sensitive VBSs Vh subdomains EF EF

Size: px
Start display at page:

Download "sensitive VBSs Vh subdomains EF EF"

Transcription

1 Tlin- Tlin-EGFP-His ABD Mehno- ABD2 ABD3 sensitive VBSs DD 6xHis EGFP Vh sudomins EGFP-Vinulin EGFP Vt EGFP-Vh EGFP tinin- CH CH2 SP SP SP SP EF EF mcherry--tinin- mcherry CH CH2 SP SP SP SP EF EF Supplementry Figure. Proteins used in the study. () Construts used in this study. In tlin, the domins nmed,, 2 nd 3 re the F, F, F2 nd F3 sudomins of the FERM (four-point-one, ezrin, rdixin, moesin) domin. ABD, tin inding domin. DD, dimeriztion domin. Vh, vinulin hed. Vt, vinulin til. CH, lponin homology domin. SP, spetrin repet. EF, EF hnd motif. () SDS-PAGE of the purified proteins used in this work stined with Coomssie lue.

2 Tlin-EGFP in diss (.u.) High ffinity Clpin-2 site Low ffinity Clpin-2 site 2 3 EGFP ABD Mehno- ABD2 ABD3 sensitive VBSs DD 6xHis Tlin-EGFP-6xHis Rod-DD-EGFP-6xHis Rod Hed DD-EGFP-6xHis WB nti-his Tlin-EGFP-6xHis Coomssie Blue Alex594-Atin d Control + Clpin-2 (/2) 6 Control 2 8 Clpin-2 (/2) 4 e Alex594-Atin f Tlin- High ffinity Clpin-2 site Tlin ABD2 N ABD3 C Supplementry Figure 2. Orienttion of tlin on the surfe. (). Domin orgniztion of humn tlin fused with EGFP nd tgged with 6His t its C- terminus (tlin-egfp-his). The sheme shows the two lpin-2 levge sites. The high ffinity site is loted etween Q3 nd Q4 in the linker region tht onnets the hed nd the rod. The low ffinity site is loted etween K2493 nd M2494 in the region tht links the C-terminl tin inding domin (ABD) nd the dimeriztion domin (DD). () Tlin-EGFP- His is inuted with vrying dilutions of lpin-2. Clevge produts were resolved y SDS-PAGE nd nlyzed y Western lotting using n nti-his ntiody (left pnel) nd stined with Coomssie lue (entrl pnel). The levge produts re indited on the right. () In the ssy desried in this study, the ddition of lpin-2 (/2) results in the loss of EGFP fluoresene in tlin-egfp-his-oted diss (levge of tlin-egfp-his) nd prevents the nhoring of ontrtile tomyosin strutures. Conditions:.5 µm tlin-egfp- His (in the oting retion),.4 µm Myosin II, 2.4 µm of G-tin (2% Alex594-leled). Sle r, 2 µm. (d) Quntifition of the fluoresene of tlin-egfp-his in the diss in the sene nd presene of lpin-2. Dt re men ± SD. Asene of lpin-2 n = 85, presene of lpin-2 n = 8. The P vlue ws lulted (P <.) using t-test. Dt 2

3 olleted in two independent experiments. (e) We ompred the ility of full-length tlin nd tlin (deleted from the N-terminl hed) to support the self-ssemly of tomyosin les in the reonstituted ssy. SDS-PAGE shows tht the proteins were present t the sme onentrtion in the oting retions (left pnel). No ontrtile tin strutures were oserved when the miroptterned surfe ws first inuted with tlin insted of full-length tlin (right pnels). Conditions:.5 µm full-length tlin or tlin (during the oting retion),.4 µm Myosin II, 2.4 µm of G-tin (2% Alex594-leled). Sle r, 2 µm. (f) Sheme showing tht the N-terminl prt of tlin is ound to the surfe while its C-terminl ABD nd/or its entrl ABD intert with tin filments. 3

4 Normlized fluoresene (.u.) Normlized fluoresene (.u.) preleh.9.8 postleh s s 5 s d Time (s) preleh postleh s 2 s 5 s Time (s) Supplementry Figure 3. Fluoresene reovery fter photolehing (FRAP) of EGFP- Vh ound to tlin-oted diss FRAP experiments were performed to mesure the rte onstnt of fluoresene reovery of EGFP-Vh ound to tlin t stedy stte when onstnt fore is pplied in the presene of myosin nd short tin filments pped t their red ends. Conditions: µm of EGFP-Vh,.2 µm Myosin II, 2.4 µm of short tin filments pped t their red end. We used spinning disk onfol mirosope (-) nd TIRF mirosope (-d) to photoleh the smple nd monitor the fluoresene reovery. () In this representtive exmple, irulr region ( µm in dimeter) ws drwn round the left dis nd lehed y 2 itertive pulses of 2 ms eh using 49 nm lser t 5% power. Fluoresene reovery fter photolehing ws monitored for 5 s ( frme/ s). The fluoresene of the ontrol nonlehed dis (right) did not hnge during the reovery of the lehed diss. The timelpse shows the preleh fluoresene, nd the postleh fluoresene reovery t time, nd 5 s. Sle r, µm. () Kinetis showing the fluorersene reovery. Dt re men ± SD, n = 6. Dt olleted in two independent experiments. () In the representtive exmple, the surfe ws lehed y ms ontinuous illumintion using the evnesent wve generted y the 473 nm lser of TIRF mirosope. Fluoresene reovery fter photolehing ws monitored for 5 s ( frme/ s). The timelpse shows the preleh fluoresene, nd the postleh fluoresene reovery t time, 2 nd 5 s. Sle r, µm. Supplementry Movie 5. (d) Kinetis showing the fluoresene reovery. Dt re men ± SD, n = 28. Dt olleted in three independent experiments. 4

5 Frtion of EGFP-vinulin ound Light sttering intensity (.u.) Fluoresene (.u.) 3 EGFP-Vh (-T) tinin (-T) + tin (5 µm) -tinin (+T) + tin (5 µm) mcherry--tinin (-T) + tin (5 µm) mcherry--tinin (+T) + tin (5 µm) -tinin (-T) -tinin (+T) mcherry--tinin (-T) mcherry--tinin (+T) EGFP-Vh (+T) n.s tinin (mm) F-tin (µm) EGFP-Vinulin (µm) VBS (µm) EGFP- Vinulin F-tin K d =.5 µm VBS (µm) Supplementry Figure 4. Control of the tivity of -tinin, mcherry- -tinin, EGFP- Vh nd EGFP-vinulin () The rosslinking tivity of -tinin nd mcherry- -tinin ws ssessed y right ngle light sttering t 35 nm. -tinin nd mcherry- -tinin were inuted with 5 µm of MgATP-G-tin in polymerizing uffer (5mM Tris ph7.8, 25 mm KCl, mm MgCl 2,, mm CCl 2,.2 mm ATP, mm DTT). We mesured the inrese in light sttering etween t nd the finl stedy stte (h t room temperture). Both -tinin nd mcherry- -tinin indue dose dependent inrese in the light sttering intensity in the presene of tin, inditing the formtion of tin filment undles (irles). In the sene of tin, light sttering did not hnge signifintly during h (squres). Beuse the purifition of - tinin nd mcherry- -tinin used in this study inludes teril lysis step in the presene of Triton X, we verified tht the tivity of the proteins purified in the sene of Triton X (-T, open symols) nd in the presene of Triton X (+T, losed symols) re the sme. Two independent mesurements re shown for eh ondition. () The purifition of EGFP-Vh used in this study inludes teril lysis step in the presene of Triton X. EGFP-Vh purified in the sene (red r) or presene of Triton X (lue r) re reruited t the sme level in tlin oted diss t stedy stte when onstnt fore ws pplied in the presene of myosin nd short tin filments pped t their red ends. Dt re men ± SD. Asene of Triton n = 33, Presene of Triton n = 4. The P vlue ws lulted (P =.24) using t-test. Dt olleted in two independent experiments. The onditions re desried in the Fig. 2. () EGFP-vinulin inds to tin filments in tlin-dependent mnner. (Left) EGFP-vinulin (2 µm) ws inuted with F-tin (5 µm) in the presene of inresing onentrtions of tlin (VBS) s indited. After ultrentrifugtion, the pellet frtion ws nlyzed y SDS-PAGE nd stined with Coomssie lue. (Right) The frtion of EGFP-vinulin ound to tin ws plotted versus the onentrtion of VBS. Assuming tht the sturtion urve desries the inding of VBS to EGFP-vinulin, the est fit of the dt gve K d of.5 µm. representtive of 2 experiments is shown. 5

Unprecedented inhibition of tubulin polymerization directed by gold nanoparticles inducing cell cycle arrest and apoptosis

Unprecedented inhibition of tubulin polymerization directed by gold nanoparticles inducing cell cycle arrest and apoptosis Eletroni supplementry informtion (ESI) for Nnosle Unpreedented inhiition of tuulin polymeriztion direted y gold nnoprtiles induing ell yle rrest nd poptosis Diptimn Choudhury,,e, Pulrjpilli Lourdu Xvier,,

More information

Supplementary Figure S1. Akaike et al.

Supplementary Figure S1. Akaike et al. reltive expression of HIPK2 (HIPK2/GAPDH) Supplementry Figure S1. Akike et l. 1.25 ontrol HIPK2 #1 1 HIPK2 #2 HIPK2 3 U 0.75 0.5 0.25 0 ontrol : + + - HIPK2 #1: - - - + + - - - - HIPK2 #2: - - - - + +

More information

Figure S1. Characterization of sirna uptake in HeLa cells.

Figure S1. Characterization of sirna uptake in HeLa cells. Supplementry Informtion The Rough Endoplsmti Retiulum is Centrl Nuletion Site of sirna-medited RNA Silening Luks Stlder, Wolf Heusermnn, Len Sokol, Domini Trojer, Joel Wirz, Justin Hen, Anj Fritzshe, Florin

More information

HeLa. CaSki. Supplementary Figure 1. Validation of the NKX6.1 expression in mrna level and

HeLa. CaSki. Supplementary Figure 1. Validation of the NKX6.1 expression in mrna level and Supplementry Figure. Li et l. Reltive expression ( / GAPDH ) 6 5 4 3 2 5 Reltive expression ( / GAPDH ) 4 3 2 Reltive expression ( / GAPDH ) 4 3 2 Reltive expression ( / GAPDH ) 4 3 2 Ve S Ve S2 S S2 Ve

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nture10924 no tg Lsm1-my Lsm2-my Lsm5-my Lsm6-my Lsm7-my Lsm8-my no tg Lsm1-my Lsm2-my Lsm5-my Lsm6-my Lsm7-my Lsm8-my kd 220 120 100 80 60 50 40 30 20 SeeBlue Mrker Mgi Mrk no tg Sm1-my Smd3-my

More information

CD222nm (mdeg)

CD222nm (mdeg) [ MRW] x -3 (Grd m 2 dmol - ) 2 - -2 2 22 24 26 (nm) CD222nm (mdeg) - -2-3 -4 2 4 6 8 T ( C) Supplementry Figure S: Struture nd stility of Cox7 () CD spetr of 4 µm oxidized ( ) nd redued (---) Cox7*, Cox7*-outerSS,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Pulldown HeL lyste lyste lyste 25 5 75 5 5kD 37 25 5 MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTP LHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKA KAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKG

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/nc2885 kd M ΔNZipA 66.4 55.6 ZipA 42.7 34.6 6x His NiNTA 27.0 c 1.,, 2. evnescent field supported memrne Supplementry Figure 1 Experimentl ssy. () Illustrtion of protein interctions (dpted

More information

Gan et al., Supplemental Figure 1

Gan et al., Supplemental Figure 1 Gn et l., Supplementl Figure IB: DU45 Unp IB: py-68 IB: perk IB: ERK IB: Akt Unp DU45 DU45 ErB2 - EGF - EGF ErB2 75 75 Supplementl Figure. DU45 nd ells predominntly express nd re highly responsive to EGF.

More information

Supplementary Figure S1. MKRN1 depletion induces apoptosis via the caspase-8 pathway. kda h 72h 96h 6.8 % 22.5 % 21.

Supplementary Figure S1. MKRN1 depletion induces apoptosis via the caspase-8 pathway. kda h 72h 96h 6.8 % 22.5 % 21. Supplementry Figure S1. depletion indues poptosis vi the spse-8 pthwy. Atin 61.5 46.2 48h 72h 96h zvad 96h 5. % 6.8 % 8.7 % 4.3% simk1#5 9.5 % 22.5 % 39.6 % 11.8 % simk1#6 8. % 21.7 % 33.5 % 11. % 48h

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 1.138/n74 In the formt provided y the uthors nd unedited. d 331p 637p 9p 394p 48p 467p 22p 23p 489p 419p 3p 493p 332p 53p 39p 1 G1: 16.4% S: 73.1% G2/M: 1.5% 2 1 2 E-KO G1: 2.2% S: 7.7% G2/M: 9.1%

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION S shrna S Viility, % of NT sirna trnsfete ells 1 1 Srmle NT sirna Csp-8 sirna RIP1 Atin L929 shrna sirna: Csp8 Atin L929: shrna Csp8 e Viility, % of NT sirna trnsfete ells NT sirna Csp-8 sirna M45 M45mutRHIM

More information

Supplementary Information

Supplementary Information -S 1 - Supplementry Informtion Gssing in Li 4 Ti 5 O 12 -sed tteries nd its remedy Yn-Bing He 1,2, Bohu Li 1, Ming Liu 1, Chen Zhng 3, Wei Lv 1,3, Cheng Yng 1, Ji Li 1, Hongd Du 1, Bio Zhng 2, Qun-Hong

More information

Enzyme Triggered Cascade Reactions and Assembly of Abiotic Block Copolymers into Micellar Nanostructures

Enzyme Triggered Cascade Reactions and Assembly of Abiotic Block Copolymers into Micellar Nanostructures Enzyme Triggered Csde Retions nd Assemly of Aioti Blok Copolymers into Miellr Nnostrutures Jingyi Ro, Christine Hottinger, nd Anzr Khn Deprtment of Mterils, ETH-Zürih, Switzerlnd nzr@mt.ethz.h Styrene,

More information

Fluorescence Intensities of. GFP-PAC-1 Strains

Fluorescence Intensities of. GFP-PAC-1 Strains DOI: 10.1038/ncb3168 Arbitrry Fluorescence Units 2500 2000 1500 1000 500 0 full length (1-4) Fluorescence Intensities of GFP-PAC-1 Strins ΔPH 392-838 575-4 GFP-PAC-1 Strins 2-610 1-574 b control c pc-1(3

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 1.138/nc2274 EpH4 Prentl -/MDCK EpH4 Prentl -/MDCK - FERM- Figure S1 (kd) delferm- (1-438)- c Prentl MDCK -/MDCK deljfr- Input Control IP IP Input Control IP IP d Control Control Figure S1 () Specificity

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi: 1.138/nture77 c 2 2 1 15 1 1 5 1 1 5 5 129Sv 1.5 h IL-6 / HPRT 3 h 5 h 6 4 2 d 129Sv 4 4 3 3 2 1 1 8 6 4 2 e f g C57/BL6 Poly(dA-dT) Cell numer (normlized to medium control) 1 5 1 5 1 5 Fluorescence

More information

Interplay between NS3 protease and human La protein---- by Ray and Das Supplementary fig 1. NS3 pro

Interplay between NS3 protease and human La protein---- by Ray and Das Supplementary fig 1. NS3 pro Interply etween tese nd humn L protein---- y Ry nd Ds Supplementry fig 1 1 2 3 4 UV crosslinking ssy: α[ 32 P]UTP leled HCV IRES RNA ws UV-crosslinked to incresing concentrtions (0.1, 0.2 nd 0.4µM) in

More information

Protein sliding and DNA denaturation are essential for DNA organization by human mitochondrial transcription factor A

Protein sliding and DNA denaturation are essential for DNA organization by human mitochondrial transcription factor A Reeived 2 Jul 212 Aepted 1 Jul 212 Pulished 21 Aug 212 DOI: 1.138/nomms21 Protein sliding nd DNA denturtion re essentil for DNA orgniztion y humn mitohondril trnsription ftor A Gérldine Frge 1, *, Niels

More information

High-Performance, Robust Metal Nanotrough-Embedded Transparent Conducting Film for Wearable Touch Screen Panel Application

High-Performance, Robust Metal Nanotrough-Embedded Transparent Conducting Film for Wearable Touch Screen Panel Application Electronic Supplementry Mteril (ESI) for Nnoscle. This journl is The Royl Society of Chemistry 216 Supporting Informtion High-Performnce, Roust Metl Nnotrough-Emedded Trnsprent Conducting Film for Werle

More information

Rap1 Activation in Collagen Phagocytosis Is Dependent on Nonmuscle Myosin II-A

Rap1 Activation in Collagen Phagocytosis Is Dependent on Nonmuscle Myosin II-A Moleulr Biology of the ell Vol. 19, 532 546, Deemer 28 tivtion in ollgen Phgoytosis Is Dependent on Nonmusle Myosin II- Pmel D. ror,* Mry nne onti, Shoshn Rvid, Dvid B. Sks, ndrs Kpus, Roert S. delstein,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/nc2307 c No Jsplkinolide Jsplkinolide MDCK AP2-GFP Trnsferrin Merge BSC1 Trnsferrin fluorescence (.u.) MDCK - Jsplkinolide Jsplkinolide AP2-GFP fluorescence (.u.) Trnsferrin fluorescence (.u.)

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION BRC repet RPA DSB RAD52 DSB Repir doi:1.138/nture9399 Gp Repir ssdna/dsdna junction ssdna/dsdna junction RPA Binding Resection RPA Binding Filment Formtion or or Filment Formtion DNA Piring DNA Piring

More information

The Reverse of Polymer Degradation: In situ crosslinked gel formation through disulphide cleavage

The Reverse of Polymer Degradation: In situ crosslinked gel formation through disulphide cleavage The Reverse of Polymer Degrdtion: In situ rosslinked gel formtion through disulphide levge Arm. Seed, Ben Newlnd, Wenxin Wng* nd Ahy Pndit* Network of Exellene for Funtionl Biomterils, Ntionl University

More information

*** supplementary information. axon growth (µm/1h) 5 ng/ml NGF. 150 ng/ml NGF. 20 ng/ml NGF. n.s. n.s. n.s. DOI: /ncb1916

*** supplementary information. axon growth (µm/1h) 5 ng/ml NGF. 150 ng/ml NGF. 20 ng/ml NGF. n.s. n.s. n.s. DOI: /ncb1916 DOI: 1.138/n1916 25 xon growth (µm/1h) 2 15 1 5 ng/ml NGF 5 ng/ml NGF 2 ng/ml NGF 1 ng/ml NGF 15 ng/ml NGF Figure S1 () Doseresponse urve for xon outgrowth in response to NGF. Speifi tivities of NGF from

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION 1 1 μm c d EGF + TPA + e f Intensity 1.8 1.6 1.4 1.2 1.8.6.4.2 2 4 8 2 4 8 (Hours) 2 4 6 8 1 Time (Hours) Reltive luciferse ctivity 4 3 2 1 + CAMEK1 FRE reporter Figure S1 inhiitor incresed protein expression

More information

Electrostatic vs covalent bond in modified Jeffamine: effect on the phase behaviour and on the templating of mesoporous silica

Electrostatic vs covalent bond in modified Jeffamine: effect on the phase behaviour and on the templating of mesoporous silica Eletroni upplementry Mteril (EI) for oft Mtter This journl is The Royl oiety of Chemistry 3 upporting Informtion Eletrostti vs ovlent ond in modified Jeffmine: effet on the phse ehviour nd on the templting

More information

H. Randall Smith; Ph.D. Agronomy and Wayne Porter: Ph.D. Horticulture Mississippi State University Extension Service

H. Randall Smith; Ph.D. Agronomy and Wayne Porter: Ph.D. Horticulture Mississippi State University Extension Service Effect of SumGrow on growth, development nd yield of Irish pottoes (Solnum tuerosum) t the Beumont Reserch Sttion (Mississippi Stte University) during 217 H. Rndll Smith; Ph.D. Agronomy nd yne Porter:

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SI Fig. PrpS is single copy gene k 3. 9... EcoRV EcoRV k 5 BmH Pst c well k HindIII HindIII HindIII.3.5 3.. Southern lots of Ppver genomic DNA from plnts with SS8 hplotypes, hyridized with PrpS proe..

More information

TFG-1 function in protein secretion and oncogenesis

TFG-1 function in protein secretion and oncogenesis A R T I C L E S funtion in protein seretion nd onogenesis Kristen Witte 1,4, Amer L. Shuh 1,4, Jn Hegermnn 2, Ali Srkeshik 3, Jonthn R. Myers 1, Ktrin Shwrze 2, John R. Ytes III 3, Stefn Eimer 2 nd Anjon

More information

Supplementary Information

Supplementary Information Supplementry Informtion Polypurine reverse-hoogsteen (PPRH) oligonucleotides cn form triplexes with their trget sequences even under conditions where they fold into G-qudruplexes. Ann Solé, Emmnuelle Delgoutte,

More information

A" 700" B" 700" 24" PAR" Day"length" 20" Photosynthe7cally"ac7ve"radia7on"(PAR)"(Ue/m2)" 600" 500" 16" 400" Hours" 12" 300" 200" 100"

A 700 B 700 24 PAR Daylength 20 Photosynthe7callyac7veradia7on(PAR)(Ue/m2) 600 500 16 400 Hours 12 300 200 100 Oikos OIK-1764 De Long, J. R., Krdol, P., Sundqvist, M. K., Veen, G. F nd Wrdle, D. A. 214. Plnt growth response to diret nd indiret temperture effets vries y vegettion type nd elevtion in surti tundr.

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 0.038/n2228 HepG2 (ell pellet ml) Nuler Extrts (.8 mg) -epenent intertnts HepG2 (ell pellet 55.5 ml) Nuler Extrts (227.7 mg) glutthione sephrose F.T. glutthione sephrose F.T. oun F.T. oun F.T. -FXR

More information

Heat-shock protein 70 inhibits apoptosis by preventing recruitment of procaspase-9 to the Apaf-1 apoptosome

Heat-shock protein 70 inhibits apoptosis by preventing recruitment of procaspase-9 to the Apaf-1 apoptosome Het-shok protein 7 inhiits poptosis y preventing reruitment of prospse-9 to the poptosome Helen M. Beere*, Beni B. Wolf*, Kelvin Cin, Dik D. Mosser, Artin Mhoui*, Tomomi Kuwn*, Pnkj Tilor, Rihrd I. Morimoto,

More information

a ATP release 4h after induction

a ATP release 4h after induction doi:1.138/nture9413 ATP relese 4h fter induction of poptosis (nm) 5 ATP 4 3 2 1 UV UV + zvad 1μM 3μM 5μM UV + 1μM 3μM 5μM UV + 18AGA 1μM 3μM 5μM UV + FFA HeL monolyer Scrpe Dye trnsfer HeL HeL-Cx43 HeL-Cx43

More information

Won Jung, Seung Min An, Whaseon Lee-Kwon, Mario Chiong1, Sergio Lavandero1,2, and Hyug

Won Jung, Seung Min An, Whaseon Lee-Kwon, Mario Chiong1, Sergio Lavandero1,2, and Hyug Supplementry Informtion suppresses IL-1-medited immunomodultion Soo Youn Choi, Hwn Hee Lee, Jun Ho Lee, Byeong Jin Ye, Eun Jin Yoo, Hyun Je Kng, Gyu Won Jung, Seung Min An, Whseon Lee-Kwon, Mrio Chiong1,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nture10970 I. GN directly grown on the h-bn relese lyer Figure S1 shows X-ry diffrction with the 2θ/ω configurtion nd n opticl microscopy imge for the GN directly grown on the h-bn relese lyer.

More information

Lineage-specific functions of Bcl6 in immunity and inflammation are mediated through distinct biochemical mechanisms

Lineage-specific functions of Bcl6 in immunity and inflammation are mediated through distinct biochemical mechanisms Supplementry informtion for: Linege-specific functions of Bcl6 in immunity nd inflmmtion re medited through distinct iochemicl mechnisms Chunxin Hung, Kterin Htzi & Ari Melnick Division of Hemtology nd

More information

NATURE STRUCTURAL & MOLECULAR BIOLOGY

NATURE STRUCTURAL & MOLECULAR BIOLOGY Communition etween nd during sustrte proessing nd degrdtion Shilp A Joshi 1, Greg L Hersh 1, Tni A Bker 1,2 & Roert T Suer 1 In the P omprtmentl protese, ring hexmers of the AAA + ATPse ind, denture nd

More information

+ BR. b CBF a a CBF b b a,b a b COR15B 0.7. c c 1.5 COR47. c c 0.5. cpd wt BRI1 bri1. bri1-1

+ BR. b CBF a a CBF b b a,b a b COR15B 0.7. c c 1.5 COR47. c c 0.5. cpd wt BRI1 bri1. bri1-1 7 6 Survivl (%) 5 4 + BR + BR. CBF.5 CBF Fold hnge.4.7,.5. CBF.5 COR5A Fold hnge.8.4..5 - d,d Fold hnge..8.4, COR5B.4.7 KIN Fold hnge.6..8.4, COR47.5.5 COR78 wt BRI ri ri oe - - pd wt BRI ri oe - ri -

More information

supplementary information

supplementary information DOI: 10.1038/n2036 GFP2XFYVE GFP2XFYVE GFP2XFYVE ntigfp Protein A 10 nm GFP2XFYVE C215S e f g GFP2XFYVE TRANSFERRIN Figure S1 PtIns3P lolises to the mioy uring ytokinesis n ololises with reyling enosoml

More information

Supporting Information

Supporting Information Supporting Informtion Time-Resolved Fluorescent Detection of Hg 2+ in Complex Environment y Conjugting Mgnetic Nnoprticles with Triplehelix Moleculr Switch Jing Zheng, Yuhong Nie, Yping Hu, Jishn Li, Yinhui

More information

Assembly-driven activation of the AIM2 foreign-dsdna sensor provides a polymerization template for downstream ASC

Assembly-driven activation of the AIM2 foreign-dsdna sensor provides a polymerization template for downstream ASC Reeived 21 Jn 2015 Aepted 16 Jun 2015 Pulished 22 Jul 2015 DOI: 10.1038/nomms8827 Assemly-driven tivtion of the AIM2 foreign- sensor provides polymeriztion templte for downstrem ASC Semus R. Morrone 1,

More information

Initiation complex dynamics direct the transitions between distinct phases of early HIV reverse transcription

Initiation complex dynamics direct the transitions between distinct phases of early HIV reverse transcription Initition omplex dynmis diret the trnsitions etween distint phses of erly IV reverse trnsription Shixin Liu 1,6, Bryn T rd 2,6, Jennifer T Miller 3, Sturt J Le rie 3 & Xiowei Zhung 1,4,5 21 Nture meri,

More information

Supplementary Figure 1. Zhang et al.

Supplementary Figure 1. Zhang et al. Supplementry Figure 1. Zhng et l. T30-SurA: GGCAGTTTCATCATGAATGTGCAGGAGCTTGCAACAATTAAGGTGGAGAATCTCCC T30-SurB: GGCAGTTTCATCATGAATGTGCAGGAGCTAGCAACTATTAAGGTGGAGAATCTCCC T41-SurA: ACTGAATAATCAACACTTGGGAATGGTGGTTCAATGGGAGGATCGGTTCTAT

More information

Preparation of conductive carbons with high surface area

Preparation of conductive carbons with high surface area PERGAMON Crbon 39 (2001) 39 44 Preprtion of ondutive rbons with high surfe re Weiming Lu, D.D.L. Chung* Composite Mterils Reserh Lbortory, Stte University of New York t Bufflo, Bufflo, NY 14260-4400, USA

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nture09470 prmt5-1 prmt5-2 Premture Stop Codon () GGA TGA PRMT5 Hypocotyl Length (Reltive to Drk) 0.5 0.3 0.1 ** 30 *** c prmt5-1 d ** *** 150 prmt5-2 ** *** 28 100 26 24 50 prmt5-1 prmt5-2

More information

Supplementary Fig

Supplementary Fig Supplementry Fig. 1 * 180-115- 82-64- 49-37- * 180-115- 85-64- 49-37- 26-26- Mem Cyt Mem Cyt Supplementry Fig.1 Specificity of nti-tie2 ntiodies. HUVECs were homogenized nd centrifuged t 400 000g to otin

More information

COS-1 cells transiently transfected with either HA hgr wt, HA hgr S211A or HA hgr S226A

COS-1 cells transiently transfected with either HA hgr wt, HA hgr S211A or HA hgr S226A 1 SUPPLEMENTRY FIGURES Fig. 1 & Specificity of the nti-p-s211 nd nti-p-s226 ntibodies COS-1 cells trnsiently trnsfected with either H hgr wt, H hgr S211 or H hgr S226 were treted with 1nM Dex for 1 hour.

More information

Synaptobrevin is essential for fast synaptic-vesicle endocytosis

Synaptobrevin is essential for fast synaptic-vesicle endocytosis LETTERS Synptorevin is essentil for fst synpti-vesile endoytosis Feren Deák,, Susnne Shoh,,3, Xinrn Liu,4, Thoms C. Südhof,,4,6 nd Ege T. Kvlli,5,6 Synptorevin- (VAMP-), the mjor SNARE protein of synpti

More information

melf4 Vec Fold induction ELF4 STK38 MAVS IFNa8- Luc

melf4 Vec Fold induction ELF4 STK38 MAVS IFNa8- Luc IfnβmRNA() m h m h Type I IFN(unit/ml) Supplementry Informtion Supplementry Figures 3 7 3 2 2 35 1 1 mifnβ-lu hifnβ-lu Med HIV-1 EMCV SeV Poly(IC) Poly(dAdT) d e f g h 8 4 2 1 12 6 9 6 3 12 6 IFN2-Lu IFN4

More information

Crystallization Time (min) PCL block. PCL homopolymer. Crystallization Time (min)

Crystallization Time (min) PCL block. PCL homopolymer. Crystallization Time (min) Figure S-1 Crystllinity of PCL Chins.4.3.2.1 2 PCL homopolymer T c = -54 o C D = 13. nm PCL lock 4 6 8 1 Crystlliztion Time (min) Crystllinity of PCL Chins.4.3.2.1 PCL lock PCL homopolymer T c = -45 o

More information

EXPLORING BIOFUMIGATIONAL POTENTIAL OF MUSTARDS

EXPLORING BIOFUMIGATIONAL POTENTIAL OF MUSTARDS EXPLORING BIOFUMIGATIONAL POTENTIAL OF MUSTARDS Oleg Dugovish*, (University of Cliforni Coopertive Extension - Ventur County), Jmes Downer nd Ole Beker (University of Cliforni Coopertive Extension -Ventur

More information

7 mm Diameter Miniature Single-Turn Cermet Trimmer

7 mm Diameter Miniature Single-Turn Cermet Trimmer 7 mm Dimeter Miniture Single-Turn Cermet Trimmer A dust seled plsti se proteting qulity ermet trk gurntees high performne nd proven reliility. Adjustments re mde esier y the ler sle redings. is idelly

More information

WesternBright TM MCF and MCF-IR

WesternBright TM MCF and MCF-IR WesternBright TM MCF nd MCF-IR Quntittive, multi-color fluorescent Western lotting kits WesternBright MCF visile nd ner infrred (IR) fluorescent Western lotting kits llow the ssy of two proteins t once,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION % chnge in ody mss. -.. Smll intestinl mss (g) -1. -. -. Villi length in proximl jejunum (µm) 1 # of crypts/ mm of jejunum g Proximl jejunum # of enterocytes in jejunl villi 1 1 e. -. d Smll intestinl

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nture10698 Rg1 µmt LPLs CD3 LPLs CD11c hi LPLs CD3 splenocytes CD19 LPLs CD19 splenocytes 2 Ocontrol J 4 CD11c Supplementry Figure 1 Chrcteriztion of intestinl lmin

More information

PP100 N ABSOLUTE DEPTH FILTER ELEMENTS FEATURES & BENEFITS. Process Filtration

PP100 N ABSOLUTE DEPTH FILTER ELEMENTS FEATURES & BENEFITS. Process Filtration PP100 N ABSOLUTE DEPTH FILTER ELEMENTS Proess Filtrtion Donldson LifeTe PP100 N filters re solute rted depth type filters onstruted of 100% polypropylene. They ontin grded density polypropylene mirofier

More information

Coordinated conformational and compositional dynamics drive ribosome translocation

Coordinated conformational and compositional dynamics drive ribosome translocation Coordinted onformtionl nd ompositionl dynmis drive riosome trnslotion Jin Chen 1,2, Alexey Petrov 2, Alert Tsi 1,2, Seán E O Lery 2 & Joseph D Puglisi 2,3 npg 213 Nture Ameri, In. All rights reserved.

More information

Supplementary information

Supplementary information PP GC B Epithelil cell Peyer s ptch B lymphocyte Dendritic cell Bsophil Neutrophil Mst cell Nturl killer cell T lymphocyte Supplementry informtion EAF2 medites germinl center B cell poptosis to suppress

More information

Aged biochar affects gross nitrogen mineralisation and nitrogen recovery: a 15 N study in two contrasting soils

Aged biochar affects gross nitrogen mineralisation and nitrogen recovery: a 15 N study in two contrasting soils Aged biohr ffets gross nitrogen minerlistion nd nitrogen reovery: 15 N study in two ontrsting soils Shmim Mi 1, Feike A. Dijkstr 1 nd Blwnt Singh 1 1 Center for Crbon, Wter nd Food, Fulty of Agriulture

More information

Application of Phi29 Motor prna for Targeted Therapeutic Delivery of sirna Silencing Metallothionein-IIA and Survivin in Ovarian Cancers

Application of Phi29 Motor prna for Targeted Therapeutic Delivery of sirna Silencing Metallothionein-IIA and Survivin in Ovarian Cancers originl rtile The Amerin Soiety of Gene & Cell Therpy Applition of Phi9 Motor prna for Trgeted Therpeuti Delivery of sirna Silening Metllothionein-IIA nd Survivin in Ovrin Cners Pheruz Trpore, Yi Shu,

More information

ARTICLES. Pyruvate kinase M2 is a phosphotyrosinebinding

ARTICLES. Pyruvate kinase M2 is a phosphotyrosinebinding Vol 452 13 Mrh 2008 doi:10.1038/nture06667 ARTICLES Pyruvte kinse M2 is phosphotyrosineinding protein Hether R. Christofk 1, Mtthew G. Vnder Heiden 1,3, Ning Wu 1, John M. Asr 2,4 & Lewis C. Cntley 1,4

More information

T he organization of the actin cytoskeleton in cells correlates

T he organization of the actin cytoskeleton in cells correlates ActA nd humn zyxin hrour Arp2/3-independent ctinpolymeriztion ctivity rticles Julie Frdelizi*, Vincent Noireux, Julie Plstino, Berndette Menichi*, Dniel Louvrd*, Cécile Sykes, Roy M. Golsteyn* nd Evelyne

More information

LEAD contamination in soils is of major concern due

LEAD contamination in soils is of major concern due Pulished online Jnury 25, 2007 Applition Methods Affet Phosphorus-Indued Led Immoiliztion from Contminted Soil Joon Ki Yoon, Xinde Co, nd Len Q. M* Reprodued from Journl of Environmentl Qulity. Pulished

More information

TTT DIAGRAM OF A NEWLY DEVELOPED NICKEL-BASE SUPERALLOY ALLVAC 718PLUS

TTT DIAGRAM OF A NEWLY DEVELOPED NICKEL-BASE SUPERALLOY ALLVAC 718PLUS Superlloys 718, 625, 706 nd Derivtives 2005 Edited y E.A. Lori TMS (The Minerls, Metls & Mterils Soiety), 2005 TTT DIAGRAM OF A NEWLY DEVELOPED NICKEL-BASE SUPERALLOY ALLVAC 718PLUS Xishn Xie 1, Chunmei

More information

An insight into itraq: where do we stand now?

An insight into itraq: where do we stand now? Anlyticl nd Bionlyticl Chemistry Electronic Supplementry Mteril An insight into itraq: where do we stnd now? Croline Evns, Josselin Noirel, Sw Yen Ow, Mlind Slim, An G. Pereir-Medrno, Nrciso Couto, Jgroop

More information

Polymer 49 (2008) Contents lists available at ScienceDirect. Polymer. journal homepage:

Polymer 49 (2008) Contents lists available at ScienceDirect. Polymer. journal homepage: Polymer 49 (2008) 5027 5036 Contents lists ville t SieneDiret Polymer journl homepge: www.elsevier.om/lote/polymer The role of nnoly in the genertion of poly(ethylene terephthlte) fiers with improved modulus

More information

Application of Bio-filteration Wastewater Treatment Using Iraqi Gypsum and Phosphate Bio-filters

Application of Bio-filteration Wastewater Treatment Using Iraqi Gypsum and Phosphate Bio-filters Journl of Wter Resoure nd Hydruli Engineering De. 13, Vol. Iss., PP. 19-156 pplition of io-filtertion Wstewter Tretment Using Irqi Gypsum nd Phosphte io-filters yd S. Mustuf 1, Sdeq O. Sulimn, Mrw Y. Khudir

More information

Substrate elasticity provides mechanical signals for the expansion of hemopoietic stem and progenitor cells

Substrate elasticity provides mechanical signals for the expansion of hemopoietic stem and progenitor cells correction notice Nt. Biotechnol. 28, 1123 1128 (21); pulished online 3 Octoer 21; corrected fter print 27 April 211 Sustrte elsticity provides mechnicl signls for the expnsion of hemopoietic stem nd progenitor

More information

1. Supplementary Figures and Legends a b

1. Supplementary Figures and Legends a b doi:10.1038/nture09540 1. Supplementry Figures nd Legends Supplementry Figure 1. Scnning trnsmission electron microgrphs (STEM) of NCC., STEM prepred from fst evportion of dilute NCC suspension shows individul

More information

PML regulates p53 stability by sequestering Mdm2 to the nucleolus

PML regulates p53 stability by sequestering Mdm2 to the nucleolus regultes stility y sequestering to the nuleolus Ros Bernrdi 1,Pier Polo Sglioni 1,3,Stephn Bergmnn 1,3,Henning F. Horn 2,Kren H. Vousden 2 nd Pier Polo Pndolfi 1,4 The promyeloyti leukemi () tumour-suppressor

More information

A genetically encoded, fluorescent indicator for cyclic AMP in living cells

A genetically encoded, fluorescent indicator for cyclic AMP in living cells A genetilly enoded, fluoresent inditor for yli AMP in living ells rtiles Mnuel Zolo*, Frnes De Giorgi*, Chrles Y. Cho, Luxin Feng, Tom Knpp, Pul A. Negulesu, Susn S. Tylor #, Roger Y. Tsien # nd Tullio

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION doi:10.1038/nture10177 MDYKDHDGDYKDHDIDYKDD DDKMAPKKKRKVGIHGVPAA MAERPFQCRICMRKFAQSGD LTRHTKIHTGEKPFQCRICM RNFSRSDVLSEHIRTHTGEK PFACDICGKKFADRSNRIKH TKIHTGSQKPFQCRICMRNF SRSDNLSEHIRTHTGEKPFA

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Supplementry Methods: Expression nd purifiction of Sgs1 nd sgs1-k706a We first modified the pfstbc-htb vector (Invitrogen) y dding FLAG tg fter the pre-existing (His) 6 tg. A DNA frgment encoding full

More information

Jay S Desgrosellier, Leo A Barnes, David J Shields, Miller Huang, Steven K Lau, Nicolas Prévost, David Tarin, Sanford J Shattil and David A Cheresh

Jay S Desgrosellier, Leo A Barnes, David J Shields, Miller Huang, Steven K Lau, Nicolas Prévost, David Tarin, Sanford J Shattil and David A Cheresh Integrin αvβ3/c-src Oncogenic Unit Promotes Anchorge-independence nd Tumor Progression Jy S Desgrosellier, Leo A Brnes, Dvid J Shields, Miller Hung, Steven K Lu, Nicols Prévost, Dvid Trin, Snford J Shttil

More information

THE INFLUENCE OF THERMOMECHANICAL TREATMENT AND CHEMICAL COMPOSITION ON RECRYSTALLIZATION OF Al-Mg ALLOYS

THE INFLUENCE OF THERMOMECHANICAL TREATMENT AND CHEMICAL COMPOSITION ON RECRYSTALLIZATION OF Al-Mg ALLOYS Assoition of Metllurgil Engineers of Seri Sientifi pper AMES UDC:669.715 721.065.53.040.2-174=20 THE INFLUENCE OF THERMOMECHANICAL TREATMENT AND CHEMICAL COMPOSITION ON RECRYSTALLIZATION OF Al-Mg ALLOYS

More information

Lab #10 Spray Drying. Outline. Goals of Lab. Goals of lab Spray dryer Hygrometer Psychrometer Heating ambient air and drying a product

Lab #10 Spray Drying. Outline. Goals of Lab. Goals of lab Spray dryer Hygrometer Psychrometer Heating ambient air and drying a product Lb #10 Spry Drying Outline Gols of lb Spry dryer Hygrometer Psychrometer Heting mbient ir nd drying product Depiction on psychrometric chrt Performing mss blnce nd energy blnce during the process 2 Gols

More information

Life cycle management -Prediction -

Life cycle management -Prediction - JST Oen Seminr Soro, 2 Mrh 2 Life yle mngement -Predition - Professor, Hokkido University, Jn Hiroshi YOKOTA, PhD, PE Life-Cyle Mngement system Servie eriod Usge Design Environment Servie life Future ln

More information

Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction

Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction Crystl strutures of humn nd Stphyloous ureus pyruvte roxylse nd moleulr insights into the roxyltrnsfer retion Song Xing & Ling Tong Pyruvte roxylse (PC) tlyzes the iotin-dependent prodution of oxloette

More information

Genetic barcode sequencing for screening altered population dynamics of hematopoietic stem cells transduced with lentivirus

Genetic barcode sequencing for screening altered population dynamics of hematopoietic stem cells transduced with lentivirus Cittion: Moleulr Therpy Methods & Clinil Development (214) 1, 1452; doi:1.138/mtm.214.52 214 The Amerin Soiety of Gene & Cell Therpy All rights reserved 2329-51/14 www.nture.om/mtm Artile Geneti rode sequening

More information

Research. Tongjun Sun 1, Lucas Busta 2, Qian Zhang 1, Pingtao Ding 1, Reinhard Jetter 1,2 and Yuelin Zhang 1. Summary.

Research. Tongjun Sun 1, Lucas Busta 2, Qian Zhang 1, Pingtao Ding 1, Reinhard Jetter 1,2 and Yuelin Zhang 1. Summary. Reserh TGACG-BINDING FACTOR (TGA) nd TGA regulte sliyli id nd pipeoli id iosynthesis y modulting the expression of SYSTEMIC ACQUIRED RESISTANCE DEFICIENT (SARD) nd CALMODULIN-BINDING PROTEIN g (CBPg) Tongjun

More information

Supplementary Figure 1. A TRPC5-like channel in the neurites and somata of aortic baroreceptor neurons.

Supplementary Figure 1. A TRPC5-like channel in the neurites and somata of aortic baroreceptor neurons. Supplementl Figure 1 c d e f Supplementry Figure 1. A TRPC5-like chnnel in the neurites nd somt of ortic roreceptor neurons. Cell-ttched ptch recordings from the neurite terminls (-c) nd the somt (d-f)

More information

MR405: Response of Young Black Spruce (Picea mariana (Mill.) B.S.P.) to a Mixture of Wood Ash and Secondary Papermill Sludge

MR405: Response of Young Black Spruce (Picea mariana (Mill.) B.S.P.) to a Mixture of Wood Ash and Secondary Papermill Sludge The University of Mine DigitlCommons@UMine Misellneous Reports Mine Agriulturl nd Forest Experiment Sttion -997 MR45: Response of Young Blk Sprue (Pie mrin (Mill.) B.S.P.) to Mixture of Wood Ash nd Seondry

More information

than 1 week at -90, were resuspended by gentle homogenization

than 1 week at -90, were resuspended by gentle homogenization Pro. Nti. Ad. Si. USA Vol. 74, No. 11, pp. 4881-4885, November 1977 Biohemistry Role of nuleotides in tubulin polymeriztion: Effet of gunylyl 5'-methylenediphosphonte (mirotubules/gunosine nuleotides/high

More information

Title: SUPPLEMENTARY INFORMATION. Gradient Confinement Induced Uniform Tensile Ductility in Metallic Glass

Title: SUPPLEMENTARY INFORMATION. Gradient Confinement Induced Uniform Tensile Ductility in Metallic Glass SUPPLEMENTARY INFORMATION Title: Grdient Confinement Induced Uniform Tensile Ductility in Metllic Glss X.L. Lu 1, Q.H. Lu 1, Y. Li* 1,2 nd L. Lu* 1 1 Shenyng Ntionl Lortory for Mterils Science, Institute

More information

Combined Hot Air-Microwave Drying Methods in Banana Chips Production

Combined Hot Air-Microwave Drying Methods in Banana Chips Production Amerin-Eursin J. Agri. & Environ. Si., (8): 77-776, ISSN 88-6769 IDOSI Pulitions, DOI:.589/idosi.ejes...8.88 Comined Hot Air-Mirowve Drying Methods in Bnn Chips Prodution Hmid Tvkolipour nd Leil Zirjni

More information

TECHNICAL REPORTS. A genetically targeted optical sensor to monitor calcium signals in astrocyte processes

TECHNICAL REPORTS. A genetically targeted optical sensor to monitor calcium signals in astrocyte processes A genetilly trgeted optil sensor to monitor lium signls in stroyte proesses Eiji Shigetomi, Sestin Krun, Mihel V Sofroniew 2 & Bljit S Khkh,2 2 Nture Ameri, In. All rights reserved. Clium signling is studied

More information

t e c h n i c a l r e p o r t s

t e c h n i c a l r e p o r t s t e h n i l r e p o r t s A genetilly trgeted optil sensor to monitor lium signls in stroyte proesses Eiji Shigetomi, Sestin Krun, Mihel V Sofroniew 2 & Bljit S Khkh,2 2 Nture Ameri, In. All rights reserved.

More information

Crop Rotations, Reduced Tillage and N Fertilization Effects on Corn Yields And Aflatoxin Levels

Crop Rotations, Reduced Tillage and N Fertilization Effects on Corn Yields And Aflatoxin Levels Crop Rottions, Redued Tillge nd N Fertiliztion Effets on Corn Yields And Afltoxin Levels J.E. Mtoh nd M. Rihrdson Texs AgriLife Reserh nd Extension Center Stte Hwy Corpus Christi, TX 78- jmtoh@g.tmu.edu

More information

nm nm nm nm nm nm. Seed surface. oi-ab. oi-ad. ii-ab. ii-ad/endothelium. endosperm.

nm nm nm nm nm nm. Seed surface. oi-ab. oi-ad. ii-ab. ii-ad/endothelium. endosperm. B 360-370nm Seed surfce oi- 90-100nm A 630-640nm oi-d ii- ii-d/endothelium 230-240nm 220-230nm 240-280nm 1mm endosperm C oi-d D ii-d/endothelium ii- endosperm Supplementry Figure 1 Cell wll thickness mesurements

More information

Long single a-helical tail domains bridge the gap between structure and function of myosin VI

Long single a-helical tail domains bridge the gap between structure and function of myosin VI Long single -helicl til domins ridge the gp etween structure nd function of myosin VI Benjmin J Spink 1, Sivrj Sivrmkrishnn 1, Jn Lipfert 2,4, Sestin Donich 2,3 & Jmes A Spudich 1 Myosin VI hs chllenged

More information

Design+ Flooring Installation instructions for the patented installation system UNI fit!

Design+ Flooring Installation instructions for the patented installation system UNI fit! Design+ Flooring Instlltion instrutions for the ptented instlltion system UNI fit! DUAL SEAL Neessry testing nd preprtion / Su-floors 1. Neessry testing nd preprtions EGGER's Design+ flooring is mnuftured

More information

Fundamental understanding of the interaction of continuous wave laser with aluminium

Fundamental understanding of the interaction of continuous wave laser with aluminium Int J Adv Mnuf Tehnol (2017) 93:3165 3174 DOI 10.1007/s00170-017-0702-6 ORIGINAL ARTICLE Fundmentl understnding of the intertion of ontinuous wve lser with luminium Júlio Corodo 1 & Sóni Meo 1 & Stewrt

More information

Regulatory activity revealed by dynamic correlations in gene expression noise

Regulatory activity revealed by dynamic correlations in gene expression noise 28 Nture Pulishing Group http://wwwntureom/nturegenetis Regultory tivity reveled y dynmi orreltions in gene expression Mry J Dunlop, Roert Sidney Cox III 2, Joseph H Levine, Rihrd M Murry & Mihel Elowitz

More information

Electronic supplementary information: High specific detection and near-infrared photothermal. therapy of lung cancer cells with high SERS active

Electronic supplementary information: High specific detection and near-infrared photothermal. therapy of lung cancer cells with high SERS active Electronic supplementry informtion: High specific detection nd ner-infrred phototherml therpy of lung cncer cells with high SERS ctive ptmer-silver-gold shell-core nnostructures Ping Wu, Yng Go, Yimei

More information

Calpain-mediated proteolysis of talin regulates adhesion dynamics

Calpain-mediated proteolysis of talin regulates adhesion dynamics Clpin-medited proteolysis of tlin regultes dhesion dynmics Sntos J. Frnco 1,Mry A. Rodgers 2,Benjmin J. Perrin 1,Jewon Hn 3,Dvid A. Bennin 2,Dvid R. Critchley 4 nd Ann Huttenlocher 2,5 Dynmic regultion

More information

PF-PT N MEMBRANE FILTER ELEMENTS FEATURES & BENEFITS. Compressed Air & Process Filtration PF-PT N

PF-PT N MEMBRANE FILTER ELEMENTS FEATURES & BENEFITS. Compressed Air & Process Filtration PF-PT N PF-PT N MEMBRANE FILTER ELEMENTS Compressed Air & Proess Filtrtion The Donldson LifeTe PF-PT N filter element is sterile grde, pleted high performne PTFE memrne filter. It provides the gretest ssurne of

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:.38/nture598 SUPPLEMETARY IFORMATIO + + + + + + + + + rit TRIC-A: M------ELLSALSLGELALSFSRVPLFPVFDLSYFIVSILYLKYEPG--AVELSRRHPVASWLCAMLHCFGSYILADLLLGEPLIDYFSSSI 87 mouse TRIC-A: M------DLMSALSLGELALSFSRVPLFPVFDLSYFIVSIIYLKYEPG--AVELSRRHPVASWLCAMLHCFGSYILADLLLGEPIIDYFSSSSI

More information

Interpreting Data. Using Our Knowledge. Box-and-Whisker Plots. A 5-point summary is used to plot a "Box-and-Whisker" plot for a set of Data.

Interpreting Data. Using Our Knowledge. Box-and-Whisker Plots. A 5-point summary is used to plot a Box-and-Whisker plot for a set of Data. Box--Wisker Plots A 5-poit summry is use to plot "Box--Wisker" plot for set of Dt. Tese re use to ompre ifferet t sets. Tey re rw like tis: Lowest vlue Q1 Mei Q3 Higest vlue Wisker Box Wisker Tey re lwys

More information