Supplementary Fig

Size: px
Start display at page:

Download "Supplementary Fig"

Transcription

1 Supplementry Fig. 1 * * Mem Cyt Mem Cyt Supplementry Fig.1 Specificity of nti-tie2 ntiodies. HUVECs were homogenized nd centrifuged t g to otin totl memrne (Mem) nd cytosolic (Cyt) frctions. Smples from ech frction were resolved y SDS-PAGE nd Western lots were performed using either () mouse monoclonl nti-tie2 ntiodies, or () got polyclonl nti-tie2 ntiodies. * Indictes the position of mture Tie-2. Numers indicte moleculr mss in kd shown on the left.

2 Supplementry Fig. 2 Supplementry Fig. 2 Vlidtion of the Tie-2 leling strtegy. 293F cells nd 293F cells stly expressing Tie-2 were grown on glss coverslips tht were pre-coted with poly-l-lysine. The cells were fixed s descried for HUVECs in Methods. Both 293F cells nd 293F cells expressing Tie-2 were treted with mouse monoclonl nti-tie2 ntiodies (10μg/ml) followed y got nti-mouse secondry ntiodies conjugted to 0.8nm gold prticles. The sizes of the gold prticles were enhnced with silver. Cells were viewed using the Hitchi S-5200 scnning electron microscope. Bcksctter imges showing the surfce of () 293F cells, nd () 293F cells expressing Tie-2.

3 Supplementry Fig. 3 Supplementry Fig.3 Vlidtion of the Tie-2 leling strtegy. 293F cells nd 293F cells stly expressing Tie-2 were grown on glss coverslips tht were pre-coted with poly-l-lysine. The cells were fixed s descried for HUVECs in Methods. Both 293F cells nd 293F cells expressing Tie-2 were treted with got polyclonl nti-tie2 ntiodies (2μg/ml) followed y rit nti-got secondry ntiodies conjugted to 0.8nm gold prticles. The sizes of the gold prticles were enhnced with silver. Cells were viewed using the Hitchi S-5200 scnning electron microscope. Bcksctter imges showing the surfce of () 293F cells, nd () 293F cells expressing Tie-2.

4 Supplementry Fig. 4 Supplementry Fig.4 Bckground control imges for Tie-2 leling. HUVECs were fixed s descried in Methods nd treted with secondry ntiodies conjugted to 0.8nm gold prticles followed y silver enhncement. Cells were imged using the Hitchi S-5200 scnning electron microscope. Bcksctter imges showing ckground leling using () rit nti-got secondry ntiodies, nd () got nti-mouse secondry ntiodies.

5 Supplementry Tle 1: Quntifiction of Tie-2 Clusters on the HUVEC Plsm Memrne Cluster Size Mouse monoclonl Got polyclonl After exmining 70μm 2 of the HUVEC plsm memrne, the numer of times cluster size ppered ws counted for ech nti-tie2 ntiody. Cluster size is defined s the numer of ggregted silver prticles. Bold numers refer to the numer of silver prticles in the cluster; cluster size of 1 refers to single isolted silver prticle, 2 refers to cluster contining two silver prticles, 10 refers to cluster contining 10 silver prticles.

6 Supplementry Fig. 5 Supplementry Fig.5 Intrcellulr leling of R5. HUVECs were grown s monolyer to confluence, fixed, permeilized, nd treted with mouse monoclonl nti-r5 ntiodies (BD Biosciences, 1:50 dilution) followed y donkey nti-mouse secondry ntiodies conjugted to 0.8nm gold prticles. The sizes of the prticles were enhnced with silver. The cells were emedded nd sectioned (90nm thick). Sections were stined with urnyl cette nd imged using the Hitchi H-7000 trnsmission electron microscope.

7 Supplementry Fig. 6 Supplementry Fig.6 Vlidtion of the Ang-1 leling strtegy. 293F cells expressing Tie-2 were grown on glss coverslips tht were pre-coted with poly-l-lysine. Cells were incuted on ice for 90 min in medi with or without Ang-1 (800ng/ml). The cells were wshed, fixed, nd treted with mouse monoclonl nti-ang1 ntiodies (1μg/ml) followed y donkey nti-mouse secondry ntiodies conjugted to 0.8nm gold prticles. The sizes of the gold prticles were enhnced with silver. Cells were imged using the Hitchi S-5200 scnning electron microscope. Bcksctter imges of () Ang-1 on the cell surfce, nd () ckground control.

8 Supplementry Fig. 7 Supplementry Fig.7 Bckground control for Ang-1 leling in HUVECs. Cells were incuted on ice for 90min in the sence of Ang-1. The cells were wshed, fixed, nd exposed to mouse monoclonl nti-ang1 ntiodies (1µg/ml) followed y donkey nti-mouse secondry ntiodies conjugted to 0.8nm gold prticles. The sizes of the gold prticles were enhnced with silver. Cells were viewed using the Hitchi S-5200 scnning electron microscope.

WesternBright TM MCF and MCF-IR

WesternBright TM MCF and MCF-IR WesternBright TM MCF nd MCF-IR Quntittive, multi-color fluorescent Western lotting kits WesternBright MCF visile nd ner infrred (IR) fluorescent Western lotting kits llow the ssy of two proteins t once,

More information

Interplay between NS3 protease and human La protein---- by Ray and Das Supplementary fig 1. NS3 pro

Interplay between NS3 protease and human La protein---- by Ray and Das Supplementary fig 1. NS3 pro Interply etween tese nd humn L protein---- y Ry nd Ds Supplementry fig 1 1 2 3 4 UV crosslinking ssy: α[ 32 P]UTP leled HCV IRES RNA ws UV-crosslinked to incresing concentrtions (0.1, 0.2 nd 0.4µM) in

More information

COS-1 cells transiently transfected with either HA hgr wt, HA hgr S211A or HA hgr S226A

COS-1 cells transiently transfected with either HA hgr wt, HA hgr S211A or HA hgr S226A 1 SUPPLEMENTRY FIGURES Fig. 1 & Specificity of the nti-p-s211 nd nti-p-s226 ntibodies COS-1 cells trnsiently trnsfected with either H hgr wt, H hgr S211 or H hgr S226 were treted with 1nM Dex for 1 hour.

More information

a ATP release 4h after induction

a ATP release 4h after induction doi:1.138/nture9413 ATP relese 4h fter induction of poptosis (nm) 5 ATP 4 3 2 1 UV UV + zvad 1μM 3μM 5μM UV + 1μM 3μM 5μM UV + 18AGA 1μM 3μM 5μM UV + FFA HeL monolyer Scrpe Dye trnsfer HeL HeL-Cx43 HeL-Cx43

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/nc2307 c No Jsplkinolide Jsplkinolide MDCK AP2-GFP Trnsferrin Merge BSC1 Trnsferrin fluorescence (.u.) MDCK - Jsplkinolide Jsplkinolide AP2-GFP fluorescence (.u.) Trnsferrin fluorescence (.u.)

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementry Figure 1 d6 d8 d9 SSC.575 27.4 35.1 d1 d12 d2 39.6 5.4 67.3 NKX2-5-GFP Supplementry Figure 1 Differentition kinetics of the NKX2-5-GFP HES3 hesc line (Elliott et l., 211). Flow cytometric

More information

Supporting Information

Supporting Information Supporting Informtion Time-Resolved Fluorescent Detection of Hg 2+ in Complex Environment y Conjugting Mgnetic Nnoprticles with Triplehelix Moleculr Switch Jing Zheng, Yuhong Nie, Yping Hu, Jishn Li, Yinhui

More information

Jay S Desgrosellier, Leo A Barnes, David J Shields, Miller Huang, Steven K Lau, Nicolas Prévost, David Tarin, Sanford J Shattil and David A Cheresh

Jay S Desgrosellier, Leo A Barnes, David J Shields, Miller Huang, Steven K Lau, Nicolas Prévost, David Tarin, Sanford J Shattil and David A Cheresh Integrin αvβ3/c-src Oncogenic Unit Promotes Anchorge-independence nd Tumor Progression Jy S Desgrosellier, Leo A Brnes, Dvid J Shields, Miller Hung, Steven K Lu, Nicols Prévost, Dvid Trin, Snford J Shttil

More information

supplementary information

supplementary information DOI: 10.1038/nc2014 SM/C-2.6(-) CD31, CD45, SM/C-2.6 PDGFRα CD13 36.1 CD29 91.6 CD34 30.4 CD90 65.7 CXCR4 1.3 c-kit 0.1 Sc-1 86.4 Integrin α7 0.1 PDGFRα PDGFRα(-)SM/C-2.6(+) CD31, CD45, PDGFRα SM/C-2.6

More information

Won Jung, Seung Min An, Whaseon Lee-Kwon, Mario Chiong1, Sergio Lavandero1,2, and Hyug

Won Jung, Seung Min An, Whaseon Lee-Kwon, Mario Chiong1, Sergio Lavandero1,2, and Hyug Supplementry Informtion suppresses IL-1-medited immunomodultion Soo Youn Choi, Hwn Hee Lee, Jun Ho Lee, Byeong Jin Ye, Eun Jin Yoo, Hyun Je Kng, Gyu Won Jung, Seung Min An, Whseon Lee-Kwon, Mrio Chiong1,

More information

Supplementary information

Supplementary information PP GC B Epithelil cell Peyer s ptch B lymphocyte Dendritic cell Bsophil Neutrophil Mst cell Nturl killer cell T lymphocyte Supplementry informtion EAF2 medites germinl center B cell poptosis to suppress

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nture10177 MDYKDHDGDYKDHDIDYKDD DDKMAPKKKRKVGIHGVPAA MAERPFQCRICMRKFAQSGD LTRHTKIHTGEKPFQCRICM RNFSRSDVLSEHIRTHTGEK PFACDICGKKFADRSNRIKH TKIHTGSQKPFQCRICMRNF SRSDNLSEHIRTHTGEKPFA

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nture10698 Rg1 µmt LPLs CD3 LPLs CD11c hi LPLs CD3 splenocytes CD19 LPLs CD19 splenocytes 2 Ocontrol J 4 CD11c Supplementry Figure 1 Chrcteriztion of intestinl lmin

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nture12040 + + + Glc Gln Supplementry Figure 1., Reltive prolifertion of PDAC cell lines (8988T, Tu8902, Pnc1, Mipc2, PL45 nd MPnc96) nd low pssge primry humn PDAC cell lines (#1 nd #2) under

More information

Supporting Information

Supporting Information Supporting Informtion Remote Control of Multi-Modl Nnoscle Lignd Oscilltions Regultes Stem Cell dhesion nd Differentition Heemin Kng,, Dexter Siu Hong Wong,, Xiohui Yn, Hee Joon Jung,,,# Sungkyu Kim,,,#

More information

Substrate elasticity provides mechanical signals for the expansion of hemopoietic stem and progenitor cells

Substrate elasticity provides mechanical signals for the expansion of hemopoietic stem and progenitor cells correction notice Nt. Biotechnol. 28, 1123 1128 (21); pulished online 3 Octoer 21; corrected fter print 27 April 211 Sustrte elsticity provides mechnicl signls for the expnsion of hemopoietic stem nd progenitor

More information

Gan et al., Supplemental Figure 1

Gan et al., Supplemental Figure 1 Gn et l., Supplementl Figure IB: DU45 Unp IB: py-68 IB: perk IB: ERK IB: Akt Unp DU45 DU45 ErB2 - EGF - EGF ErB2 75 75 Supplementl Figure. DU45 nd ells predominntly express nd re highly responsive to EGF.

More information

nm nm nm nm nm nm. Seed surface. oi-ab. oi-ad. ii-ab. ii-ad/endothelium. endosperm.

nm nm nm nm nm nm. Seed surface. oi-ab. oi-ad. ii-ab. ii-ad/endothelium. endosperm. B 360-370nm Seed surfce oi- 90-100nm A 630-640nm oi-d ii- ii-d/endothelium 230-240nm 220-230nm 240-280nm 1mm endosperm C oi-d D ii-d/endothelium ii- endosperm Supplementry Figure 1 Cell wll thickness mesurements

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/nc2885 kd M ΔNZipA 66.4 55.6 ZipA 42.7 34.6 6x His NiNTA 27.0 c 1.,, 2. evnescent field supported memrne Supplementry Figure 1 Experimentl ssy. () Illustrtion of protein interctions (dpted

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION 1 1 μm c d EGF + TPA + e f Intensity 1.8 1.6 1.4 1.2 1.8.6.4.2 2 4 8 2 4 8 (Hours) 2 4 6 8 1 Time (Hours) Reltive luciferse ctivity 4 3 2 1 + CAMEK1 FRE reporter Figure S1 inhiitor incresed protein expression

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementry Methods: Expression nd purifiction of Sgs1 nd sgs1-k706a We first modified the pfstbc-htb vector (Invitrogen) y dding FLAG tg fter the pre-existing (His) 6 tg. A DNA frgment encoding full

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Mgneto-erotctic cteri deliver drug-contining nnoliposomes to tumour hypoxic regions Oujdi Felfoul, Mhmood Mohmmdi, Smir Therkhni, Dominic de Lnuze, Yong Zhong Xu, Dumitru Loghin, Sherief Ess, Sylwi Jncik,

More information

Title: SUPPLEMENTARY INFORMATION. Gradient Confinement Induced Uniform Tensile Ductility in Metallic Glass

Title: SUPPLEMENTARY INFORMATION. Gradient Confinement Induced Uniform Tensile Ductility in Metallic Glass SUPPLEMENTARY INFORMATION Title: Grdient Confinement Induced Uniform Tensile Ductility in Metllic Glss X.L. Lu 1, Q.H. Lu 1, Y. Li* 1,2 nd L. Lu* 1 1 Shenyng Ntionl Lortory for Mterils Science, Institute

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SI Fig. PrpS is single copy gene k 3. 9... EcoRV EcoRV k 5 BmH Pst c well k HindIII HindIII HindIII.3.5 3.. Southern lots of Ppver genomic DNA from plnts with SS8 hplotypes, hyridized with PrpS proe..

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementry Figures nd Legends S1 Figure S1. Trgeted FRET sensors of Auror B kinse ctvity., Imges of cells expressing the untrgeted (i), centromere trgeted (ii), or chromtin-trgeted sensors (iii) in mitosis.

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nture10970 I. GN directly grown on the h-bn relese lyer Figure S1 shows X-ry diffrction with the 2θ/ω configurtion nd n opticl microscopy imge for the GN directly grown on the h-bn relese lyer.

More information

Dual Physically Cross-Linked Hydrogels with High. Stretchability, Toughness and Good Self-

Dual Physically Cross-Linked Hydrogels with High. Stretchability, Toughness and Good Self- Dul Physiclly Cross-Linked Hydrogels with High Stretchility, Toughness nd Good Self- Recoverility Yng Hu,, Zhengshn Du, Xioln Deng, To Wng, Zhuohong Yng, Wuyi Zhou,*, Choyng Wng*, Reserch Institute of

More information

Supplementary Information

Supplementary Information Supplementry Informtion Polypurine reverse-hoogsteen (PPRH) oligonucleotides cn form triplexes with their trget sequences even under conditions where they fold into G-qudruplexes. Ann Solé, Emmnuelle Delgoutte,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 1.138/nc2274 EpH4 Prentl -/MDCK EpH4 Prentl -/MDCK - FERM- Figure S1 (kd) delferm- (1-438)- c Prentl MDCK -/MDCK deljfr- Input Control IP IP Input Control IP IP d Control Control Figure S1 () Specificity

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION NCS (ng/ml) Time (min) kd 500 500 0 30 0 30 IP: IP: 112 105 75 IB: ps407 IB: Mdm2 NCS + + IB: IB: tuulin IP input sup NCS (ng/ml) 50 100 500 Time (min) 0 15 30 60 120 15 30 60 120 15 30 60 120 IB: ps407

More information

HIT: a versatile proteomics platform for multianalyte phenotyping of cytokines, intracellular proteins and surface molecules

HIT: a versatile proteomics platform for multianalyte phenotyping of cytokines, intracellular proteins and surface molecules 28 Nture Pulishing Group http://www.nture.com/nturemedicine HIT: verstile proteomics pltform for multinlyte phenotyping of cytokines, intrcellulr proteins nd surfce molecules Michel G Ktth 1, John Coller

More information

1. Supplementary Figures and Legends a b

1. Supplementary Figures and Legends a b doi:10.1038/nture09540 1. Supplementry Figures nd Legends Supplementry Figure 1. Scnning trnsmission electron microgrphs (STEM) of NCC., STEM prepred from fst evportion of dilute NCC suspension shows individul

More information

Nod2-mediated recognition of the microbiota is critical for mucosal adjuvant activity of cholera toxin

Nod2-mediated recognition of the microbiota is critical for mucosal adjuvant activity of cholera toxin Supplementry informtion Nod2-medited recognition of the microiot is criticl for mucosl djuvnt ctivity of choler toxin Donghyun Kim 1,2, Yun-Gi Kim 1,2, Sng-Uk Seo 1,2, Dong-Je Kim 1,2, Nouhiko Kmd 3, Dve

More information

Fluorescence Intensities of. GFP-PAC-1 Strains

Fluorescence Intensities of. GFP-PAC-1 Strains DOI: 10.1038/ncb3168 Arbitrry Fluorescence Units 2500 2000 1500 1000 500 0 full length (1-4) Fluorescence Intensities of GFP-PAC-1 Strins ΔPH 392-838 575-4 GFP-PAC-1 Strins 2-610 1-574 b control c pc-1(3

More information

S patial and temporal coordination between cell substrate adhesion

S patial and temporal coordination between cell substrate adhesion Integrins regulte GTP-Rc loclized effector interctions through dissocition of Miguel Angel Del Pozo*, Willim B. Kiosses*, Nzill B. Alderson*, Nhum Meller*, Klus M. Hhn, nd Mrtin Alexnder Schwrtz* *Division

More information

Electronic supplementary information: High specific detection and near-infrared photothermal. therapy of lung cancer cells with high SERS active

Electronic supplementary information: High specific detection and near-infrared photothermal. therapy of lung cancer cells with high SERS active Electronic supplementry informtion: High specific detection nd ner-infrred phototherml therpy of lung cncer cells with high SERS ctive ptmer-silver-gold shell-core nnostructures Ping Wu, Yng Go, Yimei

More information

An insight into itraq: where do we stand now?

An insight into itraq: where do we stand now? Anlyticl nd Bionlyticl Chemistry Electronic Supplementry Mteril An insight into itraq: where do we stnd now? Croline Evns, Josselin Noirel, Sw Yen Ow, Mlind Slim, An G. Pereir-Medrno, Nrciso Couto, Jgroop

More information

Roles of Extracellular Matrix Components in Differentiating Teratocarcinoma Cells*

Roles of Extracellular Matrix Components in Differentiating Teratocarcinoma Cells* THE JOURNAL OF BOLOGCAL CHEMSTRY Vol. 0, No., ssue of Octoer 5, pp. 5-5,95 0 95 hy The Americn Society of Biologicl Chemists, nc. Printed in U. S. A. Roles of Extrcellulr Mtrix Components in Differentiting

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/nc2473 AP-2 EEA1 APPL1 EEA1 APPL1 EEA1 APPL1 c d e AP-2 FCHO2 merge f g h i k FCHO1 EFC domin FCHO2 EFC domin 10X 1X 3X 10X 10X 1X 3X 10X FCHO1/FCHO2 _ + + + _ + + + PtdIns(4,5)P 2 S P S P

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 1.138/nc3386 β-ctin (S) (A) - - - TGN46 116 kd 97 45 level (% of ) 1 8 6 4 2 EEA1 (S) (A) c 1 Reltive mrna levels normlized to β-ctin 8 6 4 2 TFEB KD MCOLN1 KD PI4KIIIβ KD PIP5K1α KD PIP5K1β KD VPS

More information

Tobamovirus movement. A motor for phagocytosis Mesodermal competence. Vol 4 No7 July 2002

Tobamovirus movement. A motor for phagocytosis Mesodermal competence. Vol 4 No7 July 2002 nture cell iology vol. 4 no. 7 july 2002 pp E163-E184,469 546 http://cellio.nture.com A motor for phgocytosis Mesoderml competence Vol 4 No7 July 2002 http://cellio.nture.com Tomovirus movement The systemic

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION % chnge in ody mss. -.. Smll intestinl mss (g) -1. -. -. Villi length in proximl jejunum (µm) 1 # of crypts/ mm of jejunum g Proximl jejunum # of enterocytes in jejunl villi 1 1 e. -. d Smll intestinl

More information

Directing human embryonic stem cell differentiation towards a renal lineage generates a self-organizing kidney

Directing human embryonic stem cell differentiation towards a renal lineage generates a self-organizing kidney L E T T E R Directing humn emryonic stem cell differentition towrds renl linege genertes self-orgnizing kidney M. Tksto 1, P. X. Er 1, M. Becroft 1, J. M. Vnslmrouck 1, E. G. Stnley 2,3, A. G. Elefnty

More information

Repair of Rhodopsin mrna by Spliceosome- Mediated RNA Trans-Splicing: A New Approach for Autosomal Dominant Retinitis Pigmentosa

Repair of Rhodopsin mrna by Spliceosome- Mediated RNA Trans-Splicing: A New Approach for Autosomal Dominant Retinitis Pigmentosa originl rticle The Americn Society of Gene & Cell Therpy MT Open Repir of Rhodopsin mrna y Spliceosome- Medited RNA Trns-Splicing: A New Approch for Autosoml Dominnt Retinitis Pigmentos Adeline Berger

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:.38/nture965 footprinting deep-sequencing Supplementry Figure. Schemtic of riosome profiling experiment for quntifiction of riosome occupncy long mrna. The protocol for cteril riosome profiling with

More information

Specific capacity / mah g

Specific capacity / mah g b Bulk: N[Ni 0.60 Co 0.05 Mn 0.35 Inner: N[Ni 0.80 Co 0.02 Mn 0.18 Outer:N[Ni 0.58 Co 0.06 Mn 0.36 Specific cpcity / mah g -1 Bulk: N[Ni 0.60 Co 0.05 Mn 0.35 Inner: N[Ni 0.80 Co 0.02 Mn 0.18 Outer:N[Ni

More information

HeLa. CaSki. Supplementary Figure 1. Validation of the NKX6.1 expression in mrna level and

HeLa. CaSki. Supplementary Figure 1. Validation of the NKX6.1 expression in mrna level and Supplementry Figure. Li et l. Reltive expression ( / GAPDH ) 6 5 4 3 2 5 Reltive expression ( / GAPDH ) 4 3 2 Reltive expression ( / GAPDH ) 4 3 2 Reltive expression ( / GAPDH ) 4 3 2 Ve S Ve S2 S S2 Ve

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION BRC repet RPA DSB RAD52 DSB Repir doi:1.138/nture9399 Gp Repir ssdna/dsdna junction ssdna/dsdna junction RPA Binding Resection RPA Binding Filment Formtion or or Filment Formtion DNA Piring DNA Piring

More information

Calpain-mediated proteolysis of talin regulates adhesion dynamics

Calpain-mediated proteolysis of talin regulates adhesion dynamics Clpin-medited proteolysis of tlin regultes dhesion dynmics Sntos J. Frnco 1,Mry A. Rodgers 2,Benjmin J. Perrin 1,Jewon Hn 3,Dvid A. Bennin 2,Dvid R. Critchley 4 nd Ann Huttenlocher 2,5 Dynmic regultion

More information

T he organization of the actin cytoskeleton in cells correlates

T he organization of the actin cytoskeleton in cells correlates ActA nd humn zyxin hrour Arp2/3-independent ctinpolymeriztion ctivity rticles Julie Frdelizi*, Vincent Noireux, Julie Plstino, Berndette Menichi*, Dniel Louvrd*, Cécile Sykes, Roy M. Golsteyn* nd Evelyne

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Alessndro A. Srtori 1, Cludi Luks 2, Juli Cotes 1, Mrtin Mistrik 2, Shung Fu 3, Jiri Brtek 2, Richrd Ber 3, Jiri Luks 2 nd Stephen P. Jckson 1 1 The Wellcome Trust nd Cncer Reserch UK Gurdon Institute,

More information

Lineage-specific functions of Bcl6 in immunity and inflammation are mediated through distinct biochemical mechanisms

Lineage-specific functions of Bcl6 in immunity and inflammation are mediated through distinct biochemical mechanisms Supplementry informtion for: Linege-specific functions of Bcl6 in immunity nd inflmmtion re medited through distinct iochemicl mechnisms Chunxin Hung, Kterin Htzi & Ari Melnick Division of Hemtology nd

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi: 1.138/nture77 c 2 2 1 15 1 1 5 1 1 5 5 129Sv 1.5 h IL-6 / HPRT 3 h 5 h 6 4 2 d 129Sv 4 4 3 3 2 1 1 8 6 4 2 e f g C57/BL6 Poly(dA-dT) Cell numer (normlized to medium control) 1 5 1 5 1 5 Fluorescence

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:1.138/nture11895 G FSC Linege + PI Sc-1 CD48 c-kit Fc!R CD34 Flk2 CD15 CD15 G ex vivo ± cytokines BfA c WT 2-NBD glucose +cytokines (6h) -cytokines (6h) WT G +cytokines (6h) -cytokines (6h) 2-NBD glucose

More information

LETTERS. Dscam diversity is essential for neuronal wiring and self-recognition

LETTERS. Dscam diversity is essential for neuronal wiring and self-recognition Vol 449 13 Septemer 27 doi:1.138/nture699 LETTERS Dscm diversity is essentil for neuronl wiring nd self-recognition Disuke Httori 1 *, Eru Demir 2 *, Ho Won Kim 1, Erik Virgh 2, S. Lwrence Zipursky 1 &

More information

Crop Performance and Plant Microbe-Interactions are Affected by the Sequence and Frequency of Pulse Crops in the Canadian Prairie

Crop Performance and Plant Microbe-Interactions are Affected by the Sequence and Frequency of Pulse Crops in the Canadian Prairie Crop Performnce nd Plnt Microbe-Interctions re Affected by the Sequence nd Frequency of Pulse Crops in the Cndin Pririe Nvrro-Borrell A 1,2 ; Di M 2 ; Hmel C 1,2 ; Fernndez MR 2 ; Gn Y 2 ; Germid J 1.

More information

Visfatin is present in bovine mammary epithelial cells, lactating mammary gland and milk, and its expression is regulated by camp pathway

Visfatin is present in bovine mammary epithelial cells, lactating mammary gland and milk, and its expression is regulated by camp pathway Visftin is present in ovine mmmry epithelil cells, lctting mmmry glnd nd milk, nd its expression is regulted y camp pthwy Tomo Yonezw *,1, Stoshi Hg, Yosuke Koyshi, Ttsuyuki Tkhshi, Yoshiki Or Deprtment

More information

THE JOWAL OF BIOL~CICAL CHEMISTRY Vol. 269, No. 44, Issue of November 4, pp , 1994 Printed in USA.

THE JOWAL OF BIOL~CICAL CHEMISTRY Vol. 269, No. 44, Issue of November 4, pp , 1994 Printed in USA. THE JOWAL OF BIOL~CICAL CHEMISTRY Vol. 269, No. 44, Issue of Novemer 4, pp. 2738427393, 1994 Printed in USA. Purifiction nd Phrmcologicl nd Immunochemicl Chrcteriztion of Synptic Memrne Proteins with Ligndinding

More information

Supplementary Figure 1. Zhang et al.

Supplementary Figure 1. Zhang et al. Supplementry Figure 1. Zhng et l. T30-SurA: GGCAGTTTCATCATGAATGTGCAGGAGCTTGCAACAATTAAGGTGGAGAATCTCCC T30-SurB: GGCAGTTTCATCATGAATGTGCAGGAGCTAGCAACTATTAAGGTGGAGAATCTCCC T41-SurA: ACTGAATAATCAACACTTGGGAATGGTGGTTCAATGGGAGGATCGGTTCTAT

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:1.138/nture1371 As Brc11 (null) Brc5-13cK (conditioned llele) Reltive levels of mrna d C 1.2 1.8.6.4.2 Cereellum Ec Ev Ev As KO c Frequency Thymus KO KO 1 neo 11 Ec As 4 loxp

More information

Supporting Information

Supporting Information Supporting Informtion Positive Potentil Opertion of Cthodic Electrogenerted Chemiluminescence Immunosensor bsed on Luminol nd Grphene for Cncer iomrker Detection Shoujing Xu, Yng Liu*, Tihong Wng*, Jinghong

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Pulldown HeL lyste lyste lyste 25 5 75 5 5kD 37 25 5 MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTP LHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKA KAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKG

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:.38/nture126 Supplementry Tle 1. Oligonucleotides used in this study Nme Sequence ( -3 ) Construction of ptx hld Delt Bm CTAGATCACAGAGATGTGATGGATCCTAGTTGATGAGTTG Delt Mlu GTTGGGATGGCTTAATAACGCGTACTTTTAGTACTATACG

More information

Supplementary Materials

Supplementary Materials Supplementry Mterils Supplementry Figure 1 Supplementry Figure 2 in Fh deficient mice. Supplementry Figure 3 Supplementry Figure 4 Supplementry Figure 5 Supplementry Figure 6 Supplementry Figure 7 Supplementry

More information

High-Performance, Robust Metal Nanotrough-Embedded Transparent Conducting Film for Wearable Touch Screen Panel Application

High-Performance, Robust Metal Nanotrough-Embedded Transparent Conducting Film for Wearable Touch Screen Panel Application Electronic Supplementry Mteril (ESI) for Nnoscle. This journl is The Royl Society of Chemistry 216 Supporting Informtion High-Performnce, Roust Metl Nnotrough-Emedded Trnsprent Conducting Film for Werle

More information

In vivo cancer targeting and imaging with semiconductor quantum dots

In vivo cancer targeting and imaging with semiconductor quantum dots In vivo cncer trgeting nd imging with semiconductor quntum dots Xiohu Go, 1 Yunyun Cui, 2 Richrd M Levenson, 3 Lelnd W K Chung 2 & Shuming Nie 1 We descrie the development of multifunctionl nnoprticle

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi: 1.138/nture5694 Supplementry Informtion Anphse initition is regulted y ntgonistic uiquitintion nd deuiquitintion ctivities. Frnk Stegmeier 1,7, Michel Rpe 2,6,7, Viji M. Drvim 2,3, Grzegorz Nlep 4,

More information

Effect of Tantalum Additions to a Cobalt-Chromium-Nickel

Effect of Tantalum Additions to a Cobalt-Chromium-Nickel Effect of Tntlum Additions to Coblt-Chromium-Nickel Bse Alloy A. P. ROWE, W. C. BIGELOW, nd K. ASGAR University of Michign, School of Dentistry, Ann Arbor, Michign 48104, USA An investigtion by electron

More information

Apolipoprotein E promotes astrocyte colocalization and degradation of deposited amyloid-β peptides

Apolipoprotein E promotes astrocyte colocalization and degradation of deposited amyloid-β peptides 24 Nture Pulishing Group http://www.nture.com/nturemedicine Apolipoprotein E promotes strocyte colocliztion nd degrdtion of deposited myloid-β peptides Mill Koistinho 1,4,Suizhen Lin 1,4,Xin Wu 1,Michil

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:.8/nture99 Supplementry Tle : Primers nd proes. Sequences re written in 5 - direction. Vector construction cirs-7 forwrd cirs-7 reverse cirs-7ir forwrd cirs-7ir reverse cirs-7fs

More information

Lipid Nanoparticle Delivery of sirna to Osteocytes Leads to Effective Silencing of SOST and Inhibition of Sclerostin In Vivo

Lipid Nanoparticle Delivery of sirna to Osteocytes Leads to Effective Silencing of SOST and Inhibition of Sclerostin In Vivo Cittion: Moleculr Therpy Nucleic Acids (216) 5, e363; doi:1.138/mtn.216.68 Officil journl of the Americn Society of Gene & Cell Therpy www.nture.com/mtn Lipid Nnoprticle Delivery of sirna to Osteocytes

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi: 10.1038/nmt2812 Comintoril Development of Biomterils for Clonl Growth of Humn Pluripotent Stem Cells Ying Mei 1*, Krishnu Sh 2*, Sid R. Bogtyrev 1, Jing Yng 3, Andrew L.

More information

Genetic capsid modifications allow efficient re-targeting of adeno-associated virus type 2

Genetic capsid modifications allow efficient re-targeting of adeno-associated virus type 2 Genetic cpsid modifictions llow efficient re-trgeting of deno-ssocited virus type 2 ANNE GIROD 1, MARTIN RIED 1, CHRISTIANE WOBUS 2, HARALD LAHM 1, KRISTIN LEIKE 1, JÜRGEN KLEINSCHMIDT 2, GILBERT DELÉAGE

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION ARTICLE NUMBER: 643 DOI:.38/NMICROBIOL.6.43 A fungl pthogen secretes plnt lklinizing peptides to increse infection Sr Mschis, Dvid Segore, Dvid Turrà, Mercedes Leon-Ruiz, Ursul Fürst, Mennt El Ghlid, Guy

More information

Macmillan Publishers Limited. All rights reserved

Macmillan Publishers Limited. All rights reserved Vol 466 26 August 21 doi:1.138/nture933 LETTERS Role of Tet proteins in 5mC to 5hmC conversion, ES-cell self-renewl nd inner cell mss specifiction Shinsuke Ito 1,2, An C. D Alessio 1,2, Olen V. Trnov 1,2,

More information

Transient cell-specific EXO70A1 activity in the CASP domain and Casparian strip localization

Transient cell-specific EXO70A1 activity in the CASP domain and Casparian strip localization In the formt provided y the uthors nd unedited. SUPPLEMENTARY INFORMATION Trnsient cell-specific EXO7A1 ctivity in the CASP domin nd Csprin strip locliztion Lothr Klmch 1, Kin Hémty 1,2, Dmien De Bellis

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nture09470 prmt5-1 prmt5-2 Premture Stop Codon () GGA TGA PRMT5 Hypocotyl Length (Reltive to Drk) 0.5 0.3 0.1 ** 30 *** c prmt5-1 d ** *** 150 prmt5-2 ** *** 28 100 26 24 50 prmt5-1 prmt5-2

More information

Targeted sirna Delivery and mrna Knockdown Mediated by Bispecific Digoxigenin-binding Antibodies

Targeted sirna Delivery and mrna Knockdown Mediated by Bispecific Digoxigenin-binding Antibodies Cittion: Moleculr Therpy Nucleic Acids (12) 1, e46; doi:1.138/mtn.12.39 12 Americn Society of Gene & Cell Therpy All rights reserved 2158-3188/11 www.nture.com/mtn Trgeted sirna Delivery nd mrna Knockdown

More information

Rac1 orientates epithelial apical polarity through effects on basolateral laminin assembly

Rac1 orientates epithelial apical polarity through effects on basolateral laminin assembly Rc1 orienttes epithelil picl polrity through effects on solterl lminin ssemly ucy Erin O Brien*, Tzuu-Shuh Jou, Anne. Pollck, Qihng Zhng, Steen H. Hnsen*#, Peter Yurchenco nd Keith E. Mostov*** *Deprtment

More information

Chapter 9: Phase Diagrams

Chapter 9: Phase Diagrams hpter 9: Phse Digrms ISSUES TO ADDRESS... oncepts of Phse, omponent, Equilibrium Phse digrm In prticulr, if we specify... -- composition (e.g., wt% u - wt% Ni), nd -- temperture (T) then... How mny phses

More information

Supplemental Data. Antosz et al. Plant Cell (2017) /tpc SPT6/SPT6L. genomic DNA ACT2 +RT -RT +RT -RT

Supplemental Data. Antosz et al. Plant Cell (2017) /tpc SPT6/SPT6L. genomic DNA ACT2 +RT -RT +RT -RT A B C SPT6/SPT6L genomic DNA ACT2 +RT -RT Col- seedlings +RT -RT PSB-D cells Supplementl Figure 1. Expression of SPT6L nd SPT6. (Supports Figure 1.) Trnscript levels of of SPT6L (At1g6544) nd SPT6 (At1g6321)

More information

Supplementary Figures

Supplementary Figures Supplementry Figures Supplementry Figure 1: SEM imge of sphericlly shped closed cell encpsulted y CMG flkes. CMG segregtes to the oil/wter interfce during emulsifiction, stilizing sphericlly shped emulsion

More information

Protein microarrays with carbon nanotubes as multicolor Raman labels

Protein microarrays with carbon nanotubes as multicolor Raman labels Protein microrrys with cron nnotues s multicolor Rmn lels Zhuo Chen 1,4, Scott M Tkmn 1,4, Andrew P Goodwin 1, Michel G Ktth 2, Dn Drncing 1, Xinrn Wng 1, Gungyu Zhng 1, Xiolin Li 1, Zhung Liu 1, Pul J

More information

Supporting Information

Supporting Information Supporting Informtion Wiley-VCH 2011 69451 Weinheim, Germny Single-Crystl-like Titni Mesocges** Zhenfeng Bin, Jin Zhu, Jing Wen, Fenglei Co, Yuning Huo, Xufng Qin, Yong Co, Meiqing Shen,* Hexing Li,* nd

More information

Autoantigen microarrays for multiplex characterization of autoantibody responses

Autoantigen microarrays for multiplex characterization of autoantibody responses Autontigen microrrys for multiplex chrcteriztion of utontiody responses WILLIAM H. ROBINSON 1,2,4, CARLA DIGENNARO 1,2, WOLFGANG HUEBER 1, BRIAN B. HAAB 5, MAKOTO KAMACHI 1, ERIK J. DEAN 1,2, SYLVIE FOURNEL

More information

Autoantigen microarrays for multiplex characterization of autoantibody responses

Autoantigen microarrays for multiplex characterization of autoantibody responses Autontigen microrrys for multiplex chrcteriztion of utontiody responses WILLIAM H. ROBINSON 1,2,4, CARLA DIGENNARO 1,2, WOLFGANG HUEBER 1, BRIAN B. HAAB 5, MAKOTO KAMACHI 1, ERIK J. DEAN 1,2, SYLVIE FOURNEL

More information

Memory of cell shape biases stochastic fate decision-making despite mitotic rounding

Memory of cell shape biases stochastic fate decision-making despite mitotic rounding Received 5 Aug 15 Accepted 1 My 16 Pulished 8 Jun 16 DOI: 1.138/ncomms11963 Memory of cell shpe ises stochstic fte decision-mking despite mitotic rounding OPEN Tkshi Aknum 1, Cong Chen,3, Tetsuo Sto 1,4,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:.38/nture59 lmd phosphtse Okdic cid h COS7 SHSY5Y Clf lkline phosphtse Mouse rin c lmd phosphtse Okdic cid h 3P IB () COS7 Supplementry Figure is phosphoprotein., Okdic cid

More information

Supplementary Methods (A. M. Piliponsky et al.)

Supplementary Methods (A. M. Piliponsky et al.) Neurotensin increses mortlity nd mst cells reduce neurotensin levels in mouse model of sepsis Supplementry Methods (A. M. Piliponsky et l.) Lentivirl vector production plentilox 3.7 (pll3.7), vector engineered

More information

Systemic signals regulate ageing and rejuvenation of blood stem cell niches

Systemic signals regulate ageing and rejuvenation of blood stem cell niches Vol 463 28 Jnury 21 doi:1.138/nture8749 ARTICLES Systemic signls regulte geing nd rejuvention of lood stem cell niches Shne R. Myck 1, Jennifer L. Shdrch 1, Frncis S. Kim 1 & Amy J. Wgers 1 Ageing in multicellulr

More information

AKAP12 Mediates PKA-Induced Phosphorylation of ATR to Enhance Nucleotide Excision Repair

AKAP12 Mediates PKA-Induced Phosphorylation of ATR to Enhance Nucleotide Excision Repair University of Kentucky UKnowledge Mrkey ncer enter Fculty Publictions ncer 12-15-216 Medites PKA-Induced Phosphoryltion of ATR to Enhnce Nucleotide Excision Repir Sturt G. Jrrett University of Kentucky,

More information

In situ evaluation of DGT techniques for measurement of trace. metals in estuarine waters: a comparison of four binding layers

In situ evaluation of DGT techniques for measurement of trace. metals in estuarine waters: a comparison of four binding layers Electronic Supplementry Mteril (ESI) for Environmentl Science: Processes & Impcts. This journl is The Royl Society of Chemistry 2015 Supplementry Informtion for: In situ evlution of DGT techniques for

More information

Centrosome number is controlled by a centrosomeintrinsic block to reduplication

Centrosome number is controlled by a centrosomeintrinsic block to reduplication Centrosome numer is controlled y centrosomeintrinsic lock to redupliction Connie Wong 1 nd Tim Sterns 1,2 The centrosome duplictes once in S phse. To determine whether there is lock in centrosome redupliction,

More information

A monovalent streptavidin with a single femtomolar biotin binding site

A monovalent streptavidin with a single femtomolar biotin binding site A monovlent streptvidin with single femtomolr iotin inding site Mrk Howrth 1, Dniel J-F Chinnpen 1,4, Kimerly Gerrow 2,4, Pieter C Dorrestein 3, Melnie R Grndy 1, Neil L Kelleher 3, Al El-Husseini 2 &

More information

Supplementary Material

Supplementary Material Supplementry Mteril Kineticlly-controlled Synthesis of LiNi 0.5 Mn 1.5 O 4 Micro/nno-structured Hollow Spheres s High-rte Cthode Mterils for Lithium Ion Btteries Sheng Li, Guo M, Bing Guo, Zeheng Yng,

More information

Plasmin(ogen) Acquisition by Group A Streptococcus Protects against C3b-Mediated Neutrophil Killing

Plasmin(ogen) Acquisition by Group A Streptococcus Protects against C3b-Mediated Neutrophil Killing Journl of Innte Immunity Reserch Article J Innte Immun DOI: 1.1159/353754 Received: Ferury 7, 213 Accepted: June 17, 213 Pulished online: August 2, 213 Plsmin(ogen) Acquisition y Group A Streptococcus

More information

Lethal influenza infection in the absence of the natural killer cell receptor gene Ncr1

Lethal influenza infection in the absence of the natural killer cell receptor gene Ncr1 26 Nture Pulishing Group http://www.nture.com/ntureimmunology Lethl influenz infection in the sence of the nturl killer cell receptor gene Ncr Roi Gzit, Rizy Grud, Morn Eloim, Tl I Arnon, Gil Ktz, Hgit

More information

Phenotype of B cells responding to the thymus-independent type-2 antigen polyvinyl pyrrolidinone

Phenotype of B cells responding to the thymus-independent type-2 antigen polyvinyl pyrrolidinone Interntionl Immunology, V/ 8. No 4, pp 533-542 1996 Oxford University Press Phenotype of B cells responding to the thymus-independent type-2 ntigen polyvinyl pyrrolidinone Aln C. Whitmore, Geoffrey Hughton

More information

Neuronal activity enhances tau propagation and tau pathology in vivo

Neuronal activity enhances tau propagation and tau pathology in vivo r t i c l e s Neuronl ctivity enhnces tu propgtion nd tu pthology in vivo Jessic W Wu 1, yed Hussini 1,2, Isle M stille 1, Gustvo Rodriguez 1, n Mrejeru 3, Kelly Rilett 1, Dvid W nders 4, sey ook 5, Hongjun

More information

EXPERIMENTAL STUDY OF EXTRUSION AND SURFACE TREATMENT OF ORGANO CLAY WITH PET NANOCOMPOSITES

EXPERIMENTAL STUDY OF EXTRUSION AND SURFACE TREATMENT OF ORGANO CLAY WITH PET NANOCOMPOSITES EXPERIMENTAL STUDY OF EXTRUSION AND SURFACE TREATMENT OF ORGANO CLAY WITH PET NANOCOMPOSITES Krnik Trverdi, Somchoke Sontikew Wolfson Centre for Mterils Processing School of Engineering nd Design Brunel

More information