SUPPLEMENTARY INFORMATION
|
|
|
- Hugh Dawson
- 6 years ago
- Views:
Transcription
1 DOI: 1.138/n74 In the formt provided y the uthors nd unedited. d 331p 637p 9p 394p 48p 467p 22p 23p 489p 419p 3p 493p 332p 53p 39p 1 G1: 16.4% S: 73.1% G2/M: 1.5% E-KO G1: 2.2% S: 7.7% G2/M: 9.1% Exon 1 Exon 2 Exon 5 Exon 1 Exon 2 Exon 5 Exon 1 Exon 2 Exon 5 Exon 6 Exon 7 Exon 3 Exon 1-3 Exon 6 Exon 11 G1:.4% S: 62.4% G2/M:11.2% Cylin D1 Cylin D3 Cylin D2 Cylin E2 Cylin E1 G1: 44.1% S: 47.4% G2/M: 8.5% è * Cylin D3 Cylin E1 Cylin E2 Cylin A2 Cylin B1 Cylin C CDK1 CDK2 CDK4 CDK6 GAPDH Cylin D1 Cylin D2 Cylin D3 Cylin E1 GAPDH e Perentge of ells D-KO E-KO G1 S G2/M Supplementry Figure 1 Anlyses of ES ells., PCR nlysis of two independent ontrol (1 nd 2), ylin D1 -/- D2 -/- D3 -/- E1 Δ/Δ E2 -/- (1 nd 2) nd one ylin E1 Δ/Δ E2 -/- (E-KO) ES ell lines. PCR primers (see Supplementry Tle 2) were used to mplify the indited exons of the ylin D1, D2, D3, E1 nd E2 genes. Note tht ylin D1 -/-, D2 -/-, nd D3 -/- lleles lk exons 1 nd 2, ut ontin intt exon 5 (refs 54-), ylin E1 Δ/Δ lk exons 6 nd 7, ut ontin exon 3 (ref. 57), while the ylin E2 -/- lleles lk exons 1-3 nd 6, ut ontin exon 11 (ref. 3). The sizes of the mplified frgments re shown on the left., Western lot nlysis of ontrol nd ES ell lines with the indited ntiodies. An rrow points to the ylin E1-speifi nd nd str mrks ross-reting non-speifi nd. GAPDH ws used s loding ontrol., Western lot nlysis of ontrol nd MEFs with the indited ntiodies. GAPDH ws used s loding ontrol., nd re representtive of 3 independent experiments. d, Control (), ylin D1 -/- D2 -/- D3 -/- (D-KO), ylin E1 Δ/Δ E2 -/- (E-KO) nd ylin D1 -/- D2 -/- D3 -/- E1 Δ/Δ E2 -/- () ES ells were pulsed with romodeoxyuridine (BrdU) for 1 hr, stined with n nti-brdu ntiody nd propidium iodide nd nlyzed y flow ytometry. Shown re the perentges of ells in the indited ell yle phses, representtive of n=4 independent experiments. e, Brs depiting the perentges of ells in the indited ell yle phses (determined s in pnel d) in four independent, D-KO, E-KO or ES ell lines. The men vlues (± s.d.) were [%]: : G1, 15.1 ± 1.; S, 75.7 ± 1.8; G2/M 9.2 ± 1.2; D-KO: G1, 19.7 ±.4; S,.1 ± 1.; G2/M, 8.1 ±.7; E-KO: G1, 28. ± 1.6; S, 6.6 ± 2.6; G2/M 11.4 ± 2.6; : G1,.9 ± 2.6; S, 44.7 ± 3.8; G2/M 11.4 ± 2.8. Anlyses were done 3 times. Soure dt for e n e found in Supplementry Tle Mmilln Pulishers Limited, prt of Springer Nture. All rights reserved.
2 Reltive trnsript levels * * * D-KO E-KO E-KO D-KO Reltive levels (%) 1 5 D-KO E-KO Numer of genes vs >2 >4 Fold hnge Down Up e Flg- 4E Flg-GFP IB: Flg d P-vlue (-log 1 ) Down Up vs 4E Endogenous IB: Fold hnge (log 2 ) Supplementry Figure 2 Moleulr nlyses of ES ells., Reversetrnsription quntittive PCR nlysis of the indited trnsripts in ontrol (), ylin D1 -/- D2 -/- D3 -/- (D-KO), ylin E1 Δ/Δ E2 -/- (E-KO) nd ylin D1 -/- D2 -/- D3 -/- E1 Δ/Δ E2 -/- () ES ells. Shown re men ± s.d. of n=3 independent experiments. Men expression levels oserved in ES ells were set s 1., Left pnel: immunolot nlysis of, E-KO, D-KO nd ES ells with ntiodies ginst ore pluripoteny ftors, representtive of n=3 independent experiments. ws used s loding ontrol. Right pnel: quntifition of the densitometri snning of nd intensities from the left pnel, men ± s.d. of n=3 independent experiments. nd d, RNA-Seq nlysis of ES ells., Numer of trnsripts downregulted (Down) or upregulted (Up) t lest two-fold (> 2), or t lest 4-fold (> 4) in ES ells s ompred to ES ells. Three lines of nd ES ells were used for nlysis. d, Volno plot of RNA-Seq results showing p-vlues nd fold hnge. e, ES ells were trnsdued with lentiviruses enoding Flg-tgged GFP or Flg-tgged 4E mutnt ontining phospho-mimiking glutmi id sustitutions within ll four ylin E-CDK2-dependent phosphoresidues. Lystes were immunolotted with n nti-flg ntiody (to detet etopilly expressed proteins), nd with ntiodies ginst (to detet endogenous nd etopilly expressed 4E mutnt), nd, representtive of 3 independent experiments. served s loding ontrol. Twotiled t-tests were used (*, p <.5;, p <.1;, p <.1; NS). Soure dt for nd n e found in Supplementry Tle Mmilln Pulishers Limited, prt of Springer Nture. All rights reserved.
3 T1 T2 T3 N1 N2 N3 N4 Cylin D3 Cylin D3 Cylin E1 Cylin E1 Supplementry Figure 3 Expression of G1 ylins in wild-type tropholst nd neurl progenitor ells., Humn tropholst ell lines HTR-8/SVneo (T1), JEG-3 (T2), nd BeWo (T3), s well s ontrol humn rest ner ell line MDA-MB-6 (), nd, A murine neurl stem/progenitor ell line, kind gift of Dr. C. Stiles (N1), mouse neurl stem/progenitor ell lines NE-4C (N2) nd NE-GFP-4C (N3), nd rt fetl neurl stem/progenitor ell line N77441 (N4) were nlyzed y immunolotting with the indited ntiodies. served s loding ontrol. Note tht wild-type tropholst nd neurl stem/progenitor ells normlly express G1 ylins. Results re representtive of 3 independent experiments Mmilln Pulishers Limited, prt of Springer Nture. All rights reserved.
4 Supplementry Figure CHX (hr) Log 2 fold hnge in reltive protein levels Time fter CHX (hr) Hours * Log 2 fold hnge in reltive protein levels Time fter CHX (hr) Hours * d Time fter CHX (hr) e MG132 (1 µm) Log 2 fold hnge in reltive protein levels Hours Supplementry Figure 4 Anlyses of, nd degrdtion in ES ells., Control nd ES ells were treted with 1 μg/ ml yloheximide (CHX, to lok new protein synthesis) for the indited times. The levels of, nd proteins were determined y immunolotting. served s loding ontrol., nd intensities from immunolots s in were quntified, normlized ginst tuulin nd plotted. Eh dt-point represents men vlue derived from n=3 independent experiments. Right pnel shows lulted men hlflife of in nd ES ells, men ± s.d. of n=3 independent experiments. P=.8., Similr nlysis s in for protein, men ± s.d. of n=3 independent experiments. P=.8. d, Similr nlysis s in for protein, men ± s.d. of n=3 independent experiments. P=.14. e, nd ES ells were treted with protesome inhiitor MG132 (+), or left untreted ( ), nd the levels of, nd proteins were determined y immunolotting. served s loding ontrol. Results re representtives of n=3 (-d) or 4 (e) independent experiments. Twotiled t-tests were used (*, p <.5;, p <.1;, p <.1). Soure dt for, d nd e n e found in Supplementry Tle Mmilln Pulishers Limited, prt of Springer Nture. All rights reserved.
5 1 2 3 HA- 4A E CHX (hr) HA GFP Log 2 fold hnge in reltive protein levels Time fter CHX (hr) A 4E HA- 3A E CHX (hr) HA GFP d Log 2 fold hnge in reltive protein levels Time fter CHX (hr) A 3E e HA- 4A E CHX (hr) HA GFP f Log 2 fold hnge in reltive protein levels Time fter CHX (hr) A 4E g h i Ni-NTA pull-down EV 4A HA- His-U IB: HA Poly-U HA- Ni-NTA pull-down EV 3A HA- His-U IB: HA Poly-U HA- Ni-NTA pull-down EV 4A HA- His-U IB: HA Poly-U HA- WCL IB: HA WCL IB: HA WCL IB: HA Supplementry Figure 5 Anlyses of, nd phosphomutnts., nd e, HeL ells were trnsfeted with plsmids enoding HA-tgged wild-type, or () or enoding mutnt proteins ontining phospho-intivting lnine (4A or 3A) or phospho-mimiking glutmi id (4E or 3E) sustitutions within ll ylin E-CDK2-dependent residues, together with CMV-GFP plsmid. Cells were treted with 1 μg/ml yloheximide (CHX) for the indited times, whole ell lystes were prepred nd immunolotted with n nti-ha ntiody, s well s with n nti-gfp (ontrol of trnsfetion effiieny) nd n nti-tuulin ntiody (loding ontrol)., d nd f, HA nd intensities were quntified, normlized with GFP, nd plotted. g i, 293T ells were trnsfeted with empty vetors (EV), or with expression plsmids enoding (in pnel g) wild-type HA- () or mutnt HA- ontining lnine (4A) sustitutions within ylin E-CDK2-dependent residues; or (in pnel h) wild-type HA- () or mutnt HA- ontining lnine (3A) sustitutions within ylin E-CDK2-dependent residues; or (in pnel i) wild-type HA- () or mutnt HA- ontining lnine (4A) sustitutions within ylin E-CDK2-dependent residues, together with histidine-tgged uiquitin (His-U) expression plsmids. Cells were treted with 15 μm MG132 overnight efore protein extrtion. Cell extrts were inuted with Ni-NTA mtries to pture uiquitinted proteins vi His- NTA intertion. Immoilized proteins were resolved y SDS PAGE nd immunolotted with n nti-ha ntiody (IB: HA, upper pnels, Ni-NTA pull-down) to detet polyuiquitinted, or. Whole ell lystes (WCL) were lso resolved y SDS PAGE nd immunolotted with n nti-ha ntiody (IB: HA, lower pnels). Note tht phospho-intivting (lnine) sustitutions strongly inresed uiquitintion of, nd proteins. Results in -i re representtives of n=3 independent experiments. Soure dt for, d nd f n e found in Supplementry Tle Mmilln Pulishers Limited, prt of Springer Nture. All rights reserved.
6 Reltive protein levels (%) VO 1 (µm) 5 5 AS AS AS AS AS AS B1-CDK Flg-tgged è * è * IP: Flg è IB: ThioP IB: Flg IB: ThioP Supplementry Figure 6 Anlyses of the effet of on, nd protein levels in ES ells., Quntifition of the results from the three ES ell lines shown in Fig. 8. The levels of eh protein in ells treted with vehile only (VO) were set s 1%. Shown re men ± s.d. of n=3 independent experiments. Two-tiled t-tests were used (, p <.1)., Tretment of ES ells with leds to further derese in the levels of pluripoteny ftors. Comprison of the levels of the indited proteins etween ontrol ES ells treted with vehile only (, ), ES ells treted with vehile only (, ), nd ES ells treted with 1 μm, whih inhiits CDK2 nd CDK1 (, 1). Protein lystes were immunolotted with the indited ntiodies., CDK1 n phosphorylte pluripoteny ftors. In-ell kinse retions. 293T ells were trnsfeted with onstruts enoding ylin B1 together with nlog-sensitive CDK1 (AS), or with wild-type CDK1 (), nd with Flg-tgged versions of, or (+Flg-tgged) or with empty vetors (-). Cells were permeilized nd inuted with 6-PhEt-ATPγS. Only AS kinses n utilize this ulky ATP version, nd hene they trnsfer thiophosphte moieties to their sustrtes. Upper pnels: following inution with 6-PhEt-ATPγS, Flg-tgged, or proteins were immunopreipitted (IP) with n nti-flg ntiody, nd immunolots were proed (IB) with n ntithiophosphte ester ntiody (ThioP). Bnds orresponding to nd proteins re mrked y rrows, non-speifi nds y strs. Middle pnels: lystes were immunolotted with n nti-flg ntiody (to detet trnsfeted proteins). Lower pnels: lystes were immunolotted with n nti-thiophosphte ester ntiody to onfirm tht AS CDK1-ylin B1 kinse phosphoryltes lrge numer of endogenous sustrtes, s expeted. Results re representtives of 5 () or 3 () independent experiments. Soure dt for n e found in Supplementry Tle Mmilln Pulishers Limited, prt of Springer Nture. All rights reserved.
7 Perentge of poptoti ells VO BT74 BT112 BT182 BT248 Perentge of ells VO MDA-MB-6 HCC38 CAL51 Perentge of ells * * * VO Supplementry Figure 7 Response of ptient-derived gliolstom tumorinititing ells nd humn triple-negtive rest ner ells to tretment. The indited ell lines were treted with vehile only (VO) or with 1 μm for 48 hr., Cells were stined for Annexin V nd nlyzed y flow ytometry. Shown re perentges of poptoti (Annexin V + ) ells, men ± s.d. of n=3 independent experiments. nd, gliolstom () nd rest ner ells () were pulsed with BrdU, stined with n nti-brdu ntiody nd propidium iodide nd nlyzed y flow ytometry. Shown re perentges of ells in the indited ell yle phses, men ± s.d. of n=3 independent experiments. Two-tiled t-tests were used (*, p <.5;, p <.1;, p <.1; NS). Soure dt n e found in Supplementry Tle Mmilln Pulishers Limited, prt of Springer Nture. All rights reserved.
8 MDA-MB-6 1 (µm) 4E Endogenous Perentge of poptoti ells E Perentge of ells G1 S G2/M vetor VO G1 S G2/M 4E mutnt HCC38 1 (µm) 4E Endogenous Perentge of poptoti ells E Perentge of ells VO 8 * G1 S G2/M G1 S G2/M vetor 4E mutnt CAL51 1 (µm) 3E Endogenous Perentge of poptoti ells * * 3E Perentge of ells G1 S G2/M vetor VO G1 S G2/M 3E mutnt Supplementry Figure 8 Anlyses of humn triple-negtive rest ner ell lines etopilly expressing phosphomimiking or mutnts., MDA-MB-6 ells were engineered to etopilly express Flg-tgged mutnt ontining phospho-mimiking glutmi id sustitutions within ll four ylin E-CDK2-dependent phosphoresidues ( 4E). Left pnel, ells were treted with vehile only () or with 1 μm (1) for 48 hr. Protein lystes were immunolotted for 4E (using n nti- Flg ntiody) or for the endogenous. served s loding ontrol. Note tht 4E mutnt ws resistnt to tretment, i.e. its levels did not derese upon tretment of ells with the inhiitor, in ontrst to the endogenous. Middle pnel, ells stly expressing 4E, or ontrol ells trnsdued with n empty vetor () were treted with vehile only (VO) or with 1 μm for 48 hr, stined for Annexin V nd nlyzed y flow ytometry. Shown re perentges of poptoti (Annexin V + ) ells, men ± s.d. of n=3 independent experiments. Right pnel, ells stly expressing 4E, or ontrol ells trnsdued with n empty vetor ( vetor) were treted with s ove, pulsed with BrdU, stined with n nti-brdu ntiody nd propidium iodide nd nlyzed y flow ytometry. Shown re men ± s.d. of n=3 independent experiments. Note tht expression of 4E did not ffet the poptoti nd ell yle response of MDA-MB-6 ells to (lso ompre with Supplementry Fig. 7, )., Similr nlysis s in using humn triple-negtive rest ner ell line HCC38 engineered to etopilly express 4E mutnt. Shown re men ± s.d. of n=3 independent experiments., Similr nlysis s in using humn triple-negtive rest ner ell line CAL51 engineered to etopilly express Flg-tgged mutnt ontining phospho-mimiking glutmi id sustitutions within ll three ylin E-CDK2-dependent phosphoresidues ( 3E). Shown re men ± s.d. of n=3 independent experiments. Two-tiled t-tests were used (*, p <.5;, p <.1;, p <.1). Soure dt n e found in Supplementry Tle 5. Western lots shown re representtives of n=3 independent experiments Mmilln Pulishers Limited, prt of Springer Nture. All rights reserved.
9 Fig. 3 Fig. 3d Fig. 3e Cylin E1 17 Cylin D1 Cylin D2 Cylin D3 17 Supplementry Figure 9 Unproessed originl sns of lots Mmilln Pulishers Limited, prt of Springer Nture. All rights reserved.
10 Fig. 7 Fig E-CDK2 D3-CDK Uiquitin Fig. 7d Supplementry Figure 9 Continued Mmilln Pulishers Limited, prt of Springer Nture. All rights reserved.
11 17 11 Fig. 7e p-s/t-p MPM2 Pin1 IgG hevy hin 17 Fig. 7f p-s/t-p MPM2 Pin1 IgG hevy hin Fig. 7f p-s/t-p MPM2 Pin1 IgG hevy hin Supplementry Figure 9 Continued Mmilln Pulishers Limited, prt of Springer Nture. All rights reserved.
12 Fig. 8 Fig. 8 J1 V6.5 BT74 BT112 BT182 BT248 Fig. 8e Fig. 8f MDA-MB-6 HCC38 Supplementry Figure 9 Continued Mmilln Pulishers Limited, prt of Springer Nture. All rights reserved.
13 Supplementry Tle Legends Supplementry Tle 1 Antiody informtion. Supplementry Tle 2 Sequenes of PCR primers. Supplementry Tle 3 Comprisons of trnsript undne etween nd ES ells. The Tle hs three sheets. The first sheet ( vs ) ompres the undne of the indited trnsripts etween nd ES ells. Columns list: (A) gene ID (from UCSC hg19 referene); (B) men normlized ounts (semen); (C) log 2 fold hnge; (D) the stndrd error of the log 2 fold hnge (lfse); (E) the log 2 fold hnge divided y lfse (stt); (F) two-tiled p-vlue otined using the Wld test; (G) djusted p-vlue (Benjmini-Hoherg test). DESeq2 performs independent filtering y defult using the men of normlized ounts s filter sttisti. The djusted p-vlues for the genes whih do not pss the filter threshold re mrked s NA (suh s Prg3). Genes upregulted t lest 4-fold in re highlighted in red, genes downregulted t lest 4-fold in re highlighted in lue. The seond sheet lists genes upregulted t lest 4-fold in. Trophetoderml/tropholst genes re mrked in olumn (H), nd referenes listed in olumn (I). The third sheet lists genes downregulted t lest 4-fold in. Supplementry Tle 4 Mpping of ylin E-CDK2-dependent phosphosites on, nd. Supplementry Tle 5 Sttistis soure dt Mmilln Pulishers Limited, prt of Springer Nture. All rights reserved.
Supplementary Figure S1. Akaike et al.
reltive expression of HIPK2 (HIPK2/GAPDH) Supplementry Figure S1. Akike et l. 1.25 ontrol HIPK2 #1 1 HIPK2 #2 HIPK2 3 U 0.75 0.5 0.25 0 ontrol : + + - HIPK2 #1: - - - + + - - - - HIPK2 #2: - - - - + +
SUPPLEMENTARY INFORMATION
1 1 μm c d EGF + TPA + e f Intensity 1.8 1.6 1.4 1.2 1.8.6.4.2 2 4 8 2 4 8 (Hours) 2 4 6 8 1 Time (Hours) Reltive luciferse ctivity 4 3 2 1 + CAMEK1 FRE reporter Figure S1 inhiitor incresed protein expression
HeLa. CaSki. Supplementary Figure 1. Validation of the NKX6.1 expression in mrna level and
Supplementry Figure. Li et l. Reltive expression ( / GAPDH ) 6 5 4 3 2 5 Reltive expression ( / GAPDH ) 4 3 2 Reltive expression ( / GAPDH ) 4 3 2 Reltive expression ( / GAPDH ) 4 3 2 Ve S Ve S2 S S2 Ve
Gan et al., Supplemental Figure 1
Gn et l., Supplementl Figure IB: DU45 Unp IB: py-68 IB: perk IB: ERK IB: Akt Unp DU45 DU45 ErB2 - EGF - EGF ErB2 75 75 Supplementl Figure. DU45 nd ells predominntly express nd re highly responsive to EGF.
SUPPLEMENTARY INFORMATION
S shrna S Viility, % of NT sirna trnsfete ells 1 1 Srmle NT sirna Csp-8 sirna RIP1 Atin L929 shrna sirna: Csp8 Atin L929: shrna Csp8 e Viility, % of NT sirna trnsfete ells NT sirna Csp-8 sirna M45 M45mutRHIM
SUPPLEMENTARY INFORMATION
DOI: 1.138/nc2274 EpH4 Prentl -/MDCK EpH4 Prentl -/MDCK - FERM- Figure S1 (kd) delferm- (1-438)- c Prentl MDCK -/MDCK deljfr- Input Control IP IP Input Control IP IP d Control Control Figure S1 () Specificity
SUPPLEMENTARY INFORMATION
doi:10.1038/nture10924 no tg Lsm1-my Lsm2-my Lsm5-my Lsm6-my Lsm7-my Lsm8-my no tg Lsm1-my Lsm2-my Lsm5-my Lsm6-my Lsm7-my Lsm8-my kd 220 120 100 80 60 50 40 30 20 SeeBlue Mrker Mgi Mrk no tg Sm1-my Smd3-my
melf4 Vec Fold induction ELF4 STK38 MAVS IFNa8- Luc
IfnβmRNA() m h m h Type I IFN(unit/ml) Supplementry Informtion Supplementry Figures 3 7 3 2 2 35 1 1 mifnβ-lu hifnβ-lu Med HIV-1 EMCV SeV Poly(IC) Poly(dAdT) d e f g h 8 4 2 1 12 6 9 6 3 12 6 IFN2-Lu IFN4
Supplementary Figure S1. MKRN1 depletion induces apoptosis via the caspase-8 pathway. kda h 72h 96h 6.8 % 22.5 % 21.
Supplementry Figure S1. depletion indues poptosis vi the spse-8 pthwy. Atin 61.5 46.2 48h 72h 96h zvad 96h 5. % 6.8 % 8.7 % 4.3% simk1#5 9.5 % 22.5 % 39.6 % 11.8 % simk1#6 8. % 21.7 % 33.5 % 11. % 48h
SUPPLEMENTARY INFORMATION
Pulldown HeL lyste lyste lyste 25 5 75 5 5kD 37 25 5 MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTP LHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKA KAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKG
Unprecedented inhibition of tubulin polymerization directed by gold nanoparticles inducing cell cycle arrest and apoptosis
Eletroni supplementry informtion (ESI) for Nnosle Unpreedented inhiition of tuulin polymeriztion direted y gold nnoprtiles induing ell yle rrest nd poptosis Diptimn Choudhury,,e, Pulrjpilli Lourdu Xvier,,
Interplay between NS3 protease and human La protein---- by Ray and Das Supplementary fig 1. NS3 pro
Interply etween tese nd humn L protein---- y Ry nd Ds Supplementry fig 1 1 2 3 4 UV crosslinking ssy: α[ 32 P]UTP leled HCV IRES RNA ws UV-crosslinked to incresing concentrtions (0.1, 0.2 nd 0.4µM) in
SUPPLEMENTARY INFORMATION
DOI: 0.038/n2228 HepG2 (ell pellet ml) Nuler Extrts (.8 mg) -epenent intertnts HepG2 (ell pellet 55.5 ml) Nuler Extrts (227.7 mg) glutthione sephrose F.T. glutthione sephrose F.T. oun F.T. oun F.T. -FXR
Fluorescence Intensities of. GFP-PAC-1 Strains
DOI: 10.1038/ncb3168 Arbitrry Fluorescence Units 2500 2000 1500 1000 500 0 full length (1-4) Fluorescence Intensities of GFP-PAC-1 Strins ΔPH 392-838 575-4 GFP-PAC-1 Strins 2-610 1-574 b control c pc-1(3
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nture11303 c Supplementry Figure 1: Genertion of INCB18424 persistent B/F3 Epor- V617F (EporVF) cells, which re cross resistnt to other inhiitors. : () Nïve EporVF
SUPPLEMENTARY INFORMATION
doi: 1.138/nture77 c 2 2 1 15 1 1 5 1 1 5 5 129Sv 1.5 h IL-6 / HPRT 3 h 5 h 6 4 2 d 129Sv 4 4 3 3 2 1 1 8 6 4 2 e f g C57/BL6 Poly(dA-dT) Cell numer (normlized to medium control) 1 5 1 5 1 5 Fluorescence
a ATP release 4h after induction
doi:1.138/nture9413 ATP relese 4h fter induction of poptosis (nm) 5 ATP 4 3 2 1 UV UV + zvad 1μM 3μM 5μM UV + 1μM 3μM 5μM UV + 18AGA 1μM 3μM 5μM UV + FFA HeL monolyer Scrpe Dye trnsfer HeL HeL-Cx43 HeL-Cx43
sensitive VBSs Vh subdomains EF EF
Tlin- Tlin-EGFP-His 2 3 2 3 ABD Mehno- ABD2 ABD3 sensitive VBSs DD 6xHis EGFP Vh sudomins EGFP-Vinulin EGFP 2 3 4 Vt EGFP-Vh EGFP 2 3 4 -tinin- CH CH2 SP SP SP SP EF EF mcherry--tinin- mcherry CH CH2 SP
PML regulates p53 stability by sequestering Mdm2 to the nucleolus
regultes stility y sequestering to the nuleolus Ros Bernrdi 1,Pier Polo Sglioni 1,3,Stephn Bergmnn 1,3,Henning F. Horn 2,Kren H. Vousden 2 nd Pier Polo Pndolfi 1,4 The promyeloyti leukemi () tumour-suppressor
Lineage-specific functions of Bcl6 in immunity and inflammation are mediated through distinct biochemical mechanisms
Supplementry informtion for: Linege-specific functions of Bcl6 in immunity nd inflmmtion re medited through distinct iochemicl mechnisms Chunxin Hung, Kterin Htzi & Ari Melnick Division of Hemtology nd
Figure S1 Yoo et al.
doi:.38/nture6543 8 8 6 6 4 4 d Protoplsts Leves Reltive promoter ctivity (%) Reltive trnscript level 2 2 88 66 44 22 32 2 2 MKK-MYC MPK ctivity nti-mpk6 c ctr MKK - 4 5 4 5 MKK-MYC MPK3 ctivity MPK6 ctivity
Figure S1. Characterization of sirna uptake in HeLa cells.
Supplementry Informtion The Rough Endoplsmti Retiulum is Centrl Nuletion Site of sirna-medited RNA Silening Luks Stlder, Wolf Heusermnn, Len Sokol, Domini Trojer, Joel Wirz, Justin Hen, Anj Fritzshe, Florin
*** supplementary information. axon growth (µm/1h) 5 ng/ml NGF. 150 ng/ml NGF. 20 ng/ml NGF. n.s. n.s. n.s. DOI: /ncb1916
DOI: 1.138/n1916 25 xon growth (µm/1h) 2 15 1 5 ng/ml NGF 5 ng/ml NGF 2 ng/ml NGF 1 ng/ml NGF 15 ng/ml NGF Figure S1 () Doseresponse urve for xon outgrowth in response to NGF. Speifi tivities of NGF from
SUPPLEMENTARY INFORMATION
NCS (ng/ml) Time (min) kd 500 500 0 30 0 30 IP: IP: 112 105 75 IB: ps407 IB: Mdm2 NCS + + IB: IB: tuulin IP input sup NCS (ng/ml) 50 100 500 Time (min) 0 15 30 60 120 15 30 60 120 15 30 60 120 IB: ps407
SUPPLEMENTARY INFORMATION
SUPPLEMENTRY INFORMTION DOI:./n7 d Tm d- d- Frequeny, e+ e+ kp e+ e+.e+ Ctegory # peks % peks % genome Fold Enrihment k upstrem TSS.7 9..77 Exon..7. ' UTR...7 ' UTR... Intron 79.
Electrostatic vs covalent bond in modified Jeffamine: effect on the phase behaviour and on the templating of mesoporous silica
Eletroni upplementry Mteril (EI) for oft Mtter This journl is The Royl oiety of Chemistry 3 upporting Informtion Eletrostti vs ovlent ond in modified Jeffmine: effet on the phse ehviour nd on the templting
supplementary information
DOI: 10.1038/n2036 GFP2XFYVE GFP2XFYVE GFP2XFYVE ntigfp Protein A 10 nm GFP2XFYVE C215S e f g GFP2XFYVE TRANSFERRIN Figure S1 PtIns3P lolises to the mioy uring ytokinesis n ololises with reyling enosoml
Substrate elasticity provides mechanical signals for the expansion of hemopoietic stem and progenitor cells
correction notice Nt. Biotechnol. 28, 1123 1128 (21); pulished online 3 Octoer 21; corrected fter print 27 April 211 Sustrte elsticity provides mechnicl signls for the expnsion of hemopoietic stem nd progenitor
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:1.138/nture1371 As Brc11 (null) Brc5-13cK (conditioned llele) Reltive levels of mrna d C 1.2 1.8.6.4.2 Cereellum Ec Ev Ev As KO c Frequency Thymus KO KO 1 neo 11 Ec As 4 loxp
Negative regulation of TLR4 via targeting of the proinflammatory tumor suppressor PDCD4 by the microrna mir-21
Negtive regultion of TLR vi trgeting of the proinflmmtory tumor suppressor y the mirorna mir-1 Frederik J Sheedy 1, Ev Plsson-MDermott 1, Elizeth J Hennessy 1, Cr Mrtin,, John J O Lery,, Qingguo Run, Derek
iaspp oncoprotein is a key inhibitor of p53 conserved from worm to human 12.5 no irradiation +100 J/m 2 UV germ-cell corpses / gonad arm
onoprotein is key inhiitor of onserved from worm to humn 23 Nture Pulishing Group http://www.nture.om/nturegenetis Dniele Bergmshi 1 *, Yrden Smuels 1 *, Nigel J. O Neil 2 *, Giuseppe Triginte 1, Tim Crook
Aneuploidy generates proteotoxic stress and DNA damage concurrently with p53-mediated post-mitotic apoptosis in SAC-impaired cells
ARTICLE Reeived 3 Nov Aepted Jun 5 Pulished 6 Jul 5 DOI:.38/nomms8668 OPEN Aneuploidy genertes proteotoxi stress nd DNA dmge onurrently with p53-medited post-mitoti poptosis in SAC-impired ells Akihiro
A functional genomic screen identifies a role for TAO1 kinase in spindle-checkpoint signalling
A funtionl genomi sreen identifies role for kinse in spindle-hekpoint signlling Viji M. Drvim 1,5, Frnk Stegmeier 2,5, Grzegorz Nlep 3, Mthew E. Sow 3, Jing Chen 3, Anthony Ling 2, Gregory J. Hnnon 4,
SUPPLEMENTARY INFORMATION
DOI: 10.1038/nc2885 kd M ΔNZipA 66.4 55.6 ZipA 42.7 34.6 6x His NiNTA 27.0 c 1.,, 2. evnescent field supported memrne Supplementry Figure 1 Experimentl ssy. () Illustrtion of protein interctions (dpted
Supplemental Figure S1
Supplementl Figure S1 TG nrt1.5- Li et l., 1 nrt1.5- Lin et l., 8 F L CTGCCT R T 5'UTR 3'UTR 1 3 81p (k) nrt1.5- C nrt1.5- Supplementl Figure S1. Phenotypes of the T-DN insertion mutnts (this pper), nrt1.5-
WesternBright TM MCF and MCF-IR
WesternBright TM MCF nd MCF-IR Quntittive, multi-color fluorescent Western lotting kits WesternBright MCF visile nd ner infrred (IR) fluorescent Western lotting kits llow the ssy of two proteins t once,
Won Jung, Seung Min An, Whaseon Lee-Kwon, Mario Chiong1, Sergio Lavandero1,2, and Hyug
Supplementry Informtion suppresses IL-1-medited immunomodultion Soo Youn Choi, Hwn Hee Lee, Jun Ho Lee, Byeong Jin Ye, Eun Jin Yoo, Hyun Je Kng, Gyu Won Jung, Seung Min An, Whseon Lee-Kwon, Mrio Chiong1,
SUPPLEMENTARY INFORMATION
SI Fig. PrpS is single copy gene k 3. 9... EcoRV EcoRV k 5 BmH Pst c well k HindIII HindIII HindIII.3.5 3.. Southern lots of Ppver genomic DNA from plnts with SS8 hplotypes, hyridized with PrpS proe..
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nture10177 MDYKDHDGDYKDHDIDYKDD DDKMAPKKKRKVGIHGVPAA MAERPFQCRICMRKFAQSGD LTRHTKIHTGEKPFQCRICM RNFSRSDVLSEHIRTHTGEK PFACDICGKKFADRSNRIKH TKIHTGSQKPFQCRICMRNF SRSDNLSEHIRTHTGEKPFA
BRCA1 tumour suppression occurs via heterochromatin-mediated silencing
doi:.38/nture37 BRCA tumour suppression ours vi heterohromtin-medited silening Qun Zhu *, Gerld M. Po *, Alexis M. Huynh {, Hoonkyo Suh {, Nin Tonnu, Petr M. Nederlof 2, Fred H. Gge & Inder M. Verm Muttions
COS-1 cells transiently transfected with either HA hgr wt, HA hgr S211A or HA hgr S226A
1 SUPPLEMENTRY FIGURES Fig. 1 & Specificity of the nti-p-s211 nd nti-p-s226 ntibodies COS-1 cells trnsiently trnsfected with either H hgr wt, H hgr S211 or H hgr S226 were treted with 1nM Dex for 1 hour.
JBC Papers in Press. Published on June 2, 2010 as Manuscript M Mbnl1 binds to IR intronic enhancer
JBC Ppers in Press. Pulished on June 2, 2010 s Mnusript M109.095224 The ltest version is t http://www.j.org/gi/doi/10.1074/j.m109.095224 Mnl1 inds to IR introni enhner MUSCLEBLIND-LIKE 1 (MBNL1) PROMOTES
SUPPLEMENTARY INFORMATION
DOI: 1.138/nc3386 β-ctin (S) (A) - - - TGN46 116 kd 97 45 level (% of ) 1 8 6 4 2 EEA1 (S) (A) c 1 Reltive mrna levels normlized to β-ctin 8 6 4 2 TFEB KD MCOLN1 KD PI4KIIIβ KD PIP5K1α KD PIP5K1β KD VPS
Jay S Desgrosellier, Leo A Barnes, David J Shields, Miller Huang, Steven K Lau, Nicolas Prévost, David Tarin, Sanford J Shattil and David A Cheresh
Integrin αvβ3/c-src Oncogenic Unit Promotes Anchorge-independence nd Tumor Progression Jy S Desgrosellier, Leo A Brnes, Dvid J Shields, Miller Hung, Steven K Lu, Nicols Prévost, Dvid Trin, Snford J Shttil
Supplementary Figure 1
Supplementry Figure 1 d6 d8 d9 SSC.575 27.4 35.1 d1 d12 d2 39.6 5.4 67.3 NKX2-5-GFP Supplementry Figure 1 Differentition kinetics of the NKX2-5-GFP HES3 hesc line (Elliott et l., 211). Flow cytometric
Cysteine methylation disrupts ubiquitin-chain sensing in NF-kB activation. NF-κB activation (fold change) NleE TRAF p-ikk /β.
doi:10.1038/nture10690 Cysteine methyltion disrupts uiquitin-hin sensing in NF-kB tivtion Li Zhng 1,2, Xiojun Ding 2, Jixin Cui 2,HoXu 2, Jing Chen 2, Yi-Nn Gong 2, Liyn Hu 2, Yn Zhou 2, Jinning Ge 2,
nm nm nm nm nm nm. Seed surface. oi-ab. oi-ad. ii-ab. ii-ad/endothelium. endosperm.
B 360-370nm Seed surfce oi- 90-100nm A 630-640nm oi-d ii- ii-d/endothelium 230-240nm 220-230nm 240-280nm 1mm endosperm C oi-d D ii-d/endothelium ii- endosperm Supplementry Figure 1 Cell wll thickness mesurements
I n all metazoans, programmed cell death, or apoptosis, is essential
Regultion of Drosophil IAP1 degrdtion nd poptosis y reper nd ud1 f Hyung Don Ryoo*, Andres Bergmnn, Hedv Gonen, Aron Ciehnover nd Hermnn Steller* *Howrd Hughes Medil Institute, Strng Lortory of Cner Reserh,
ARTICLES. Pyruvate kinase M2 is a phosphotyrosinebinding
Vol 452 13 Mrh 2008 doi:10.1038/nture06667 ARTICLES Pyruvte kinse M2 is phosphotyrosineinding protein Hether R. Christofk 1, Mtthew G. Vnder Heiden 1,3, Ning Wu 1, John M. Asr 2,4 & Lewis C. Cntley 1,4
Supplementary information
PP GC B Epithelil cell Peyer s ptch B lymphocyte Dendritic cell Bsophil Neutrophil Mst cell Nturl killer cell T lymphocyte Supplementry informtion EAF2 medites germinl center B cell poptosis to suppress
Mammalian Sprouty4 suppresses Ras-independent ERK activation by binding to Raf1
Mmmlin suppresses Rs-independent ERK tivtion y inding to Rf1 letters Atsuo Sski*, Tkhru Tketomi*, Reiko Kto*, Kzuko Seki*, Atsushi Nonmi*, Mik Sski*, Msmitsu Kuriym, Noki Sito, Msumi Shiuy nd Akihiko Yoshimur*
SUPPLEMENTARY INFORMATION
doi:.38/nture598 SUPPLEMETARY IFORMATIO + + + + + + + + + rit TRIC-A: M------ELLSALSLGELALSFSRVPLFPVFDLSYFIVSILYLKYEPG--AVELSRRHPVASWLCAMLHCFGSYILADLLLGEPLIDYFSSSI 87 mouse TRIC-A: M------DLMSALSLGELALSFSRVPLFPVFDLSYFIVSIIYLKYEPG--AVELSRRHPVASWLCAMLHCFGSYILADLLLGEPIIDYFSSSSI
Rap1 Activation in Collagen Phagocytosis Is Dependent on Nonmuscle Myosin II-A
Moleulr Biology of the ell Vol. 19, 532 546, Deemer 28 tivtion in ollgen Phgoytosis Is Dependent on Nonmusle Myosin II- Pmel D. ror,* Mry nne onti, Shoshn Rvid, Dvid B. Sks, ndrs Kpus, Roert S. delstein,
FL3-H::PI H2O2: %G1=66.3, %S=15.7, %G2=19.6. Cisplatin: %G1=66.9, %S=16.3, %G2=16.8 FL3-H::PI
.8 mm HO, 8 h 66C14 4T1 MB468 MB31 ontrol FL4-H::ap annexin V HO ount ount ontrol: %G1=48., %S=3.7, %G=9.5 Dox: %G1=67.9, %S=15.3, %G=19.1 HO: %G1=66.3, %S=15.7, %G=19.6 Cisplatin: %G1=66.9, %S=16.3, %G=16.8
SUPPLEMENTARY INFORMATION
DOI: 10.1038/nc2473 AP-2 EEA1 APPL1 EEA1 APPL1 EEA1 APPL1 c d e AP-2 FCHO2 merge f g h i k FCHO1 EFC domin FCHO2 EFC domin 10X 1X 3X 10X 10X 1X 3X 10X FCHO1/FCHO2 _ + + + _ + + + PtdIns(4,5)P 2 S P S P
scientificreport ATM-mediated phosphorylation of SOG1 is essential for the DNA damage response in Arabidopsis scientific report
sientifireport is essentil for the DNA dmge response in Aridopsis Koru O. Yoshiym 1,2+,JunyKoyshi 3,NouoOgit 1,MinkoUed 1,SeisukeKimur 2, Hisji Mki 1 & Mski Umed 1,4++ 1 Grdute Shool of Biologil Sienes,
Regulation of microrna-mediated gene silencing by microrna precursors
Regultion of mirorna-medited gene silening y mirorna preursors Biswjoy Roy-Chudhuri 1,2, Pul N Vldmnis 1,2, Yue Zhng 1,2, Qing Wng 1,2, Qing-Jun Luo 1,2 & Mrk A Ky 1,2 Proessing of mirornas (mirnas) from
Heat-shock protein 70 inhibits apoptosis by preventing recruitment of procaspase-9 to the Apaf-1 apoptosome
Het-shok protein 7 inhiits poptosis y preventing reruitment of prospse-9 to the poptosome Helen M. Beere*, Beni B. Wolf*, Kelvin Cin, Dik D. Mosser, Artin Mhoui*, Tomomi Kuwn*, Pnkj Tilor, Rihrd I. Morimoto,
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:.38/nture59 lmd phosphtse Okdic cid h COS7 SHSY5Y Clf lkline phosphtse Mouse rin c lmd phosphtse Okdic cid h 3P IB () COS7 Supplementry Figure is phosphoprotein., Okdic cid
Arabidopsis HT1 kinase controls stomatal movements in response to CO 2
Aridopsis kinse ontrols stomtl movements in response to Mimi Hshimoto, Juntro Negi, Jred Young 2, Mri Isrelsson 2, Julin I. Shroeder 2 nd Koh I,3 Gurd ells, whih form stomt in lef epidermes, sense multitude
Nod2-mediated recognition of the microbiota is critical for mucosal adjuvant activity of cholera toxin
Supplementry informtion Nod2-medited recognition of the microiot is criticl for mucosl djuvnt ctivity of choler toxin Donghyun Kim 1,2, Yun-Gi Kim 1,2, Sng-Uk Seo 1,2, Dong-Je Kim 1,2, Nouhiko Kmd 3, Dve
SUPPLEMENTARY INFORMATION
Alessndro A. Srtori 1, Cludi Luks 2, Juli Cotes 1, Mrtin Mistrik 2, Shung Fu 3, Jiri Brtek 2, Richrd Ber 3, Jiri Luks 2 nd Stephen P. Jckson 1 1 The Wellcome Trust nd Cncer Reserch UK Gurdon Institute,
Overlay α-jmjd2c. α-jmjd2c α-ar. IP α-flag V5-JMJD2C Flag-AR Flag α-v5 α-flag. V5-JMJD2C Flag-LSD1 Flag α-v5. α-flag GST- AR-LBD R1881.
Ovrly DAPI Ovrly DAPI + 28 μm 28 μm 28 μm 28 μm 28 μm V5- AR Flg V5- LSD1 Flg - Nix1 - AR-NTD - AR-DBD - AR-LBD + MBP MBP- ARwt - Nix1 - LSD1 - LSD1-NTD - LSD1-SWIRM - LSD1-AO MBP MBP- Supplmntry Figur
SUPPLEMENTARY INFORMATION
Supplementry Figures nd Legends S1 Figure S1. Trgeted FRET sensors of Auror B kinse ctvity., Imges of cells expressing the untrgeted (i), centromere trgeted (ii), or chromtin-trgeted sensors (iii) in mitosis.
LETTERS. Linking the p53 tumour suppressor pathway to somatic cell reprogramming
doi:.8/nture8 LETTERS Linking the tumour suppressor pthwy to somti ell reprogrmming Teruhis Kwmur, *, Jotro Suzuki, *, Yunyun V. Wng, Sergio Menendez, Lur Btlle Morer, Angel Ry,,, Geoffrey M. Whl & Jun
Supplementary Figure 1 PARP1 is involved in regulating the stability of mrnas from pro-inflammatory cytokine/chemokine mediators.
Supplementary Figure 1 PARP1 is involved in regulating the stability of mrnas from pro-inflammatory cytokine/chemokine mediators. (a) A graphic depiction of the approach to determining the stability of
SUPPLEMENTARY INFORMATION
DOI: 10.1038/nc2307 c No Jsplkinolide Jsplkinolide MDCK AP2-GFP Trnsferrin Merge BSC1 Trnsferrin fluorescence (.u.) MDCK - Jsplkinolide Jsplkinolide AP2-GFP fluorescence (.u.) Trnsferrin fluorescence (.u.)
Endothelial Apelin-FGF Link Mediated by MicroRNAs 424 and 503 is Disrupted in Pulmonary Arterial Hypertension
Endothelil Apelin-FGF Link Medited y MicroRNAs 424 nd 53 is Disrupted in Pulmonry Arteril Hypertension Jongmin Kim, Yujung Kng, Yoko Kojim, Jnet K. Lighthouse, Xioyue Hu, Michel A. Aldred, Dnielle L. McLen,
RESEARCH ARTICLE n.s.
Cellular & Moleular Immunology (214), 12 ß 214 CSI and USTC. All rights reserved 1672-7681/14 $32. www.nature.om/mi a 5 RESEARCH ARTICLE TNF-a (pg/ml) 4 3 2 1 IL-6 (pg/ml) 15 1 5 IL-12p4 (pg/ml) 3 2 1
LETTER. Mediator kinase inhibition further activates super-enhancer-associated genes in AML
LETTER doi:1.138/nture1494 Meditor kinse inhiition further tivtes super-enhner-ssoited genes in AML Henry E. Pelish 1 *, Brin B. Liu 1 *, Ion I. Nitulesu 1, Anupong Tngpeerhikul 1, Zhry C. Poss 2, Diogo
5 -triphosphate-sirna: turning gene silencing and Rig-I activation against melanoma
28 Nture Pulishing Group http://www.nture.om/nturemediine -triphosphte-sirna: turning gene silening nd Rig-I tivtion ginst melnom Hendrik Poek 1 3,12, Roert Besh 4,12, Cornelius Mihoefer 2,3,12, Mrel Renn,12,
Supplementary Fig
Supplementry Fig. 1 * 180-115- 82-64- 49-37- * 180-115- 85-64- 49-37- 26-26- Mem Cyt Mem Cyt Supplementry Fig.1 Specificity of nti-tie2 ntiodies. HUVECs were homogenized nd centrifuged t 400 000g to otin
Sequence-specific regulator Prdm14 safeguards mouse ESCs from entering extraembryonic endoderm fates
Sequene-speifi regultor Prdm sfegurds mouse ESCs from entering extremryoni endoderm ftes Ziyng M, Tomek Swigut, Anton Vlouev, Alvro Rd-Iglesis & Jonn Wysok,3, Nture Ameri, In. All rights reserved. Prdm
T he PML gene is involved in reciprocal chromosomal translocations
The funtion of in -epenent poptosis Ailn Guo*, Polo Slomoni*, Jinyun Luo, Aln Shih*, Sue Zhong*, Wei Gu n Pier Polo Pnolfi* *Deprtment of Humn Genetis n Moleulr Biology Progrm, Memoril Slon-Kettering Cner
A genetically encoded, fluorescent indicator for cyclic AMP in living cells
A genetilly enoded, fluoresent inditor for yli AMP in living ells rtiles Mnuel Zolo*, Frnes De Giorgi*, Chrles Y. Cho, Luxin Feng, Tom Knpp, Pul A. Negulesu, Susn S. Tylor #, Roger Y. Tsien # nd Tullio
SUPPLEMENTARY INFORMATION
doi:10.1038/nture09470 prmt5-1 prmt5-2 Premture Stop Codon () GGA TGA PRMT5 Hypocotyl Length (Reltive to Drk) 0.5 0.3 0.1 ** 30 *** c prmt5-1 d ** *** 150 prmt5-2 ** *** 28 100 26 24 50 prmt5-1 prmt5-2
SUPPLEMENTARY INFORMATION
BRC repet RPA DSB RAD52 DSB Repir doi:1.138/nture9399 Gp Repir ssdna/dsdna junction ssdna/dsdna junction RPA Binding Resection RPA Binding Filment Formtion or or Filment Formtion DNA Piring DNA Piring
SUPPLEMENTARY INFORMATION
SUPPLEMENTRY INFORMTION DOI:.38/ncb Kdmb locus kb Long isoform Short isoform Long isoform Jmj XX PHD F-box LRR Short isoform XX PHD F-box LRR Target Vector 3xFlag Left H Neo Right H TK LoxP LoxP Kdmb Locus
SUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nture10698 Rg1 µmt LPLs CD3 LPLs CD11c hi LPLs CD3 splenocytes CD19 LPLs CD19 splenocytes 2 Ocontrol J 4 CD11c Supplementry Figure 1 Chrcteriztion of intestinl lmin
Supplementary Figure 1. A TRPC5-like channel in the neurites and somata of aortic baroreceptor neurons.
Supplementl Figure 1 c d e f Supplementry Figure 1. A TRPC5-like chnnel in the neurites nd somt of ortic roreceptor neurons. Cell-ttched ptch recordings from the neurite terminls (-c) nd the somt (d-f)
Application of Phi29 Motor prna for Targeted Therapeutic Delivery of sirna Silencing Metallothionein-IIA and Survivin in Ovarian Cancers
originl rtile The Amerin Soiety of Gene & Cell Therpy Applition of Phi9 Motor prna for Trgeted Therpeuti Delivery of sirna Silening Metllothionein-IIA nd Survivin in Ovrin Cners Pheruz Trpore, Yi Shu,
2000 Nature America Inc.
Quntittive expression of Ot-3/4 defines differentition, dedifferentition or self-renewl of ES ells Hitoshi Niw 1,2, Jun-ihi Miyzki 2 & Austin G. Smith 1 Cell fte during development is defined y trnsription
Ezh2 controls B cell development through histone H3 methylation and Igh rearrangement
Ezh2 ontrols B ell development through histone H3 methyltion nd Igh rerrngement I-hsin Su 1,Ashwin Bsvrj 1,Andrew N. Kruthinsky 2, Oliver Hoert 3,Axel Ullrih 4, Brin T. Chit 2 nd Alexnder Trkhovsky 1 Pulished
MED18 interaction with distinct transcription factors regulates multiple plant functions
Reeived 13 Aug 213 Aepted 4 De 213 Pulished 23 Jn 214 DOI: 1.138/nomms464 MED18 intertion with distint trnsription ftors regultes multiple plnt funtions Zhiing Li 1, Crig M. Shluttenhofer 1,w, Ketki Bhide
AKAP150 signaling complex promotes suppression of the M-current by muscarinic agonists
AKAP150 signling omplex promotes suppression of the M-urrent y musrini gonists Noto Hoshi 1,2,Ji-Sheng Zhng 1,Miho Omki 3,Tkhiro Tkeuhi 1,Shigeru Yokoym 1,Niols Wnvereq 4, Lorene K Lngeerg 2,Yukio Yoned
SUPPLEMENTARY INFORMATION
doi:10.1038/nture12040 + + + Glc Gln Supplementry Figure 1., Reltive prolifertion of PDAC cell lines (8988T, Tu8902, Pnc1, Mipc2, PL45 nd MPnc96) nd low pssge primry humn PDAC cell lines (#1 nd #2) under
... The E2F1±3 transcription factors are essential for cellular proliferation
2±4 ml 4% prformldehyde (PFA) (numer S898-7 JT Bker). Approximtely 2 3 1 4 ells were evluted for forwrd nd side stter hrteristis y ow ytometry under the diretion of J. Norderg t the VA ore Flow Fility
Dual control of nuclear EIN3 by bifurcate MAPK cascades in C 2 H 4 signalling
Vol 51 1 Ferury doi:1.13/nture653 ARTICLES Dul ontrol of nuler y ifurte MAPK sdes in C H signlling Sng-Dong Yoo 1, Young-Hee Cho 1, Guillume Ten 1, Yn Xiong 1 & Jen Sheen 1 A prinipl question in MAP kinse
SUPPLEMENTARY INFORMATION
Supplementry Methods: Expression nd purifiction of Sgs1 nd sgs1-k706a We first modified the pfstbc-htb vector (Invitrogen) y dding FLAG tg fter the pre-existing (His) 6 tg. A DNA frgment encoding full
Supplementary Materials
Supplementry Mterils Supplementry Figure 1 Supplementry Figure 2 in Fh deficient mice. Supplementry Figure 3 Supplementry Figure 4 Supplementry Figure 5 Supplementry Figure 6 Supplementry Figure 7 Supplementry
Interferons induce tyrosine phosphorylation of the eif2a kinase PKR through activation of Jak1 and Tyk2
sientifi report sientifireport Interferons indue tyrosine phosphoryltion of the eif2 kinse through tivtion of Jk1 nd Tyk2 Qiozhu Su, Shuo Wng, Dionissios ltzis, Li-Ke Qu w,jenniferf.rven,suiyngli z, ndrew
LETTER. Enhancer decommissioning by LSD1 during embryonic stem cell differentiation
oi:1.138/nture18 Enhner eommissioning y uring emryoni stem ell ifferentition Wrren A. Whyte 1,2 *, Steve Biloeu 1 *, Dvi A. Orlno 1, Hether A. Hoke 1,2, Grrett M. Frmpton 1,2, Chrles T. Foster 3,4, Shun
Endothelial adherens junctions control tight junctions by VE-cadherin-mediated upregulation of claudin-5
Enothelil herens juntions ontrol tight juntions y VE-herin-meite upregultion of Anre Tei 1, Costnz Gimpietro 1, Annrit Conti 1, Frizio Orsenigo 1, Ferruio Brevirio 2, Vlentin Pirzzoli 1, Mihel Potente
SUPPLEMENTARY INFORMATION
doi:1.138/nture9816 control.1 µg/µl.1 µg/µl 1 µg/µl NH2 signl 2xFLAG PS Fc-tg CD4L [116-261] 55 274 146 c counts Stimultion of Rji cells Lysis nd 1 st IP with M2-eds (4 C) PreScission nd FLAG-peptide tretment
Shigella IpgB1 promotes bacterial entry through the ELMO Dock180 machinery
LETTERS promotes teril entry through the Dok18 mhinery Yutk Hn 1, Msto Suzuki 1, Kenji Ohy 1, Hiroki Iwi 1, Nozomi Ishijim 1, Anthony J. Koleske 3, Yoshinori Fukui 4 n Chihiro Sskw 1,2,5,6 use speil mehnism
Exon-intron circular RNAs regulate transcription in the nucleus
Exon-intron irulr RNAs regulte trnsription in the nuleus Zhoyong Li 1,2,7, Chun Hung 1,7, Chun Bo 1,3,4,7, Ling Chen 1, Mei Lin 1, Xiolin Wng 1, Guolin Zhong 1, Bin Yu 1, Wnhen Hu 1, Limin Di 1, Pengfei
LETTER. Emergence of KRAS mutations and acquired resistance to anti-egfr therapy in colorectal cancer
doi:1.138/nture11156 Emergene of muttions nd quired resistne to nti-egfr therpy in oloretl ner Sndr Misle 1,2 *, Ron Yeger 3 *, Sestijn Hoor 1 *, Elis Sl 1,2 *, Mnikm Jnkirmn 4 *, Dvid Lisk 5, Emnuele
Supplemental Data. Antosz et al. Plant Cell (2017) /tpc SPT6/SPT6L. genomic DNA ACT2 +RT -RT +RT -RT
A B C SPT6/SPT6L genomic DNA ACT2 +RT -RT Col- seedlings +RT -RT PSB-D cells Supplementl Figure 1. Expression of SPT6L nd SPT6. (Supports Figure 1.) Trnscript levels of of SPT6L (At1g6544) nd SPT6 (At1g6321)
Inhibiting gene expression at transcription start sites in chromosomal DNA with antigene RNAs
Inhiiting gene expression t trnsription strt sites in hromosoml DNA with ntigene RNAs Bethny A Jnowski 1,2, Kenneth E Huffmn 1,2, Jo C Shwrtz 1,2, Roslyn Rm 1,2, Dniel Hrdy 2, Dvid S Shmes 1,3,4, John
Protein Degradation and Quality Control in Cells from Laforin and Malin Knockout Mice*
JBC Ppers in Press. Pulished on June 9, 214 s Mnusript M114.58167 The ltest version is t http://www.j.org/gi/doi/1.174/j.m114.58167 Lfor disese nd protein qulity ontrol Protein Degrdtion nd Qulity Control