Introduction to BioLuminate

Size: px
Start display at page:

Download "Introduction to BioLuminate"

Transcription

1 Introduction to BioLuminate Janet Paulsen Stanford University 10/16/17

2 BioLuminate has Broad Functionality Antibody design Structure prediction from sequence, humanization Protein design Residue scanning (affinity/stability); Cysteine scanning; Protein crosslinking; Affinity maturation; Non-standard amino acids Protein liability ID Aggregation propensity ID; Reactive residue ID (glycosylation, proteolysis, oxidation, deamination); Peptide QSAR; Titration curve/isoelectric point; Solubility Protein modeling Homology modeling Protein-protein docking; Prime de novo loop modeling Protein interaction analysis; Chimeric model generation; Automated peptide docking Multiple Sequence Viewer (MSV); Protein Structure Quality Viewer Molecular Dynamics, minimization, quantum mechanics, etc.

3 Good CADD Starts with Good Science 1. The quality of your structure matters 2. The conformational state of your structure matters 3. The design of your experiment matters

4 BioLuminate has Accurate Antibody Prediction Predicted CDR region FAB13B5 versus experiment (1E6J, light green)

5 AMA-II Round 1 Showed Comparable Performance Method Fv RMSD Framework RMSD All loops RMSD H3 H3 RMSD Schrödinger 1.1 ± 0.2Å 0.8 ± 0.2Å 1.1 ± 0.4Å 2.7 ± 0.8Å Accelrys 1.1 ± 0.3Å 0.9 ± 0.3Å 1.1 ± 0.5Å 3.0 ± 1.1Å CCG 1.1 ± 0.2Å 0.9 ± 0.3Å 1.0 ± 0.3Å 3.3 ± 0.9Å Rosetta 1.1 ± 0.2Å 0.8 ± 0.2Å 1.1 ± 0.4Å 2.6 ± 0.9Å Macromoltek 1.4 ± 0.2Å 1.2 ± 0.2Å 1.2 ± 0.3Å 3.0 ± 1.0Å Astellas + Osaka U 1.1 ± 0.2Å 0.8 ± 0.2Å 1.0 ± 0.2Å 2.3 ± 0.6Å PIGS server 1.2 ± 0.1Å 0.9 ± 0.2Å 0.9 ± 0.4Å 3.1 ± 1.1Å Average 1.1 ± 0.2Å 0.9 ± 0.2A Å 2.8 ± 0.9Å

6 BioLuminate s H3 prediction is the Best Automated Method Method H3 RMSD (Round 1) H3 RMSD (Round 2) Schrödinger 2.7 ± 0.8Å 1.4 ± 1.1Å Accelrys 3.0 ± 1.1Å 2.3 ± 1.0Å CCG 3.3 ± 0.9Å 2.5 ± 1.6Å Rosetta 2.6 ± 0.9Å 2.1 ± 1.1Å Macromoltek 3.0 ± 1.0Å 3.3 ± 1.2Å Astellas + Osaka U 2.3 ± 0.6Å 1.4 ± 1.9Å PIGS server 3.1 ± 1.1Å Average 2.8 ± 0.9A 2.2 ± 0.9Å Zhu, K. et al. Proteins, 2014, 82(8),

7 Incorporating Crystallographic Symmetry Improves Predictions H3 Loop Length >17 Prime* Rosetta ± Prime* with symmetry Average RMS deviations from x-ray for H3 (Å) * Zhu, K. and T. Day. Proteins, 2013, 81(6), ± Sivasubramanian, A. et al. Proteins, 2009, 74(2),

8 BioLuminate can Quickly Humanize an Antibody Model Easy to use Automatically IDs clashing residues for back mutation

9 Residue Scanning Accurately Predicts Stabilizing Mutations 2 mutation locations Glu107 Ser mutations made and tested experimentally Only 3 mutations lead to increased thermal stability E107D S124K S124R Computed)Energy) Δ Energy Predic5on)of)Thermal)Stability) Prediction of Thermal Stability 0$!40$!35$!30$!25$!20$!15$!10$!5$ 0$ 5$ 10$ 150$ 100$ 50$!50$!100$!150$ Experimental Δ Tm delta)tm)!200$

10 Residue Scanning Accurately Predicts Stabilizing Mutations 2 mutation locations Glu107 Ser mutations made and tested experimentally Only 3 mutations lead to increased thermal stability E107D S124K S124R Computed)Energy) Δ Energy Predic5on)of)Thermal)Stability) Prediction of Thermal Stability 0$!40$!35$!30$!25$!20$!15$!10$!5$ 0$ 5$ 10$ 3 best scoring predictions are the only stabilizing mutations 150$ 100$ 50$!50$!100$!150$ Experimental Δ Tm delta)tm)!200$

11 Residue Scanning can Expand to Affinity Maturation Residue Scanning (single mutations): Protein 1 Protein 1 Protein 2 Protein 2 Affinity Maturation/Protein Design (multiple simultaneous mutations): Protein 1 Protein 1 Protein 2 Protein 2

12 Affinity Maturation can Assist with Protein Design Search multiple residue positions simultaneously for changes Use to suggest new sequences, or to influence random library design Can generate a sequence logo to visualize results

13 Surface Patch Analyzer Calculates Properties Calculates positive, negative and hydrophobic surface patches: Charge (positive, negative): atomic partial charges are smoothed over the grid points of the protein interaction surface Hydrophobicity: atomic contribution model (Crippen et al., 1999) that calculates logp from a given structure Positive patch Negative patch Hydrophobic patch ARG pentamer PHE pentamer

14 Surface Patch Analyzer Visualizes Properties Rationalizing aggregation - growth hormone proteins human hgh bovine bgh bgh_8h chimer protein experimentally determined aggregation region no aggregation strong aggregation strong aggregation

15 Homology Modeling can Build a 3D Structure Purple = direct overlap with the template Cyan = target and template sequence differ

16 BioLuminate Uses Best-in-Class Protein-Protein Docking Tools Licensed from the Vajda Group at Boston University: Kozakov, D. et al. Proteins: Struct., Funct., Bioinf., 2006, 65(2), #1 server in most recent Critical Assessment of PRediction of Interactions competition (CAPRI), 2010 Piper/CLUSPRO: #1 group #1 server

17 Predicted Complex Shows Agreement with Experimental Data Modeled FAB13B5 CDR docked with crystal structure of unbound antigen P24 (orange) versus x-ray complex 1E6J. 3 rd ranked complex shown.

18 Use the Multiple Sequence Viewer to Analyze Data

19 The BioLuminate Interface is User Friendly Selection Toolbar Favorites Toolbar Style Toolbox Task Tool Workspace Navigator Workspace 2D Overlay Status Bar Workspace Configuration Toolbar

20 The Help Menu Contains More Detail

21 Learn More with the Training Portal

22 Use Our List of Publications to Generate Ideas

23 Useful Video Links Related to Today s Workshop Protein Preparation Wizard Introduction to Biologics Suite Biologics Tasks Maestro 11 Quick Start Guide Maestro 11 Short Videos

24 Other Education Resources Schrödinger support: Knowledge Base: Support Center: Training Center: Schrödinger Seminar Series: Script Center:

25 Thanks for Joining Us! Technical Support Your Account Manager Kristin Robinson:

static MM_Index snap(mm_index corect, MM_Index ligct, int imatch0, int *moleatoms, i

static MM_Index snap(mm_index corect, MM_Index ligct, int imatch0, int *moleatoms, i BIOLUMINATE static MM_Index snap(mm_index corect, MM_Index ligct, int imatch0, int *moleatoms, int *refcoreatoms){int ncoreat = :vector mappings; PhpCoreMapping mapping; for COMMON(glidelig).

More information

What s New in Discovery Studio 2.5.5

What s New in Discovery Studio 2.5.5 What s New in Discovery Studio 2.5.5 Discovery Studio takes modeling and simulations to the next level. It brings together the power of validated science on a customizable platform for drug discovery research.

More information

Structure guided homology model based design and engineering of mouse antibodies for humanization

Structure guided homology model based design and engineering of mouse antibodies for humanization www.bioinformation.net Hypothesis Volume 10(4) Structure guided homology model based design and engineering of mouse antibodies for humanization Vinodh B Kurella & Reddy Gali* Center for Biomedical Informatics

More information

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,

More information

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,

More information

Building an Antibody Homology Model

Building an Antibody Homology Model Application Guide Antibody Modeling: A quick reference guide to building Antibody homology models, and graphical identification and refinement of CDR loops in Discovery Studio. Francisco G. Hernandez-Guzman,

More information

Protein 3D Structure Prediction

Protein 3D Structure Prediction Protein 3D Structure Prediction Michael Tress CNIO ?? MREYKLVVLGSGGVGKSALTVQFVQGIFVDE YDPTIEDSYRKQVEVDCQQCMLEILDTAGTE QFTAMRDLYMKNGQGFALVYSITAQSTFNDL QDLREQILRVKDTEDVPMILVGNKCDLEDER VVGKEQGQNLARQWCNCAFLESSAKSKINVN

More information

Introduction to Bioinformatics

Introduction to Bioinformatics Introduction to Bioinformatics http://1.51.212.243/bioinfo.html Dr. rer. nat. Jing Gong Cancer Research Center School of Medicine, Shandong University 2011.10.19 1 Chapter 4 Structure 2 Protein Structure

More information

Oracle Hyperion Planning for Interactive Users

Oracle Hyperion Planning for Interactive Users Oracle University Contact Us: 1.800.529.0165 Oracle Hyperion Planning 11.1.2 for Interactive Users Duration: 0 Days What you will learn This course is designed to teach you how to use Planning. It includes

More information

Oracle Planning and Budgeting Cloud. December 2017 Update (17.12) What s New

Oracle Planning and Budgeting Cloud. December 2017 Update (17.12) What s New Oracle Planning and Budgeting Cloud December 2017 Update (17.12) What s New TABLE OF CONTENTS REVISION HISTORY... 3 ORACLE PLANNING AND BUDGETING CLOUD, DECEMBER UPDATE... 3 ANNOUNCEMENTS AND NEW FEATURES...

More information

Structural bioinformatics

Structural bioinformatics Structural bioinformatics Why structures? The representation of the molecules in 3D is more informative New properties of the molecules are revealed, which can not be detected by sequences Eran Eyal Plant

More information

proteins GPCR 3D homology models for ligand screening: Lessons learned from blind predictions of adenosine A2a receptor complex

proteins GPCR 3D homology models for ligand screening: Lessons learned from blind predictions of adenosine A2a receptor complex proteins STRUCTURE O FUNCTION O BIOINFORMATICS GPCR 3D homology models for ligand screening: Lessons learned from blind predictions of adenosine A2a receptor complex Vsevolod Katritch, 1 Manuel Rueda,

More information

Protein-Ligand Analysis with SID

Protein-Ligand Analysis with SID Protein-Ligand Analysis with SID A new post-simulation analysis tool Dmitry Lupyan, PhD Understanding molecular processes with MD Drug discovery and design Protein-protein interactions + Protein-DNA interactions

More information

CFSSP: Chou and Fasman Secondary Structure Prediction server

CFSSP: Chou and Fasman Secondary Structure Prediction server Wide Spectrum, Vol. 1, No. 9, (2013) pp 15-19 CFSSP: Chou and Fasman Secondary Structure Prediction server T. Ashok Kumar Department of Bioinformatics, Noorul Islam College of Arts and Science, Kumaracoil

More information

6-Foot Mini Toober Activity

6-Foot Mini Toober Activity Big Idea The interaction between the substrate and enzyme is highly specific. Even a slight change in shape of either the substrate or the enzyme may alter the efficient and selective ability of the enzyme

More information

Discovery Studio. Life Science Modeling and Simulations. Platform

Discovery Studio. Life Science Modeling and Simulations. Platform Discovery Studio is a singleunified, easy-to-use, graphical interface for powerful drug design and protein modeling research. Discovery Studio contains both established gold-standard applications (e.g.,

More information

2/23/16. Protein-Protein Interactions. Protein Interactions. Protein-Protein Interactions: The Interactome

2/23/16. Protein-Protein Interactions. Protein Interactions. Protein-Protein Interactions: The Interactome Protein-Protein Interactions Protein Interactions A Protein may interact with: Other proteins Nucleic Acids Small molecules Protein-Protein Interactions: The Interactome Experimental methods: Mass Spec,

More information

Measurement & Analytics Measurement made easy. Advanced spectroscopy software for quantitative and qualitative analysis Horizon MB FTIR

Measurement & Analytics Measurement made easy. Advanced spectroscopy software for quantitative and qualitative analysis Horizon MB FTIR Measurement & Analytics Measurement made easy Advanced spectroscopy software for quantitative and qualitative analysis Horizon MB FTIR Intuitive Spectroscopy Software for MB3000 and MB3600 Spectrometers

More information

Supplementary Table 1: List of CH3 domain interface residues in the first chain (A) and

Supplementary Table 1: List of CH3 domain interface residues in the first chain (A) and Supplementary Tables Supplementary Table 1: List of CH3 domain interface residues in the first chain (A) and their side chain contacting residues in the second chain (B) a Interface Res. in Contacting

More information

Qfiniti Help Desk Workshop

Qfiniti Help Desk Workshop 3-7502 Qfiniti Help Desk Workshop Course Outline Overview This course is intended for help desk personnel to learn to support Qfiniti end users and administrators, gather troubleshooting information, perform

More information

Chapter 8. One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model. Sebastian Kmiecik and Andrzej Kolinski.

Chapter 8. One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model. Sebastian Kmiecik and Andrzej Kolinski. Chapter 8 One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model Abstract Despite the significant increase in computational power, molecular modeling of protein structure using

More information

Immunoglobulins. Harper s biochemistry Chapter 49

Immunoglobulins. Harper s biochemistry Chapter 49 Immunoglobulins Harper s biochemistry Chapter 49 Immune system Detects and inactivates foreign molecules, viruses, bacteria and microorganisms Two components with 2 strategies B Lymphocytes (humoral immune

More information

Protocol S1: Supporting Information

Protocol S1: Supporting Information Protocol S1: Supporting Information Basis for the specificity of the kinase domain of Abl for peptide substrates The crystal structures reported in this work were obtained using two different ATP analog-peptide

More information

Learning to Use PyMOL (includes instructions for PS #2)

Learning to Use PyMOL (includes instructions for PS #2) Learning to Use PyMOL (includes instructions for PS #2) To begin, download the saved PyMOL session file, 4kyz.pse from the Chem 391 Assignments web page: http://people.reed.edu/~glasfeld/chem391/assign.html

More information

Enhancing the Quality of Biologics Patents:

Enhancing the Quality of Biologics Patents: Enhancing the Quality of Biologics Patents: Computational Simulations as Evidence BCP Customer Partnership Meeting: April 26, 2016 Brian K. Lathrop, Ph.D., J.D., Sole Practitioner 4/22/2016 LAW OFFICE

More information

Applied Protein Services

Applied Protein Services Applied Protein Services Applied Protein Services A Window into the Future Development risk and attrition rates remain two of the greatest challenges to a successful biopharmaceutical pipeline. To help

More information

Supplementary materials. Computational study of β-n-acetylhexosaminidase from. Talaromyces flavus, a glycosidase with high substrate flexibility

Supplementary materials. Computational study of β-n-acetylhexosaminidase from. Talaromyces flavus, a glycosidase with high substrate flexibility Supplementary materials Computational study of β-n-acetylhexosaminidase from Talaromyces flavus, a glycosidase with high substrate flexibility Natallia Kulik 1,*, Kristýna Slámová 2, Rüdiger Ettrich 1,3,

More information

11 questions for a total of 120 points

11 questions for a total of 120 points Your Name: BYS 201, Final Exam, May 3, 2010 11 questions for a total of 120 points 1. 25 points Take a close look at these tables of amino acids. Some of them are hydrophilic, some hydrophobic, some positive

More information

Interaction Optimizer

Interaction Optimizer Interaction Optimizer Printable Help Interactive Intelligence Customer Interaction Center (CIC) 2015 R2 Last updated January 15, 2015 (See Change Log for summary of changes.) Abstract This document is

More information

Advanced QA/QC characterization MS in QC : Multi Attribute Method

Advanced QA/QC characterization MS in QC : Multi Attribute Method Advanced QA/QC characterization MS in QC : Multi Attribute Method Global BioPharma Summit The world leader in serving science A Complex Problem: Drug Safety and Quality Safety Is the product safe to use?

More information

Introduction to Bioinformatics Introduction to Bioinformatics

Introduction to Bioinformatics Introduction to Bioinformatics Dr. rer. nat. Gong Jing Cancer Research center Medicine School of Shandong University 2012.11.09 1 Chapter 5 Structure 2 Protein Structure When you study a protein, you are usually interested in its function.

More information

Copyright 2012, Oracle and/or its affiliates. All rights reserved. Insert Information Protection Policy Classification from Slide 12

Copyright 2012, Oracle and/or its affiliates. All rights reserved. Insert Information Protection Policy Classification from Slide 12 1 Copyright 2012, Oracle and/or its affiliates. All rights reserved. Insert Information Protection Policy Classification from Slide 12 JD Edwards EnterpriseOne Tools and Technologies and Fusion Applications

More information

RNA tertiary structure prediction with ModeRNA: A model of trna Thr from E. coli

RNA tertiary structure prediction with ModeRNA: A model of trna Thr from E. coli RNA tertiary structure prediction with ModeRNA: A model of trna Thr from E. coli Aim of the tutorial In this tutorial we are explain the usage of the ModeRNA program and web server. The ModeRNA tool uses

More information

ArcGIS Workflow Manager Advanced Workflows and Concepts

ArcGIS Workflow Manager Advanced Workflows and Concepts Esri International User Conference San Diego, California Technical Workshops July 26, 2012 ArcGIS Workflow Manager Advanced Workflows and Concepts Raghavendra Sunku Kevin Bedel Session Topics ArcGIS Workflow

More information

BI Workspaces User Guide SAP BusinessObjects Business Intelligence platform 4.0

BI Workspaces User Guide SAP BusinessObjects Business Intelligence platform 4.0 BI Workspaces User Guide SAP BusinessObjects Business Intelligence platform 4.0 Copyright 2011 SAP AG. All rights reserved.sap, R/3, SAP NetWeaver, Duet, PartnerEdge, ByDesign, SAP Business ByDesign, and

More information

Protein Folding Problem I400: Introduction to Bioinformatics

Protein Folding Problem I400: Introduction to Bioinformatics Protein Folding Problem I400: Introduction to Bioinformatics November 29, 2004 Protein biomolecule, macromolecule more than 50% of the dry weight of cells is proteins polymer of amino acids connected into

More information

What s New in BMC FootPrints Service Core version 12

What s New in BMC FootPrints Service Core version 12 WHAT S NEW What s New in BMC FootPrints Service Core version 12 Key Benefits Highlights impacting your experience include:» User Interface» Personalization» Visualization BMC FootPrints 12.0 has arrived.

More information

Protein NMR II. Lecture 5

Protein NMR II. Lecture 5 Protein NMR II Lecture 5 Standard and NMR chemical shifts in proteins Residue N A A B O Ala 123.8 4.35 52.5 19.0 177.1 ys 118.8 4.65 58.8 28.6 174.8 Asp 120.4 4.76 54.1 40.8 177.2 Glu 120.2 4.29 56.7 29.7

More information

Remote Support Platform for SAP Business One. June 2013 Partner External

Remote Support Platform for SAP Business One. June 2013 Partner External Remote Support Platform for SAP Business One June 2013 Partner External Remote Support Platform Advantage for SAP Business One Run Better with RSP RSP has been engineered to mitigate implementation and

More information

go vertical. for Microsoft Dynamics AX About MBS Dev Professional Microsoft Dynamics AX Partner Wholesale Distribution Suite

go vertical. for Microsoft Dynamics AX About MBS Dev Professional Microsoft Dynamics AX Partner Wholesale Distribution Suite WDS Professional Microsoft Dynamics AX Partner Improve Quality Increase Competitive Edge Enhance Service Deliver Fast Reliable Solutions Wholesale Distribution Suite High Volume Distribution (HVD) Executive

More information

SAP BusinessObjects XI 3.1. ALL INFORMATION, ALL PEOPLE, ONE PLATFORM WHAT S NEW IN SAP BusinessObjects XI 3.1

SAP BusinessObjects XI 3.1. ALL INFORMATION, ALL PEOPLE, ONE PLATFORM WHAT S NEW IN SAP BusinessObjects XI 3.1 SAP BusinessObjects XI 3.1 ALL INFORMATION, ALL PEOPLE, ONE PLATFORM WHAT S NEW IN SAP BusinessObjects XI 3.1 NEW FUNCTIONALITIES BROADER DATA ACCESS, IMPROVED USABILITY, GREATER FLEXIBILITY SAP BusinessObjects

More information

Dynamics CRM Update and Roadmap

Dynamics CRM Update and Roadmap Dynamics CRM Update and Roadmap Steven Foster and Paul Bowkett 10 August 2011 Agenda Introduction Dynamics CRM Positioning (10 mins) Dynamics CRM Roadmap (10 mins) Top 10 (ish) Features (15 mins) Questions

More information

Spectrum Mill MS Proteomics Workbench. Comprehensive tools for MS proteomics

Spectrum Mill MS Proteomics Workbench. Comprehensive tools for MS proteomics Spectrum Mill MS Proteomics Workbench Comprehensive tools for MS proteomics Meeting the challenge of proteomics data analysis Mass spectrometry is a core technology for proteomics research, but large-scale

More information

Smart decisions. Lasting value. EditAble CRM Grid. For Microsoft Dynamics CRM

Smart decisions. Lasting value. EditAble CRM Grid. For Microsoft Dynamics CRM Smart decisions. Lasting value. EditAble CRM Grid For Microsoft Dynamics CRM Crowe EditAble CRM Grid for Microsoft Dynamics CRM Table of Contents Overview... 1 EditAble CRM Grid Overview... 2 EditAble

More information

Microsoft Project Tips & Tricks. Project Solutions Group, Inc.

Microsoft Project Tips & Tricks. Project Solutions Group, Inc. Microsoft Project Tips & Tricks Project Solutions Group, Inc. Objectives Formatting & Printing Gantt Charts Leveling Resources Calculating Costs & Pricing Information Collecting & Entering Project Actuals

More information

A BPTrends Report. March

A BPTrends Report. March A BPTrends Report March 2010 www.bptrends.com Interneer Intellect Version: 6.5 Interneer Inc. 5901 Green Valley Circle, Ste 170, Culver City CA 90230 Tel: 310-348-9665 Fax: 866-622-7122 Web: www.interneer.com

More information

Agilent Genomic Workbench 7.0

Agilent Genomic Workbench 7.0 Agilent Genomic Workbench 7.0 Product Overview Guide Agilent Technologies Notices Agilent Technologies, Inc. 2012, 2015 No part of this manual may be reproduced in any form or by any means (including electronic

More information

Ensemble refinement shows conformational flexibility in crystal structures of human complement factor D

Ensemble refinement shows conformational flexibility in crystal structures of human complement factor D Supplementary Information for Ensemble refinement shows conformational flexibility in crystal structures of human complement factor D Federico Forneris a,b, B. Tom Burnley a,b,c and Piet Gros a * a Crystal

More information

Oracle Agile Product Lifecycle Management for Process

Oracle Agile Product Lifecycle Management for Process Oracle Agile Product Lifecycle Management for Process Supply Chain Relationship Management User Guide Release 6.1.1.5 E57831-01 November 2014 Oracle Agile Product Lifecycle Management for Process Supply

More information

Bringing a New Level of Simplicity to ITSM System Administration

Bringing a New Level of Simplicity to ITSM System Administration SOLUTION WHITE PAPER Bringing a New Level of Simplicity to ITSM System Administration EXECUTIVE SUMMARY Today s ITSM solutions are highly complex and serve a large and diverse user population that includes

More information

Protein Structure Databases, cont. 11/09/05

Protein Structure Databases, cont. 11/09/05 11/9/05 Protein Structure Databases (continued) Prediction & Modeling Bioinformatics Seminars Nov 10 Thurs 3:40 Com S Seminar in 223 Atanasoff Computational Epidemiology Armin R. Mikler, Univ. North Texas

More information

SAP BusinessObjects Enterprise BI Platform

SAP BusinessObjects Enterprise BI Platform SAP BusinessObjects Enterprise BI Platform Disclaimer This presentation outlines our general product direction and should not be relied on in making a purchase decision. This presentation is not subject

More information

Your Name: MID TERM ANSWER SHEET SIN: ( )

Your Name: MID TERM ANSWER SHEET SIN: ( ) MIDTERM EXAMINATION (October 23, 2008) BIOE150. Introduction to Bio-Nanoscience & Bio-Nanotechnology Professor Seung-Wuk Lee Fall Semester, 2008 0. Write down your name and the last digit of your SIN in

More information

SAP SuccessFactors Recruiting

SAP SuccessFactors Recruiting SAP SuccessFactors Recruiting Technical and Functional Specifications CUSTOMER TABLE OF CONTENTS KEY FEATURES AND FUNCTIONALITIES... 3 RECRUITING POSTING... 3 User Experience and Interface... 3 Channel

More information

B CELL EPITOPES AND PREDICTIONS

B CELL EPITOPES AND PREDICTIONS B CELL EPITOPES AND PREDICTIONS OUTLINE What is a B-cell epitope? How can you predict B-cell epitopes? WHAT IS A B-CELL EPITOPE? B-cell epitopes: Accessible structural feature of a pathogen molecule. Antibodies

More information

GeriMedProfiles. Consultant Pharmacist Software

GeriMedProfiles. Consultant Pharmacist Software GeriMedProfiles Consultant Pharmacist Software Features GerimedProfiles TM is a comprehensive medical database for clinical pharmacists Utilizes Microsoft Access as the core database allowing the end-user

More information

X-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction

X-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction X-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction Tomohisa Shimasaki 1, Hiromi Yoshida 2, Shigehiro Kamitori 2 & Koji

More information

Introduction to Protein Purification

Introduction to Protein Purification Introduction to Protein Purification 1 Day 1) Introduction to Protein Purification. Input for Purification Protocol Development - Guidelines for Protein Purification Day 2) Sample Preparation before Chromatography

More information

Valor NPI for Users. Student Workbook

Valor NPI for Users. Student Workbook Student Workbook 2017 Mentor Graphics Corporation All rights reserved. This document contains information that is trade secret and proprietary to Mentor Graphics Corporation or its licensors and is subject

More information

Quick Reference. Virtual OneStop (VOS) Employer User. Logging In

Quick Reference. Virtual OneStop (VOS) Employer User. Logging In Virtual OneStop (VOS) Employer User Logging In If you don t have an account: Click the link Not Registered? on the Home page, near the Sign In button, (name may vary, but will include Register in the link

More information

IBM Watson IoT Maximo Asset Management

IBM Watson IoT Maximo Asset Management IBM Watson IoT Maximo Asset Management Maximo 7.6 Analytic Options and Comparisons Revision 2 Pam Denny Senior Analytics Architect Maximo Analytics Options and Comparisons CONTENTS Revision History v 1

More information

Business Portal for Microsoft Dynamics GP. Requisition Management Administrator s Guide Release 10.0

Business Portal for Microsoft Dynamics GP. Requisition Management Administrator s Guide Release 10.0 Business Portal for Microsoft Dynamics GP Requisition Management Administrator s Guide Release 10.0 Copyright Copyright 2007 Microsoft Corporation. All rights reserved. Complying with all applicable copyright

More information

Dynamic Programming Algorithms

Dynamic Programming Algorithms Dynamic Programming Algorithms Sequence alignments, scores, and significance Lucy Skrabanek ICB, WMC February 7, 212 Sequence alignment Compare two (or more) sequences to: Find regions of conservation

More information

B-cell Epitope Prediction and Cloning monoclonal ADAs

B-cell Epitope Prediction and Cloning monoclonal ADAs B-cell Epitope Prediction and Cloning monoclonal ADAs Stefan Ryser, CEO, Trellis Bioscience 3 rd International Symposium on Higher Order Structure of Protein Therapeutics Arlington, Virginia, February

More information

This topic focuses on how to prepare a customer for support, and how to use the SAP support processes to solve your customer s problems.

This topic focuses on how to prepare a customer for support, and how to use the SAP support processes to solve your customer s problems. This topic focuses on how to prepare a customer for support, and how to use the SAP support processes to solve your customer s problems. 1 On completion of this topic, you will be able to: Explain the

More information

Introduction to Proteins

Introduction to Proteins Introduction to Proteins Lecture 4 Module I: Molecular Structure & Metabolism Molecular Cell Biology Core Course (GSND5200) Matthew Neiditch - Room E450U ICPH matthew.neiditch@umdnj.edu What is a protein?

More information

Docking and Design with AutoDock. David S. Goodsell Arthur J. Olson The Scripps Research Institute

Docking and Design with AutoDock. David S. Goodsell Arthur J. Olson The Scripps Research Institute Docking and Design with AutoDock David S. Goodsell Arthur J. Olson The Scripps Research Institute Rapid automated docking using: Grid-based energy evaluation Torsion-only conformation search AutoDock History

More information

Characterization of Aptamer Binding using SensíQ SPR Platforms

Characterization of Aptamer Binding using SensíQ SPR Platforms Characterization of Aptamer Binding using SensíQ SPR Platforms APPLICATION NOTE INTRODUCTION Aptamers have the potential to provide a better solution in diagnostics and other research areas than traditional

More information

MOLECULAR DOCKING STUDIES FOR IDENTIFICATION OF POTENT PHOSPHOINOSITIDE 3-KINASES (PI3KS) INHIBITORS

MOLECULAR DOCKING STUDIES FOR IDENTIFICATION OF POTENT PHOSPHOINOSITIDE 3-KINASES (PI3KS) INHIBITORS CHAPTER 7 MLECULAR DCKIG STUDIES FR IDETIFICATI F PTET PHSPHISITIDE 3-KIASES (PI3KS) IHIBITRS 7.1 Introduction Phosphoinositide 3 kinases (PI3Ks) constitute a class of enzymes that catalyse phosphorylation

More information

Purification: Step 1. Lecture 11 Protein and Peptide Chemistry. Cells: Break them open! Crude Extract

Purification: Step 1. Lecture 11 Protein and Peptide Chemistry. Cells: Break them open! Crude Extract Purification: Step 1 Lecture 11 Protein and Peptide Chemistry Cells: Break them open! Crude Extract Total contents of cell Margaret A. Daugherty Fall 2003 Big Problem: Crude extract is not the natural

More information

Purification: Step 1. Protein and Peptide Chemistry. Lecture 11. Big Problem: Crude extract is not the natural environment. Cells: Break them open!

Purification: Step 1. Protein and Peptide Chemistry. Lecture 11. Big Problem: Crude extract is not the natural environment. Cells: Break them open! Lecture 11 Protein and Peptide Chemistry Margaret A. Daugherty Fall 2003 Purification: Step 1 Cells: Break them open! Crude Extract Total contents of cell Big Problem: Crude extract is not the natural

More information

Discovery and Humanization of Novel High Affinity Neutralizing Monoclonal Antibodies to Human IL-17A

Discovery and Humanization of Novel High Affinity Neutralizing Monoclonal Antibodies to Human IL-17A Discovery and Humanization of Novel High Affinity Neutralizing Monoclonal Antibodies to Human IL-17A Contacts: Marty Simonetti martysimonetti@gmail.com Kirby Alton kirby.alton@abeomecorp.com Rick Shimkets

More information

MasterScope IT Process Management Introduction. First Edition June, 2017 NEC Corporation

MasterScope IT Process Management Introduction. First Edition June, 2017 NEC Corporation MasterScope IT Process Management Introduction First Edition June, 2017 NEC Corporation table of contents 1. Introduction of MasterScope 2. Overview of MasterScope IT Process Management 3. Use Case 4.

More information

TrueView Comes to AdWords. August 2017

TrueView Comes to AdWords. August 2017 TrueView Comes to AdWords August 2017 Section 1: Creating your TrueView campaign in AdWords TrueView is now fully integrated into the core AdWords interface! As we welcome TrueView into AdWords, we re

More information

Fundamentals of Protein Structure

Fundamentals of Protein Structure Outline Fundamentals of Protein Structure Yu (Julie) Chen and Thomas Funkhouser Princeton University CS597A, Fall 2005 Protein structure Primary Secondary Tertiary Quaternary Forces and factors Levels

More information

Sage What s New. December 2017

Sage What s New. December 2017 Sage 100 2018 What s New December 2017 2017 The Sage Group plc or its licensors. All rights reserved. Sage, Sage logos, and Sage product and service names mentioned herein are the trademarks of The Sage

More information

What s New in Microsoft Dynamics CRM 4.0. Bryan Nielson Director, Product Marketing

What s New in Microsoft Dynamics CRM 4.0. Bryan Nielson Director, Product Marketing What s New in Microsoft Dynamics CRM 4.0 Bryan Nielson Director, Product Marketing Session Agenda Introduction Dynamics CRM 4.0 Feature Areas Use Design Report Data Manage Deploy Develop Demo In Conclusion

More information

Oracle Planning and Budgeting Cloud Service

Oracle Planning and Budgeting Cloud Service Oracle Planning and Budgeting Oracle Planning and Budgeting has enabled over a thousand organizations of various sizes to quickly adopt world-class planning and budgeting applications with no CAPEX infrastructure

More information

466 Asn (N) to Ala (A) Generate beta dimer Interface

466 Asn (N) to Ala (A) Generate beta dimer Interface Table S1: Amino acid changes to the HexA α-subunit to convert the dimer interface from α to β and to introduce the putative GM2A binding surface from β- onto the α- subunit Residue position (α-numbering)

More information

Kepion Solution vs. The Rest. A Comparison White Paper

Kepion Solution vs. The Rest. A Comparison White Paper Kepion Solution vs. The Rest A Comparison White Paper In the Business Intelligence industry, Kepion competes everyday with BI vendors such as IBM Cognos, Oracle Hyperion and SAP BusinessObjects. At first

More information

Sage ERP MAS. Everything you want to know about Sage ERP MAS Intelligence. What is Sage ERP MAS Intelligence? benefits

Sage ERP MAS. Everything you want to know about Sage ERP MAS Intelligence. What is Sage ERP MAS Intelligence? benefits Sage ERP MAS Everything you want to know about Sage ERP MAS Intelligence What is Sage ERP MAS Intelligence? Sage ERP MAS Intelligence (or Intelligence) empowers managers to quickly and easily obtain operations

More information

PEAKS 8 User Manual. PEAKS Team

PEAKS 8 User Manual. PEAKS Team PEAKS 8 User Manual PEAKS Team PEAKS 8 User Manual PEAKS Team Publication date 2016 Table of Contents 1. Overview... 1 1. How to Use This Manual... 1 2. What Is PEAKS?... 1 3. What Is New in PEAKS 8?...

More information

Practically Useful: What the ROSETTA Protein Modeling Suite Can Do for You

Practically Useful: What the ROSETTA Protein Modeling Suite Can Do for You Biochemistry 2010, 49, 2987 2998 2987 DOI: 10.1021/bi902153g Practically Useful: What the ROSETTA Protein Modeling Suite Can Do for You Kristian W. Kaufmann, Gordon H. Lemmon, Samuel L. DeLuca, Jonathan

More information

Risk Management User Guide

Risk Management User Guide Risk Management User Guide Version 17 December 2017 Contents About This Guide... 5 Risk Overview... 5 Creating Projects for Risk Management... 5 Project Templates Overview... 5 Add a Project Template...

More information

IBM Partner Program for MSP

IBM Partner Program for MSP IBM Partner Program for MSP New MSP Initiative Partner World MSP Member level Benefits New MSP 1. Join PW 2. Declare your firm as an MSP Update Profile Existing BP 1. Update Profile 2. Declare your firm

More information

Expert Reference Series of White Papers. Microsoft Service Manager Simplified

Expert Reference Series of White Papers. Microsoft Service Manager Simplified Expert Reference Series of White Papers Microsoft Service Manager Simplified 1-800-COURSES www.globalknowledge.com Microsoft Service Manager Simplified Randy Muller, MCT, MCT Regional Lead, MCSE, CEH Introduction

More information

Comparative Simulation Studies of Native and Single-Site Mutant Human Beta-Defensin-1 Peptides

Comparative Simulation Studies of Native and Single-Site Mutant Human Beta-Defensin-1 Peptides Comparative Simulation Studies of Native and Single-Site Mutant Human Beta-Defensin-1 Peptides Rabab A. Toubar, Artem Zhmurov, Valeri Barsegov, * and Kenneth A. Marx * Department of Chemistry, University

More information

WasteMan 2G. Key Features. Newcastle Weighing Services Pty Ltd. Prepared by. Office: (02) Fax: (02)

WasteMan 2G. Key Features. Newcastle Weighing Services Pty Ltd. Prepared by. Office: (02) Fax: (02) WasteMan 2G Key Features Prepared by Newcastle Weighing Services Pty Ltd Office: (02) 4961 4554 Fax: (02) 4962 1137 Email: sales@nws.com.au DATABASE MANAGEMENT SYSTEMS WASTEMAN 2G KEY FEATURES WasteMan

More information

IBM Tivoli Monitoring

IBM Tivoli Monitoring Monitor and manage critical resources and metrics across disparate platforms from a single console IBM Tivoli Monitoring Highlights Proactively monitor critical components Help reduce total IT operational

More information

Structure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München

Structure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Structure formation and association of biomolecules Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Motivation Many biomolecules are chemically synthesized

More information

Peptide libraries: applications, design options and considerations. Laura Geuss, PhD May 5, 2015, 2:00-3:00 pm EST

Peptide libraries: applications, design options and considerations. Laura Geuss, PhD May 5, 2015, 2:00-3:00 pm EST Peptide libraries: applications, design options and considerations Laura Geuss, PhD May 5, 2015, 2:00-3:00 pm EST Overview 1 2 3 4 5 Introduction Peptide library basics Peptide library design considerations

More information

IBM Cognos Business Intelligence Version Getting Started Guide

IBM Cognos Business Intelligence Version Getting Started Guide IBM Cognos Business Intelligence Version 10.2.2 Getting Started Guide Note Before using this information and the product it supports, read the information in Notices on page 51. Product Information This

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION A human XRCC4-XLF complex bridges DNA ends. Sara N. Andres 1, Alexandra Vergnes 2, Dejan Ristic 3, Claire Wyman 3, Mauro Modesti 2,4, and Murray Junop 2,4 1 Department of Biochemistry

More information

Application Note AN001

Application Note AN001 Testing hybridoma supernatants with the Spots On Dots Antibody Screening Kit Application Note AN1 Table of Contents Overview... 2 Figure 1. Screening of hybridomas raised against peptide antigens... 3

More information

Increase throughput: spend less time cutting and. any CDS into Agilent's ELN

Increase throughput: spend less time cutting and. any CDS into Agilent's ELN Increase throughput: spend less time cutting and pasting. Smart Import your results directly from any CDS into Agilent's ELN e-seminar, November 18 th, 2009 Agenda Introduction on Agilent Software and

More information

Skelta. Document Management Solution. Business Process Management for All POWERED BY SKELTA BPM.

Skelta. Document Management Solution. Business Process Management for All POWERED BY SKELTA BPM. Skelta Document Management Solution POWERED BY SKELTA BPM Skelta Document Management Solution brings to you a powerful, revolutionary electronic document management solution that transforms your document-based

More information

KRONOS TRAINING MANUAL

KRONOS TRAINING MANUAL KRONOS TRAINING MANUAL Student and Temporary Employees PILOT (TEST) GROUP Department of Human Resources 210 East First Street Greenville, NC 27853-4353 Table of Contents Introduction to Kronos... 2 Logging

More information

Supplemental Information. The structural basis of R Spondin recognition by LGR5 and RNF43

Supplemental Information. The structural basis of R Spondin recognition by LGR5 and RNF43 Supplemental Information The structural basis of R Spondin recognition by LGR5 and RNF43 Po Han Chen 1, Xiaoyan Chen 1, Deyu Fang 2, Xiaolin He 1* 1 Department of Molecular Pharmacology and Biological

More information

FPO. BioPharma Compass 2.0. Innovation with Integrity. Accelerate Biopharmaceutical Analysis. Software

FPO. BioPharma Compass 2.0. Innovation with Integrity. Accelerate Biopharmaceutical Analysis. Software FPO BioPharma Compass 2.0 Accelerate Biopharmaceutical Analysis Innovation with Integrity Software Developed with the Biopharma Industry Award-winning biopharmaceutical analysis platform Commercial and

More information

Globins. The Backbone structure of Myoglobin 2. The Heme complex in myoglobin. Lecture 10/01/2009. Role of the Globin.

Globins. The Backbone structure of Myoglobin 2. The Heme complex in myoglobin. Lecture 10/01/2009. Role of the Globin. Globins Lecture 10/01/009 The Backbone structure of Myoglobin Myoglobin: 44 x 44 x 5 Å single subunit 153 amino acid residues 11 residues are in an a helix. Helices are named A, B, C, F. The heme pocket

More information