mutagenesis PLUS Kit

GeneArt Site-Directed Mutagenesis PLUS Kit GeneArt Site-Directed Mutagenesis PLUS Kit For quick, highly efficient in vitro site-directed mutagenesis of up to 3 sites on plasmids of up to 14kb Catalog Number A14604 Publication Number MAN0006686

More information

HiPer Plasmid DNA Cloning Teaching Kit

HiPer Plasmid DNA Cloning Teaching Kit HiPer Plasmid DNA Cloning Teaching Kit Product Code: HTBM022 Number of experiments that can be performed: 5 Duration of Experiment: 4 days Day 1- Preparation of media and revival of E. coli Host Day2-

More information

Electronic Supplementary Information

Electronic Supplementary Information Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2017 Electronic Supplementary Information Dissecting binding of a β-barrel outer membrane

More information

Aurum Plasmid Mini Kit. Instruction Manual. Bio-Rad Laboratories, Inc Alfred Nobel Dr. Hercules, CA USA (510)

Aurum Plasmid Mini Kit. Instruction Manual. Bio-Rad Laboratories, Inc Alfred Nobel Dr. Hercules, CA USA (510) Bio-Rad Laboratories, Inc. 2000 Alfred Nobel Dr. Hercules, CA 94547 USA (510) 741-1000 1-800-424-6723 Aurum Plasmid Mini Kit Instruction Manual For technical service, call your local Bio-Rad office, or

More information

Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling

Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Glendining KA 1, Markie D 2, Gardner RJM 4, Franz EA 3, Robertson SP 4, Jasoni CL 1 Supplementary

More information

Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of

Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of xylose, inducing expression of gfp-tola, localization

More information

Application Note. NGS Analysis of B-Cell Receptors & Antibodies by AptaAnalyzer -BCR

Application Note. NGS Analysis of B-Cell Receptors & Antibodies by AptaAnalyzer -BCR Reduce to the Best Application Note NGS Analysis of B-Cell Receptors & Antibodies by AptaAnalyzer -BCR The software AptaAnalyzer harnesses next generation sequencing (NGS) data to monitor the immune response

More information

RNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by. 5 AGACACAAACACCAUUGUCACACUCCACAGC; Rand-2 OMe,

RNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by. 5 AGACACAAACACCAUUGUCACACUCCACAGC; Rand-2 OMe, Materials and methods Oligonucleotides and DNA constructs RNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by Dharmacon Inc. (Lafayette, CO). The sequences were: 122-2 OMe, 5

More information

pgbkt7 Anti- Myc AH109 strain (KDa) 50

pgbkt7 Anti- Myc AH109 strain (KDa) 50 pgbkt7 (KDa) 50 37 Anti- Myc AH109 strain Supplementary Figure 1. Protein expression of CRN and TDR in yeast. To analyse the protein expression of CRNKD and TDRKD, total proteins extracted from yeast culture

More information

Purification of mfp. from an Overnight Culture. Laboratory 17

Purification of mfp. from an Overnight Culture. Laboratory 17 Purification of mfp from an Overnight Culture When scientists at a therapeutics company, like Amgen, have successfully identified a promising therapeutic protein, two objectives would be to locate and

More information

Energetic Efficiency of Escherichia coli: Effects of Mutations

Energetic Efficiency of Escherichia coli: Effects of Mutations JOURNAL OF BACTERIOLOGY, May 1993, p. 32-325 21-9193/93/132-6$2./ Copyright 1993, American Society for Microbiology Vol. 175, No. 1 Energetic Efficiency of Escherichia coli: Effects of Mutations in Components

More information

PI NAME: Eleftherios Papoutsakis. Department of Chemical Engineering and the Delaware Biotechnology Institute, University of Delaware

PI NAME: Eleftherios Papoutsakis. Department of Chemical Engineering and the Delaware Biotechnology Institute, University of Delaware PI NAME: Eleftherios Papoutsakis Department of Chemical Engineering and the Delaware Biotechnology Institute, University of Delaware ONR award number: N000141010161 ONR Award Title: Engineering Complex

More information

Single Step (KRX) Competent Cells

Single Step (KRX) Competent Cells TECHNICAL BULLETIN Single Step (KRX) Competent Cells Instruc ons for Use of Product L3002 Revised 12/14 TB352 Single Step (KRX) Competent Cells All technical literature is available at: www.promega.com/protocols/

More information

Antisense RNA Insert Design for Plasmid Construction to Knockdown Target Gene Expression

Antisense RNA Insert Design for Plasmid Construction to Knockdown Target Gene Expression Vol. 1:7-15 Antisense RNA Insert Design for Plasmid Construction to Knockdown Target Gene Expression Ji, Tom, Lu, Aneka, Wu, Kaylee Department of Microbiology and Immunology, University of British Columbia

More information

DNA supercoiling, a critical signal regulating the basal expression of the lac operon in Escherichia coli

DNA supercoiling, a critical signal regulating the basal expression of the lac operon in Escherichia coli Supplementary Information DNA supercoiling, a critical signal regulating the basal expression of the lac operon in Escherichia coli Geraldine Fulcrand 1,2, Samantha Dages 1,2, Xiaoduo Zhi 1,2, Prem Chapagain

More information

Bi 8 Lecture 7. Ellen Rothenberg 26 January Reading: Ch. 3, pp ; panel 3-1

Bi 8 Lecture 7. Ellen Rothenberg 26 January Reading: Ch. 3, pp ; panel 3-1 Bi 8 Lecture 7 PROTEIN STRUCTURE, Functional analysis, and evolution Ellen Rothenberg 26 January 2016 Reading: Ch. 3, pp. 109-134; panel 3-1 (end with free amine) aromatic, hydrophobic small, hydrophilic

More information

Biomimetic Magnetite Formation: From Biocombinatorial Approaches to Mineralization Effects

Biomimetic Magnetite Formation: From Biocombinatorial Approaches to Mineralization Effects pubs.acs.org/langmuir Terms of Use Biomimetic Magnetite Formation: From Biocombinatorial Approaches to Mineralization Effects Jens Baumgartner, Maria Antonietta Carillo, Kevin M. Eckes, Peter Werner, and

More information

R1 12 kb R1 4 kb R1. R1 10 kb R1 2 kb R1 4 kb R1

R1 12 kb R1 4 kb R1. R1 10 kb R1 2 kb R1 4 kb R1 Bcor101 Sample questions Midterm 3 1. The maps of the sites for restriction enzyme EcoR1 (R1) in the wild type and mutated cystic fibrosis genes are shown below: Wild Type R1 12 kb R1 4 kb R1 _ _ CF probe

More information