Supplemental materials
|
|
- Jasmin Hubbard
- 6 years ago
- Views:
Transcription
1 1 2 Supplemental materials 3 4 The terminal oxidase cbb 3 functions in redox control of magnetite biomineralization in Magnetospirillum gryphiswaldense 5 Running title: Oxygen respiration and magnetite biomineralization Yingjie Li a, Oliver Raschdorf a,b, Karen T. Silva a, and Dirk Schüler a# a LudwigMaximiliansUniversität München, Department Biologie I, Mikrobiologie, Großhaderner Str. 24, PlaneggMartinsried, Germany; b Max Planck Institute of Biochemistry, Department of Molecular Structural Biology, Am Klopferspitz 18, Martinsried, Germany # To whom correspondence should be addressed. Dirk Schüler, Biozentrum der LMU, Großhaderner Str.24, PlaneggMartinsried, Tel.: ; Fax: ; dirk.schueler@lrz.unimuenchen.de. 1
2 16 17 Fig. S1 Biomineralization phenotypes of Δcbb 3 and Δaa 3 Δcbb 3 mutants incubated for 24 h (A and C) and 35 h (B and C) in microaerobic nitrate medium. Scale bar, 500 nm. 18 2
3 19 Table S1 Bacterial strains and plasmids used in this work Strain or plasmid Description Reference Strains E. coli DH5α F Φ80dlacZΔM15Δ(lacZYAargF)U169 deor reca1 enda1 hsdr17 (r k, m k +) phoa supe44 λ thi1 gyra96 rela1 E. coli BW29427 dap auxotroph derivative of E. coli strain B2155 Invitrogen K. Datsenko and B. L. Wanner, unpublished MSR1 WT Wild type R3/S1, but Rif r, Sm r (1) ΔMgfnr R3/S1, ΔMgfnr (Y. Li et al., submitted) Δaa 3 R3/S1, Δaa 3 This study Δbd R3/S1, Δbd This study Δcbb 3 R3/S1, Δcbb 3 This study ΔbdΔaa 3 R3/S1, ΔbdΔaa 3 This study Δaa 3 Δcbb 3 R3/S1, Δaa 3 Δcbb 3 This study ΔbdΔcbb 3 R3/S1, ΔbdΔcbb 3 This study Plasmids pbbr1mcs2 Km r, mobilizable broadhostrange vector (2) por093 mamx CXXCH (65,104)>AXXAH, pk19mobgii derivative, Km r (3) plyj97 pbbr1mcs2 plus gusa from pk19mobgii (4) plyj115 plyj97 plus cbb 3 promoter region This study plyj128 por093 plus 2kb fused flanking section of cconoqp This study plyj129 por093 plus 2kb fused flanking section of coxbac This study plyj130 por093 plus 2kb fused flanking section of cydab This study plyj135 plyj97 plus aa 3 promoter region This study plyj137 plyj97 plus bd promoter region This study plyj138 pbbr1mcs2 plus cbb 3 with its own promoter This study plyj139 pbbr1mcs2 plus aa 3 with its own promoter This study plyj140 pbbr1mcs2 plus bd with its own promoter This study 3
4 20 Table S2 BlastP analyses of operons encoding terminal oxidases in MTB and nonmtb using MSR1 as a query Protein in MSR1 mgr_2544 mgr_2545 mgr_2546 mgr_2547 Mgr_0911 Mgr_0912 Mgr_0914 Mgr_0697 Encoded gene product (aa, kda, pi) CcoN (532, 60.6, 9.09) CcoO (243, 27.0, 6.30) CcoQ (36, 4.4, 5.09) CcoP (291, 31.2, 5.90) CoxB (269, 30.1, 6.29) CoxA (526, 57.4, 7.96) CoxC (264, 29.5, 6.97) CydB (382, 41.3, 6.06) AMB1 (evalue, Amb4363 (4e137, 86%) Amb4364 (3e09, 91%) Amb4365 (8e133, 76%) Amb2170 (1e108, 76%) Amb2169 (0.0, 89%) Amb2168 (2e115, 79%) MS1 (evalue, WP_ (0.0, 93%) WP_ (7e137, 86%) MC1 (evalue, Mmc1_2353 (0.0, 80%) Mmc1_2354 (1e94, 70%) WP_ (1e134, 77%) WP_ (3e113, 77%) WP_ (0.0, 89%) WP_ (8e104, 78%) Mmc1_2355 (4e52, 49%) gene encoding the catalytic subunit of cbb 3 oxidase is not found in M. magneticum while the ccoq gene encoding a small membrane protein of unknown function is missing in Mc. marinus and the incomplete genome assembly of M. magnetotacticum. Mc. marinus strain RS1 harbors two cydab operons as well as another operon cyoabcde encoding a quinol oxidase bo 3 oxidase (DMR_14870, _14880, _14890, _14900, and _14910). RS1 (evalue, DMR_06970 (1e63, 54%) DMR_28310 (3e23, 43%) DMR_06960 (2e61, 46%) DMR_28300 Best hit in nonmtb (evalue, (0.0, 87%) (2e124, 82%) Rhodospirillum rubrum F11 (2e11, 88%) Phaeospirillum molischianum (5e123, 73%) (6e105, 77%) (0.0, 88%) Caenispirillum salinarum (7e105, 72%) (0.0, 87%) CydA Mgr_0698 (518, 57.6, 8.66) (0.0, 92%) (4e108, 55%) AMB1: Magnetospirillum magneticum; MS1: Magnetospirillum magnetotacticum; MC1: Magnetococcus marinus; RS1: Desulfovibrio magneticus.the ccon 4
5 25 26 Table S3 Growth (OD 565 nm ), magnetic response (C mag ), and magnetosome crystal size of various terminal oxidase mutants under different conditions. Strain OD 565 nm C mag Crystal size (nm) n 0% O 2 WT 0.13 ± ± ± Δaa ± ± ± Δbd 0.13 ± ± ± ΔbdΔaa ± ± ± Δcbb ± ± ± Δaa 3 Δcbb ± ± ± ΔbdΔcbb ± ± ± % O 2, +NO 3 WT 0.22 ± ± ± Δaa ± ± ± Δbd 0.20 ± ± ± ΔbdΔaa ± ± ± % O 2, +NH 4 WT 0.11 ± ± 0.1 Δaa ± ± 0.0 Δbd 0.10 ± ± 0.1 ΔbdΔaa ± ± 0.1 Number of crystals measured for each strain (n) is presented in the last column. 28 References Schultheiss D, Kube M, Schüler D Inactivation of the flagellin gene flaa in Magnetospirillum gryphiswaldense results in nonmagnetotactic mutants lacking flagellar filaments. Appl. Environ. Microbiol. 70: Kovach ME, Elzer PH, Hill DS, Robertson GT, Farris MA, Roop RM, Peterson KM Four new derivatives of the broadhostrange cloning vector pbbr1mcs, carrying different antibioticresistance cassettes. Gene 166: Raschdorf O, Müller FD, Posfai M, Plitzko JM, Schüler D The magnetosome proteins MamX, MamZ and MamH are involved in redox control of magnetite biomineralization in Magnetospirillum gryphiswaldense. Mol. Microbiol. 89: Li Y, Katzmann E, Borg S, Schüler D The periplasmic nitrate reductase Nap is required for anaerobic growth and involved in redox control of magnetite biomineralization in Magnetospirillum gryphiswaldense. J. Bacteriol. 194:
Optimization of gene expression cassette for M. gryphiswaldense
Optimization of gene expression cassette for M. gryphiswaldense A) 325 bp P mamdc 270 bp 170 bp 102 bp 45 bp egfp Gradual truncation P mamdc45 egfp minimal transcriptionally active promoter B) P mamdc45
More informationSupplementary Material. Increased heterocyst frequency by patn disruption in Anabaena leads to enhanced photobiological
Supplementary Material Increased heterocyst frequency by patn disruption in Anabaena leads to enhanced photobiological hydrogen production at high light intensity and high cell density Applied Microbiology
More informationDeletion of a fur-like Gene Affects Iron Homeostasis and Magnetosome Formation in Magnetospirillum gryphiswaldense
JOURNAL OF BACTERIOLOGY, Aug. 2010, p. 4192 4204 Vol. 192, No. 16 0021-9193/10/$12.00 doi:10.1128/jb.00319-10 Copyright 2010, American Society for Microbiology. All Rights Reserved. Deletion of a fur-like
More informationTable S1. Bacterial strains (Related to Results and Experimental Procedures)
Table S1. Bacterial strains (Related to Results and Experimental Procedures) Strain number Relevant genotype Source or reference 1045 AB1157 Graham Walker (Donnelly and Walker, 1989) 2458 3084 (MG1655)
More informationTightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter
TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter L M Guzman et al. (1995) Journal of Bacteriology 177: 4121-4130 Outline 1. Introduction 2. Objective 3.
More informationSupporting Information-Tables
Supporting Information-Tables Table S1. Bacterial strains and plasmids used in this work Bacterial strains Description Source of reference Streptococcus pneumoniae 1 Cp1015 non-capsulated and βl susceptible
More informationSupplemental Fig. S1. Key to underlines: Key to amino acids:
AspA-F1 AspA 1 MKQMETKGYGYFRKTKAYGLVCGIT--------------LAGALTLGTTSVSADDVTTLNPATNLTTLQTPPTADQTQLAHQAGQQSGELVSEVSNTEWD 86 SspB 1 MQKREV--FG-FRKSKVAKTLCGAV-LGAALIAIADQQVLADEVTETNSTANVAVTTTGNPATNLPEAQGEATEAASQSQAQAGSKDGALPVEVSADDLN
More informationUNIVERSITY OF YORK BA, BSc, and MSc Degree Examinations
Examination Candidate Number: Desk Number: UNIVERSITY OF YORK BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Bacterial pathogenesis Time Allowed: 2 hours Marking Scheme:
More informationSegregation of prokaryotic magnetosomes organelles is driven by treadmilling of a dynamic actin-like MamK filament. Toro-Nahuelpan et al.
Segregation of prokaryotic magnetosomes organelles is driven by treadmilling of a dynamic actin-like MamK filament Toro-Nahuelpan et al. Toro-Nahuelpan et al. BMC Biology (2016) 14:88 DOI 10.1186/s12915-016-0290-1
More informationConfirming the Phenotypes of E. coli Strains
Confirming the Phenotypes of E. coli Strains INTRODUCTION Before undertaking any experiments, we need to confirm that the phenotypes of the E. coli strains we intend to use in the planned experiments correspond
More informationCompetence Modulation by the NADH Oxidase of Streptococcus pneumoniae Involves Signal Transduction
JOURNAL OF BACTERIOLOGY, Jan. 2001, p. 768 772 Vol. 183, No. 2 0021-9193/01/$04.00 0 DOI: 10.1128/JB.183.2.768 772.2001 Copyright 2001, American Society for Microbiology. All Rights Reserved. Competence
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/10/494/eaan6284/dc1 Supplementary Materials for Activation of master virulence regulator PhoP in acidic ph requires the Salmonella-specific protein UgtL Jeongjoon
More informationFigure S1. Figure S2. Figure S3 HB Anti-FSP27 (COOH-terminal peptide) Ab. Anti-GST-FSP27(45-127) Ab.
/ 36B4 mrna ratio Figure S1 * 2. 1.6 1.2.8 *.4 control TNFα BRL49653 Figure S2 Su bw AT p iw Anti- (COOH-terminal peptide) Ab Blot : Anti-GST-(45-127) Ab β-actin Figure S3 HB2 HW AT BA T Figure S4 A TAG
More informationGenome Sequence Assembly
Genome Sequence Assembly Learning Goals: Introduce the field of bioinformatics Familiarize the student with performing sequence alignments Understand the assembly process in genome sequencing Introduction:
More informationMaterials and methods. by University of Washington Yeast Resource Center) from several promoters, including
Supporting online material for Elowitz et al. report Materials and methods Strains and plasmids. Plasmids expressing CFP or YFP (wild-type codons, developed by University of Washington Yeast Resource Center)
More informationBA, BSc, and MSc Degree Examinations
Examination Candidate Number: Desk Number: BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Bacterial pathogenesis Time Allowed: 2 hours Marking Scheme: Total marks available
More informationMIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr.
MIT Department of Biology 7.01: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. Claudette Gardel iv) Would Xba I be useful for cloning? Why or why not?
More informationPyochelin potentiates the inhibitory activity of gallium on Pseudomonas aeruginosa SUPPLEMENTAL MATERIAL
Pyochelin potentiates the inhibitory activity of gallium on Pseudomonas aeruginosa by Frangipani E., Bonchi C., Minandri F., Imperi F., and Visca P. 3 4 SUPPLEMENTAL MATERIAL 5 6 TABLE S. Strains, plasmids
More informationSolutions to Quiz II
MIT Department of Biology 7.014 Introductory Biology, Spring 2005 Solutions to 7.014 Quiz II Class Average = 79 Median = 82 Grade Range % A 90-100 27 B 75-89 37 C 59 74 25 D 41 58 7 F 0 40 2 Question 1
More informationInitial Stages in Creating a laci Knockout in Escherichia coli C29 Using the Lambda Red Recombinase System
Initial Stages in Creating a laci Knockout in Escherichia coli C29 Using the Lambda Red Recombinase System AMY JAEGER, PETER SIMS, ROBIN SIDSWORTH, AND NOA TINT Department of Microbiology & Immunology,
More informationHI-Control BL21(DE3) & HI-Control 10G Chemically Competent Cells
HI-Control BL21(DE3) & HI-Control 10G Chemically Competent Cells FOR RESEARCH USE ONLY. NOT FOR HUMAN OR DIAGNOSTIC USE MA156 Rev.31OCT2016 Table of Contents Components & Storage Conditions... 3 HI-Control
More informationCytochrome c Maturation and the Physiological Role of c-type Cytochromes in Vibrio cholerae
JOURNAL OF BACTERIOLOGY, Sept. 2005, p. 5996 6004 Vol. 187, No. 17 0021-9193/05/$08.00 0 doi:10.1128/jb.187.17.5996 6004.2005 Copyright 2005, American Society for Microbiology. All Rights Reserved. Cytochrome
More informationHuman Cell-Free Protein Expression Maxi System
Cat. # 3285 For Research Use Human Cell-Free Protein Expression Maxi System Product Manual Table of Contents I. Description... 3 II. Components... 4 III. Materials Required but not Provided... 5 IV. Storage...
More informationFranzens-Universitaet Graz, Humboldtstrasse 50, 8010 Graz. Phone: ++43 (0) Fax: ++43 (0)
Extracellular nucleases and extracellular DNA play important roles in Vibrio cholerae biofilm formation Andrea Seper 1, Vera H. I. Fengler 1, Sandro Roier 1, Heimo Wolinski 1, Sepp D. Kohlwein 1, Anne
More informationSUPPLEMENTAL MATERIAL FOR. Structure of Bacterial Transcription Factor SpoIIID and Evidence for a Novel
SUPPLEMENTAL MATERIAL FOR Structure of Bacterial Transcription Factor SpoIIID and Evidence for a Novel Mode of DNA Binding Bin Chen, Paul Himes, Yu Liu, Yang Zhang, Zhenwei Lu, Aizhuo Liu, Honggao Yan,
More informationF 11/23 Happy Thanksgiving! 8 M 11/26 Gene identification in the genomic era Bamshad et al. Nature Reviews Genetics 12: , 2011
3 rd Edition 4 th Edition Lecture Day Date Topic Reading Problems Reading Problems 1 M 11/5 Complementation testing reveals that genes are distinct entities Ch. 7 224-232 2 W 11/7 One gene makes one protein
More informationApplied Microbiology and Biotechnology. De-bugging and maximizing plant cytochrome P450 production in Escherichia coli with C-terminal GFP-fusions
Applied Microbiology and Biotechnology De-bugging and maximizing plant cytochrome P450 production in Escherichia coli with C-terminal GFP-fusions Ulla Christensen 1, Dario V. Albacete 1, Karina M. Søgaard
More informationMidterm 2 Review Session. Megan McBee November 7th, 2006
20.106 Midterm 2 Review Session Megan McBee November 7th, 2006 Topics Nitrogen Cycle Communities, symbiosis, genome reduction Horizontal Gene Transfer Biotechnology Nitrogen Cycle Important Reactions Nitrogen
More informationStrains for production of RcoM Bx -1 proteins and assay of in vivo activity.
Strains for production of RcoM Bx -1 proteins and assay of in vivo activity. The following plasmids and strains are components of the protein production and in vivo assay system for the CO-dependent RcoM-1
More informationRegulation of Quorum Sensing by RpoS in Pseudomonas aeruginosa
JOURNAL OF BACTERIOLOGY, Aug. 2000, p. 4356 4360 Vol. 182, No. 15 0021-9193/00/$04.00 0 Copyright 2000, American Society for Microbiology. All Rights Reserved. Regulation of Quorum Sensing by RpoS in Pseudomonas
More information7.013 Problem Set 3 FRIDAY October 8th, 2004
MIT Biology Department 7.012: Introductory Biology - Fall 2004 Instructors: Professor Eric Lander, Professor Robert. Weinberg, Dr. laudette ardel Name: T: 7.013 Problem Set 3 FRIDY October 8th, 2004 Problem
More informationRespiration of Escherichia coli in the Mouse Intestine
INFECTION AND IMMUNITY, Oct. 2007, p. 4891 4899 Vol. 75, No. 10 0019-9567/07/$08.00 0 doi:10.1128/iai.00484-07 Copyright 2007, American Society for Microbiology. All Rights Reserved. Respiration of Escherichia
More informationGenome research in eukaryotes
Functional Genomics Genome and EST sequencing can tell us how many POTENTIAL genes are present in the genome Proteomics can tell us about proteins and their interactions The goal of functional genomics
More informationSupplementary Material
Supplementary Material Gene Inactivation Study on gntk, a Putative C-methyltransferase Gene in Gentamicin Biosynthesis from Micromonospora echinospora Suman Karki Jin-Yong Kim Si-Hyung Park Hyung-Jin Kwon
More informationBuilding Better Algae
Building Better Algae Craig Marcus, Ph.D. Dept. of Environmental & Molecular Toxicology Domestication of Algae as a New Crop Must develop a rapid process (corn first domesticated ~4000 B.C.) Requires a
More informationSI Results Peculiarities in the consumption of ammonium and glucose by AmtB- strains SI Materials and Methods Strain Construction
SI Results Peculiarities in the consumption of ammonium and glucose by AmtB - strains. The AmtB - strain failed to consume all the ammonium in the medium under NH 3 -limiting conditions (.5 mm total ammonium
More informationBacterioMatch II Two-Hybrid System XR Plasmid cdna Library
BacterioMatch II Two-Hybrid System XR Plasmid cdna Library INSTRUCTION MANUAL BN #982000 Revision A For In Vitro Use Only 982000-12 LIMITED PRODUCT WARRANTY This warranty limits our liability to replacement
More informationAcrS is an Activator of acrd Expression in Escherichia coli K-12 Following Exposure to Sub-inhibitory Concentration of Kanamycin Pretreatment
AcrS is an Activator of acrd Expression in Escherichia coli K-12 Following Exposure to Sub-inhibitory Concentration of Kanamycin Pretreatment Mariam Emami, Stella Xu, Thomas Chan Department Microbiology
More informationStabilization of a virus-like particle and its application as a nanoreactor at physiological conditions
Supporting Information Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Lise Schoonen, b Sjors Maassen, b Roeland J. M. Nolte b and Jan C. M. van
More informationGenetic Background Page 1 PHAGE P22
Genetic Background Page 1 PHAGE P22 Growth of P22. P22 is a temperate phage that infects Salmonella by binding to the O-antigen, part of the lipopolysaccharide on the outer membrane. After infection, P22
More informationHistory of the CFTR chase
Module II: Molecular and cellular phenotype Discuss the history of the gene. When was the gene discovered? How was the gene cloned? (Be brief.) Discuss the cellular phenotype. What cells or tissues are
More informationCloning and Characterization of E. meningoseptica Beta Lactamase
Cloning and Characterization of E. meningoseptica Beta Lactamase Authors: Lindsey Purcell, Jessica Matts, Patricia Canaan* Department of Biochemistry and Molecular Biology Abstract Elizabethkingia meningoseptica
More informationTransforMax EPI300 Electrocompetent E. coli TransforMax EPI300 Chemically Competent E. coli
TransforMax EPI300 Electrocompetent E. coli TransforMax EPI300 Chemically Competent E. coli Cat. Nos. EC300102, EC300110, EC300150, and C300C105 Available exclusively thru Lucigen. lucigen.com/epibio www.lucigen.com
More informationencodes a sigma factor to modify the recognition of the E.coli RNA polymerase (Several other answers would also be acceptable for each phage)
Name Student ID# Bacterial Genetics, BIO 4443/6443 Spring Semester 2001 Final Exam 1.) Different bacteriophage utilize different mechanisms to ensure that their own genes (and not host s genes) are transcribed
More informationGateway Vectors for BiFC
Gateway Vectors for BiFC 1. The enhanced YFP (EYFP) are used (Split EYFP). 2. The Fusion fusion gene is expressed by CaMV35S promoter. 3. The N- or C-terminal fragments of EYFP are fused subsequent to
More informationBA, BSc, and MSc Degree Examinations
Examination Candidate Number: Desk Number: BA, BSc, and MSc Degree Examinations 2017-8 Department : BIOLOGY Title of Exam: Genetics Time Allowed: 1 hour and 30 minutes Marking Scheme: Total marks available
More informationReceived: 13 November 2013 / Revised: 2 April 2014 / Accepted: 9 April 2014 / Published online: 24 April 2014 Springer-Verlag Berlin Heidelberg 2014
Arch Microbiol (2014) 196:481 488 DOI 10.1007/s00203-014-0984-0 Original Paper Subcellular localization of the magnetosome protein MamC in the marine magnetotactic bacterium Magnetococcus marinus strain
More informationMicrobial Biotechnology agustin krisna wardani
Microbial Biotechnology agustin krisna wardani 1. The Structure of Microbes Microbes (microorganisms) are tiny organisms that are too small to be seen individually by the naked eye and must be viewed with
More informationDiagnosis Sanger. Interpreting and Troubleshooting Chromatograms. Volume 1: Help! No Data! GENEWIZ Technical Support
Diagnosis Sanger Interpreting and Troubleshooting Chromatograms GENEWIZ Technical Support DNAseq@genewiz.com Troubleshooting This troubleshooting guide is based on common issues seen from samples within
More informationFINDING GENES AND EXPLORING THE GENE PAGE AND RUNNING A BLAST (Exercise 1)
FINDING GENES AND EXPLORING THE GENE PAGE AND RUNNING A BLAST (Exercise 1) 1.1 Finding a gene using text search. Note: For this exercise use http://www.plasmodb.org a. Find all possible kinases in Plasmodium.
More informationChapter 11. Restriction mapping. Objectives
Restriction mapping Restriction endonucleases (REs) are part of bacterial defense systems. REs recognize and cleave specific sites in DNA molecules. REs are an indispensable tool in molecular biology for
More informationTECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits
In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits Catalog Numbers APPA001 In Vitro Bacterial Split GFP "Fold 'n' Glow" Solubility Assay Kit (Green) APPA008 In Vitro Bacterial
More informationThe GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity
Promega Notes Magazine Number 62, 1997, p. 02 The GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity By Christine Andrews and Scott Lesley Promega
More informationGuangdong Province Key Laboratory of Pharmacodynamic Constituents of TCM and New Drugs Research, Jinan University, Guangzhou, , China
Development of a versatile and conventional technique for gene disruption in filamentous fungi based on CRISPR-Cas9 technology Yan-Mei Zheng, 1, + Fu-Long Lin, 1, + Hao Gao, 1, * Gen Zou, 2 Jiang-Wei Zhang,
More informationTransforMax EPI300 Electrocompetent E. coli TransforMax EPI300 Chemically Competent E. coli
TransforMax EPI300 Electrocompetent E. coli TransforMax EPI300 Chemically Competent E. coli Cat. Nos. EC300105, EC300110, EC300150, and C300C105 Connect with Epicentre on our blog (epicentral.blogspot.com),
More informationA Discovery Laboratory Investigating Bacterial Gene Regulation
Chapter 8 A Discovery Laboratory Investigating Bacterial Gene Regulation Robert Moss Wofford College 429 N. Church Street Spartanburg, SC 29307 mosssre@wofford.edu Bob Moss is an Associate Professor of
More informationLambda DASH II Library
Lambda DASH II Library INSTRUCTION MANUAL Revision A For In Vitro Use Only 945301-12 LIMITED PRODUCT WARRANTY This warranty limits our liability to replacement of this product. No other warranties of any
More informationDesigning and creating your gene knockout Background The rada gene was identified as a gene, that when mutated, caused cells to become hypersensitive
Designing and creating your gene knockout Background The rada gene was identified as a gene, that when mutated, caused cells to become hypersensitive to ionizing radiation. However, why these mutants are
More informationRole of Cyclic Di-GMP during El Tor Biotype Vibrio cholerae Infection: Characterization of the In Vivo-Induced Cyclic Di-GMP Phosphodiesterase CdpA
INFECTION AND IMMUNITY, Apr. 2008, p. 1617 1627 Vol. 76, No. 4 0019-9567/08/$08.00 0 doi:10.1128/iai.01337-07 Copyright 2008, American Society for Microbiology. All Rights Reserved. Role of Cyclic Di-GMP
More informationAnswers to Module 1. An obligate aerobe is an organism that has an absolute requirement of oxygen for growth.
Answers to Module 1 Short Answers 1) What is an obligate aerobe? An obligate aerobe is an organism that has an absolute requirement of oxygen for growth. What about facultative anaerobe? 2) Distinguish
More informationMatthew I. Hutchings, 1 Jason C. Crack, 2 Neil Shearer, 1 Benjamin J. Thompson, 1 Andrew J. Thomson, 2 and Stephen Spiro 1 *
JOURNAL OF BACTERIOLOGY, Jan. 2002, p. 503 508 Vol. 184, No. 2 0021-9193/02/$04.00 0 DOI: 10.1128/JB.184.2.503 508.2002 Copyright 2002, American Society for Microbiology. All Rights Reserved. Transcription
More informationKOD -Plus- Mutagenesis Kit
Instruction manual KOD -Plus- Mutagenesis Kit 0811 F0936K KOD -Plus- Mutagenesis Kit SMK-101 20 reactions Store at -20 C Contents [1] Introduction [2] Flow chart [3] Components [4] Notes [5] Protocol 1.
More information1. DNA Cloning. Blunt-end DNA Cloning Kits TA DNA Cloning Kits Universal DNA Cloning Kits Chemically competent cells Mutagenesis Other compounds
1. DNA Cloning Blunt-end DNA Cloning Kits TA DNA Cloning Kits Universal DNA Cloning Kits Chemically competent cells Mutagenesis Other compounds Photo: Embryo of lily ovary 10 Accelerating your Molecular
More informationCertificate of Analysis
Certificate of Analysis pet6xhn Expression Vector Set Contents Product Information... 1 pet6xhn-n, pet6xhn-c, and pet6xhn-gfpuv Vector Information... 2 Location of Features... 4 Additional Information...
More informationMutating Asn-666 to Glu in the O-helix region of the taq DNA polymerase gene
Research in Pharmaceutical Sciences, April 2010; 5(1): 15-19 Received: Oct 2009 Accepted: Jan 2010 School of Pharmacy & Pharmaceutical Sciences 15 Isfahan University of Medical Sciences Original Article
More informationPractice Problems for Recombinant DNA, Session 4: cdna Libraries and Expression Libraries
Practice Problems for Recombinant DNA, Session 4: cdna Libraries and Expression Libraries Question 1 In a hypothetical scenario you wake up one morning to your roommate exclaiming about her sudden hair
More informationETHYLBENZENE DEHYDROGENASE: OXIDATION OF HYDROCARBONS WITHOUT OXYGEN
ETHYLBENZENE DEHYDRGENASE: XIDATIN F HYDRCARBNS WITHUT XYGEN M. Szaleniec 1, B. Jobst 2, J. Heider 2 1. Institute of Catalysis and Surface Chemistry, PAS, Kraków, Poland 2. Mikrobiologie, Institut für
More informationDi erential regulation of amoa and amob gene copies in Nitrosomonas europaea
FEMS Microbiology Letters 192 (2000) 163^168 www.fems-microbiology.org Di erential regulation of amoa and amob gene copies in Nitrosomonas europaea Lisa Y. Stein, Luis A. Sayavedra-Soto, Norman G. Hommes,
More informationCopyCutter EPI400 Electrocompetent E. coli CopyCutter EPI400 Chemically Competent E. coli CopyCutter Induction Solution
CopyCutter EPI400 Electrocompetent E. coli CopyCutter EPI400 Chemically Competent E. coli CopyCutter Induction Solution Cat. Nos. C400EL10, C400CH10, and CIS40025 Available exclusively thru Lucigen. lucigen.com/epibio
More informationBiotechnology and Energy Conservation. Prof. Dr.oec.troph. Ir. Krishna Purnawan Candra, M.S. Program Magister Ilmu Lingkungan Universitas Mulawarman
Biotechnology and Energy Conservation Prof. Dr.oec.troph. Ir. Krishna Purnawan Candra, M.S. Program Magister Ilmu Lingkungan Universitas Mulawarman 12 th Lecture Genetic Engineering The Aim: Students can
More informationFunctional and Topological Characterization of Novel Components of the comb DNA Transformation Competence System in Helicobacter pylori
JOURNAL OF BACTERIOLOGY, Feb. 2006, p. 882 893 Vol. 188, No. 3 0021-9193/06/$08.00 0 doi:10.1128/jb.188.3.882 893.2006 Copyright 2006, American Society for Microbiology. All Rights Reserved. Functional
More informationA Novel Regulatory Protein Involved in Motility of Vibrio cholerae
JOURNAL OF BACTERIOLOGY, Nov. 2009, p. 7027 7038 Vol. 191, No. 22 0021-9193/09/$12.00 doi:10.1128/jb.00948-09 Copyright 2009, American Society for Microbiology. All Rights Reserved. A Novel Regulatory
More informationVibrio fischeri Flagellin A Is Essential for Normal Motility and for Symbiotic Competence during Initial Squid Light Organ Colonization
JOURNAL OF BACTERIOLOGY, July 2004, p. 4315 4325 Vol. 186, No. 13 0021-9193/04/$08.00 0 DOI: 10.1128/JB.186.13.4315 4325.2004 Copyright 2004, American Society for Microbiology. All Rights Reserved. Vibrio
More informationSupplemental Data. Aung et al. (2011). Plant Cell /tpc
35S pro:pmd1-yfp 10 µm Supplemental Figure 1. -terminal YFP fusion of PMD1 (PMD1-YFP, in green) is localized to the cytosol. grobacterium cells harboring 35S pro :PMD1-YFP were infiltrated into tobacco
More informationComputational Biology I LSM5191
Computational Biology I LSM5191 Lecture 5 Notes: Genetic manipulation & Molecular Biology techniques Broad Overview of: Enzymatic tools in Molecular Biology Gel electrophoresis Restriction mapping DNA
More informationA-PG hydrolysis by PA0919
SUPPORTING INFORMATION Identification and characterization of a periplasmic Aminoacyl-Phosphatidylglycerol Hydrolase responsible for Pseudomonas aeruginosa lipid homeostasis* Wiebke Arendt 1, Maike K.
More informationJournal of Experimental Microbiology and Immunology (JEMI) Vol. 20: Copyright April 2016, M&I UBC
The Major Periplasmic Domain of YidC May Be Required for Polar Localization of a Green Fluorescence Protein Tagged YidC Variant Protein in Escherichia coli Peter Xu, Kevin He, Steven Yan Department of
More informationBIOCHEMISTRY 551: BIOCHEMICAL METHODS SYLLABUS
BIOCHEMISTRY 551: BIOCHEMICAL METHODS SYLLABUS Course Description: Biochemistry 551 is an integrated lecture, lab and seminar course that covers biochemistry-centered theory and techniques. The course
More informationSynthetic Biology for
Synthetic Biology for Plasmids and DNA Digestion Plasmids Plasmids are small DNA molecules that are separate from chromosomal DNA They are most commonly found as double stranded, circular DNA Typical plasmids
More informationREGISTRATION DOCUMENT FOR RECOMBINANT DNA RESEARCH
EHRS Date Received: Reg. Doc. No.: REGISTRATION DOCUMENT FOR RECOMBINANT DNA RESEARCH Principal Investigator: Penn ID#: Position Title: School: Department: Mailing Address: Mail Code: Telephone: FAX: E-mail:
More informationSynthetic Biology. Sustainable Energy. Therapeutics Industrial Enzymes. Agriculture. Accelerating Discoveries, Expanding Possibilities. Design.
Synthetic Biology Accelerating Discoveries, Expanding Possibilities Sustainable Energy Therapeutics Industrial Enzymes Agriculture Design Build Generate Solutions to Advance Synthetic Biology Research
More informationCloning and Expression of a Haloacid Dehalogenase Enzyme. By: Skyler Van Senior Research Advisor: Dr. Anne Roberts
Cloning and Expression of a Haloacid Dehalogenase Enzyme By: Skyler Van Senior Research Advisor: Dr. Anne Roberts utline The gene being cloned is JHP1130 from Helicobacter pylori (H. pylori) JHP1130 is
More informationGeneArt Site-Directed Mutagenesis PLUS Kit
GeneArt Site-Directed Mutagenesis PLUS Kit For quick, highly efficient in vitro site-directed mutagenesis of up to 3 sites on plasmids of up to 14kb Catalog Number A14604 Publication Number MAN0006686
More informationHiPer Plasmid DNA Cloning Teaching Kit
HiPer Plasmid DNA Cloning Teaching Kit Product Code: HTBM022 Number of experiments that can be performed: 5 Duration of Experiment: 4 days Day 1- Preparation of media and revival of E. coli Host Day2-
More informationElectronic Supplementary Information
Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2017 Electronic Supplementary Information Dissecting binding of a β-barrel outer membrane
More informationAurum Plasmid Mini Kit. Instruction Manual. Bio-Rad Laboratories, Inc Alfred Nobel Dr. Hercules, CA USA (510)
Bio-Rad Laboratories, Inc. 2000 Alfred Nobel Dr. Hercules, CA 94547 USA (510) 741-1000 1-800-424-6723 Aurum Plasmid Mini Kit Instruction Manual For technical service, call your local Bio-Rad office, or
More informationSupplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling
Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Glendining KA 1, Markie D 2, Gardner RJM 4, Franz EA 3, Robertson SP 4, Jasoni CL 1 Supplementary
More informationFigure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of
Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of xylose, inducing expression of gfp-tola, localization
More informationApplication Note. NGS Analysis of B-Cell Receptors & Antibodies by AptaAnalyzer -BCR
Reduce to the Best Application Note NGS Analysis of B-Cell Receptors & Antibodies by AptaAnalyzer -BCR The software AptaAnalyzer harnesses next generation sequencing (NGS) data to monitor the immune response
More informationRNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by. 5 AGACACAAACACCAUUGUCACACUCCACAGC; Rand-2 OMe,
Materials and methods Oligonucleotides and DNA constructs RNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by Dharmacon Inc. (Lafayette, CO). The sequences were: 122-2 OMe, 5
More informationpgbkt7 Anti- Myc AH109 strain (KDa) 50
pgbkt7 (KDa) 50 37 Anti- Myc AH109 strain Supplementary Figure 1. Protein expression of CRN and TDR in yeast. To analyse the protein expression of CRNKD and TDRKD, total proteins extracted from yeast culture
More informationPurification of mfp. from an Overnight Culture. Laboratory 17
Purification of mfp from an Overnight Culture When scientists at a therapeutics company, like Amgen, have successfully identified a promising therapeutic protein, two objectives would be to locate and
More informationEnergetic Efficiency of Escherichia coli: Effects of Mutations
JOURNAL OF BACTERIOLOGY, May 1993, p. 32-325 21-9193/93/132-6$2./ Copyright 1993, American Society for Microbiology Vol. 175, No. 1 Energetic Efficiency of Escherichia coli: Effects of Mutations in Components
More informationPI NAME: Eleftherios Papoutsakis. Department of Chemical Engineering and the Delaware Biotechnology Institute, University of Delaware
PI NAME: Eleftherios Papoutsakis Department of Chemical Engineering and the Delaware Biotechnology Institute, University of Delaware ONR award number: N000141010161 ONR Award Title: Engineering Complex
More informationSingle Step (KRX) Competent Cells
TECHNICAL BULLETIN Single Step (KRX) Competent Cells Instruc ons for Use of Product L3002 Revised 12/14 TB352 Single Step (KRX) Competent Cells All technical literature is available at: www.promega.com/protocols/
More informationAntisense RNA Insert Design for Plasmid Construction to Knockdown Target Gene Expression
Vol. 1:7-15 Antisense RNA Insert Design for Plasmid Construction to Knockdown Target Gene Expression Ji, Tom, Lu, Aneka, Wu, Kaylee Department of Microbiology and Immunology, University of British Columbia
More informationDNA supercoiling, a critical signal regulating the basal expression of the lac operon in Escherichia coli
Supplementary Information DNA supercoiling, a critical signal regulating the basal expression of the lac operon in Escherichia coli Geraldine Fulcrand 1,2, Samantha Dages 1,2, Xiaoduo Zhi 1,2, Prem Chapagain
More informationBi 8 Lecture 7. Ellen Rothenberg 26 January Reading: Ch. 3, pp ; panel 3-1
Bi 8 Lecture 7 PROTEIN STRUCTURE, Functional analysis, and evolution Ellen Rothenberg 26 January 2016 Reading: Ch. 3, pp. 109-134; panel 3-1 (end with free amine) aromatic, hydrophobic small, hydrophilic
More informationBiomimetic Magnetite Formation: From Biocombinatorial Approaches to Mineralization Effects
pubs.acs.org/langmuir Terms of Use Biomimetic Magnetite Formation: From Biocombinatorial Approaches to Mineralization Effects Jens Baumgartner, Maria Antonietta Carillo, Kevin M. Eckes, Peter Werner, and
More informationR1 12 kb R1 4 kb R1. R1 10 kb R1 2 kb R1 4 kb R1
Bcor101 Sample questions Midterm 3 1. The maps of the sites for restriction enzyme EcoR1 (R1) in the wild type and mutated cystic fibrosis genes are shown below: Wild Type R1 12 kb R1 4 kb R1 _ _ CF probe
More information