Supplementary Materials. Figure S1 Chemical structures of cisplatin and carboplatin.

Size: px
Start display at page:

Download "Supplementary Materials. Figure S1 Chemical structures of cisplatin and carboplatin."

Transcription

1 Supplementary Materials Figure S1 Chemical structures of cisplatin and carboplatin. Figure S2 (a) RMS difference plot between the RT and 100K structures for the carboplatin_dmso case after 13 months of prolonged chemical storage. Asn-46, Try-47, Asp-48, Pro-70 and Gly-71 show the biggest RMS differences (but see Table S2 for the significant statistical evaluations) and these residues all lie in loop regions of the protein and are, to our knowledge, not chemically

2 significant. However, the shift between Pro-70 is not significant to a 3σlevel. (b) Average B factors for the 100K crystal structure of carboplatin_dmso case after 13months of prolonged chemical storage and (c) the average B factors for the RT crystal structure of carboplatin_dmso after 13 months prolonged chemical storage. The trend in the B factors for both structures is the same, with the RT crystal structure having overall higher B factors as expected. Figure S3 (a) RMS difference plot between the RT carboplatin_dmso case after 13 months of prolonged chemical storage and the 100K Carboplatin_DMSO_Glycerol case after 8 days of crystallisation. Gly 71 again shows the biggest RMS differences between the structures (labelled). (b) Average B factors for the RT crystal structure of carboplatin_dmso case after 13months of prolonged chemical storage and (c) the average B factors for the 100K crystal structure of carboplatin_dmso_glycerol after 8 days of co-crystallisation. The trend in the B factors for both structures is the same, with the RT crystal structure having overall higher B factors as expected.

3 Figure S4 (a) RMS difference plot between the RT cisplatin_dmso case after 13 months of prolonged chemical storage and the 100K cisplatin_dmso_glycerol case after 8 days of crystallisation. Gly 71 again shows the biggest RMS differences between the structures (labelled), but this shift is not significant at the 3σlevel. (b) Average B factors for the RT crystal structure of cisplatin_dmso case after 13months of prolonged chemical storage and (c) the average B factors for the 100K crystal structure of cisplatin_dmso_glycerol after 8 days of co-crystallisation. The trend in the B factors for both structures is the same, with the RT crystal structure having overall higher B factors as expected.

4 Figure S5 (a) RMS difference plot between the RT cisplatin_aqueous case after 13 months of prolonged chemical storage and the 100K cisplatin_aqueous_glycerol case after 8 days of crystallisation. Gly 71, Asn 103, Val 109 and Ala 110 shows the biggest RMS differences between the structures (labelled) and these residues lie in loop regions of the protein and to our knowledge, are not chemically significant. However, these changes are not significant at a 3σlevel. (b) Average B factors for the RT crystal structure of cisplatin_aqueous case after 13months of prolonged chemical storage and (c) the average B factors for the 100K crystal structure of cisplatin_aqueous_glycerol after 4 days of co-crystallisation. The trend in the B factors for both structures is the same, with the RT crystal structure having overall higher B factors as expected.

5 Figure S6 (a) RMS difference plot between the RT cisplatin_nag_dmso case after 13 months of prolonged chemical storage and the 100K ciaplatin_nag_dmso_glycerol case after 8 days of crystallisation. Gly 71 and Ser-72 show the biggest RMS differences between the structures (labelled) and these residues lie in loop regions of the protein and to our knowledge, are not chemically significant. (b) Average B factors for the RT crystal structure of cisplatin_nag_dmso case after 13months of prolonged chemical storage and (c) the average B factors for the 100K crystal structure of cisplatin_nag_dmso_glycerol after 8 days of co-crystallisation. The trend in the B factors for both structures is the same, with the RT crystal structure having overall higher B factors as expected.

6 Table S1 Data-collection strategy for each crystal. Swing around Phi (degrees) Cisplatin_aq Cisplatin_DMSO Cisplatin_DMSO_NAG Carboplatin_DMSO_RT Sweep (degrees) 189.0ω 101.0Φ 101.0Φ 156.5ω 174.0Φ 173.5ω 100.0ω 117.5Φ 152.0Φ 157.0Φ 174.5Φ 189.0ω 292.0Φ 329.0Φ 360.0Φ 188.5ω 188.5ω 103.5ω 73.0Φ 90.0Φ 27.5Φ 176.0ω 89.5Φ 11ω 138.0ω 141.0ω 348.0Φ

7 Carboplatin_DMSO_100K Φ Φ Φ Φ 73.0 Φ Φ 27 Φ Φ Table S2 Significant RMS differences (at 3σ level) between RT and 100K structures for each pair wise comparison with a standard deviation value for each calculated using equations 1 and 2 Pair-wise Comparisons Significant changes to amino acids RMS difference (Å) between structures with standard deviations calculated from equations 1 and 2. RT prolonged chemical exposure carboplatin DMSO with 100K prolonged chemical exposure carboplatin DMSO RT prolonged chemical exposure carboplatin DMSO with 100K 8 day crystallisation carboplatin DMSO Glycerol RT prolonged chemical exposure cisplatin NAG DMSO with 100K 8 day crystallisation cisplatin NAG DMSO Glycerol Asn /- 0.3 Thr /- 0.3 Asp /- 0.3 Gly /- 0.3 Gly /- 0.2 Gly /- 0.3 Ser /- 0.3

X-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction

X-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction X-ray structures of fructosyl peptide oxidases revealing residues responsible for gating oxygen access in the oxidative half reaction Tomohisa Shimasaki 1, Hiromi Yoshida 2, Shigehiro Kamitori 2 & Koji

More information

466 Asn (N) to Ala (A) Generate beta dimer Interface

466 Asn (N) to Ala (A) Generate beta dimer Interface Table S1: Amino acid changes to the HexA α-subunit to convert the dimer interface from α to β and to introduce the putative GM2A binding surface from β- onto the α- subunit Residue position (α-numbering)

More information

11 questions for a total of 120 points

11 questions for a total of 120 points Your Name: BYS 201, Final Exam, May 3, 2010 11 questions for a total of 120 points 1. 25 points Take a close look at these tables of amino acids. Some of them are hydrophilic, some hydrophobic, some positive

More information

Structure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München

Structure formation and association of biomolecules. Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Structure formation and association of biomolecules Prof. Dr. Martin Zacharias Lehrstuhl für Molekulardynamik (T38) Technische Universität München Motivation Many biomolecules are chemically synthesized

More information

Protein NMR II. Lecture 5

Protein NMR II. Lecture 5 Protein NMR II Lecture 5 Standard and NMR chemical shifts in proteins Residue N A A B O Ala 123.8 4.35 52.5 19.0 177.1 ys 118.8 4.65 58.8 28.6 174.8 Asp 120.4 4.76 54.1 40.8 177.2 Glu 120.2 4.29 56.7 29.7

More information

Problem Set Unit The base ratios in the DNA and RNA for an onion (Allium cepa) are given below.

Problem Set Unit The base ratios in the DNA and RNA for an onion (Allium cepa) are given below. Problem Set Unit 3 Name 1. Which molecule is found in both DNA and RNA? A. Ribose B. Uracil C. Phosphate D. Amino acid 2. Which molecules form the nucleotide marked in the diagram? A. phosphate, deoxyribose

More information

Evolution 1: Evidence of Evolution LabCh. 16

Evolution 1: Evidence of Evolution LabCh. 16 Evidence of Evolution- Pre-AP Name: Per: COOK Background: Much evidence has been found to indicate that living things have evolved or changed gradually during their natural history. The study of fossils

More information

Name: TOC#. Data and Observations: Figure 1: Amino Acid Positions in the Hemoglobin of Some Vertebrates

Name: TOC#. Data and Observations: Figure 1: Amino Acid Positions in the Hemoglobin of Some Vertebrates Name: TOC#. Comparing Primates Background: In The Descent of Man, the English naturalist Charles Darwin formulated the hypothesis that human beings and other primates have a common ancestor. A hypothesis

More information

DNA.notebook March 08, DNA Overview

DNA.notebook March 08, DNA Overview DNA Overview Deoxyribonucleic Acid, or DNA, must be able to do 2 things: 1) give instructions for building and maintaining cells. 2) be copied each time a cell divides. DNA is made of subunits called nucleotides

More information

Daily Agenda. Warm Up: Review. Translation Notes Protein Synthesis Practice. Redos

Daily Agenda. Warm Up: Review. Translation Notes Protein Synthesis Practice. Redos Daily Agenda Warm Up: Review Translation Notes Protein Synthesis Practice Redos 1. What is DNA Replication? 2. Where does DNA Replication take place? 3. Replicate this strand of DNA into complimentary

More information

DATA. mrna CODON CHART

DATA. mrna CODON CHART Alien Encounters! Background: In the year 2050, an incredible archeological discovery was made in the middle of a remote area of South America. It was an area where a large meteor had struck Earth. A pile

More information

www.lessonplansinc.com Topic: Gene Mutations WS Summary: Students will learn about frame shift mutations and base substitution mutations. Goals & Objectives: Students will be able to demonstrate how mutations

More information

DNA stands for deoxyribose nucleic acid

DNA stands for deoxyribose nucleic acid 1 DNA 2 DNA stands for deoxyribose nucleic acid This chemical substance is present in the nucleus of all cells in all living organisms DNA controls all the chemical changes which take place in cells The

More information

Alpha-helices, beta-sheets and U-turns within a protein are stabilized by (hint: two words).

Alpha-helices, beta-sheets and U-turns within a protein are stabilized by (hint: two words). 1 Quiz1 Q1 2011 Alpha-helices, beta-sheets and U-turns within a protein are stabilized by (hint: two words) Value Correct Answer 1 noncovalent interactions 100% Equals hydrogen bonds (100%) Equals H-bonds

More information

Virtual bond representation

Virtual bond representation Today s subjects: Virtual bond representation Coordination number Contact maps Sidechain packing: is it an instrumental way of selecting and consolidating a fold? ASA of proteins Interatomic distances

More information

Problem: The GC base pairs are more stable than AT base pairs. Why? 5. Triple-stranded DNA was first observed in 1957. Scientists later discovered that the formation of triplestranded DNA involves a type

More information

Structural bioinformatics

Structural bioinformatics Structural bioinformatics Why structures? The representation of the molecules in 3D is more informative New properties of the molecules are revealed, which can not be detected by sequences Eran Eyal Plant

More information

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,

More information

Dynamic Programming Algorithms

Dynamic Programming Algorithms Dynamic Programming Algorithms Sequence alignments, scores, and significance Lucy Skrabanek ICB, WMC February 7, 212 Sequence alignment Compare two (or more) sequences to: Find regions of conservation

More information

Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005

Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005 Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 9 September 005 Focus concept Purification of a novel seed storage protein allows sequence analysis and

More information

Fundamentals of Protein Structure

Fundamentals of Protein Structure Outline Fundamentals of Protein Structure Yu (Julie) Chen and Thomas Funkhouser Princeton University CS597A, Fall 2005 Protein structure Primary Secondary Tertiary Quaternary Forces and factors Levels

More information

Disease and selection in the human genome 3

Disease and selection in the human genome 3 Disease and selection in the human genome 3 Ka/Ks revisited Please sit in row K or forward RBFD: human populations, adaptation and immunity Neandertal Museum, Mettman Germany Sequence genome Measure expression

More information

Supplementary Table 1: List of CH3 domain interface residues in the first chain (A) and

Supplementary Table 1: List of CH3 domain interface residues in the first chain (A) and Supplementary Tables Supplementary Table 1: List of CH3 domain interface residues in the first chain (A) and their side chain contacting residues in the second chain (B) a Interface Res. in Contacting

More information

Cristian Micheletti SISSA (Trieste)

Cristian Micheletti SISSA (Trieste) Cristian Micheletti SISSA (Trieste) michelet@sissa.it Mar 2009 5pal - parvalbumin Calcium-binding protein HEADER CALCIUM-BINDING PROTEIN 25-SEP-91 5PAL 5PAL 2 COMPND PARVALBUMIN (ALPHA LINEAGE) 5PAL 3

More information

Using DNA sequence, distinguish species in the same genus from one another.

Using DNA sequence, distinguish species in the same genus from one another. Species Identification: Penguins 7. It s Not All Black and White! Name: Objective Using DNA sequence, distinguish species in the same genus from one another. Background In this activity, we will observe

More information

Packing of Secondary Structures

Packing of Secondary Structures 7.88 Lecture Notes - 5 7.24/7.88J/5.48J The Protein Folding and Human Disease Packing of Secondary Structures Packing of Helices against sheets Packing of sheets against sheets Parallel Orthogonal Table:

More information

6-Foot Mini Toober Activity

6-Foot Mini Toober Activity Big Idea The interaction between the substrate and enzyme is highly specific. Even a slight change in shape of either the substrate or the enzyme may alter the efficient and selective ability of the enzyme

More information

Folding simulation: self-organization of 4-helix bundle protein. yellow = helical turns

Folding simulation: self-organization of 4-helix bundle protein. yellow = helical turns Folding simulation: self-organization of 4-helix bundle protein yellow = helical turns Protein structure Protein: heteropolymer chain made of amino acid residues R + H 3 N - C - COO - H φ ψ Chain of amino

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION A human XRCC4-XLF complex bridges DNA ends. Sara N. Andres 1, Alexandra Vergnes 2, Dejan Ristic 3, Claire Wyman 3, Mauro Modesti 2,4, and Murray Junop 2,4 1 Department of Biochemistry

More information

Station 1: Fossil Records

Station 1: Fossil Records Station 1: Fossil Records 1. First, write the scientific definition of the following key terms in your NB, under the heading Fossil Records, write definitions in your own words but be sure not to leave

More information

Thr Gly Tyr. Gly Lys Asn

Thr Gly Tyr. Gly Lys Asn Your unique body characteristics (traits), such as hair color or blood type, are determined by the proteins your body produces. Proteins are the building blocks of life - in fact, about 45% of the human

More information

36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L-

36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L- 36. The double bonds in naturally-occuring fatty acids are usually isomers. A. cis B. trans C. both cis and trans D. D- E. L- 37. The essential fatty acids are A. palmitic acid B. linoleic acid C. linolenic

More information

C. Tight Turns. = -30, φ 3. = 0, and type II approximately = 120, φ 3. = -60, ψ 2. = -90, ψ 3. = +90, ψ 3

C. Tight Turns. = -30, φ 3. = 0, and type II approximately = 120, φ 3. = -60, ψ 2. = -90, ψ 3. = +90, ψ 3 Tight turns (also known as reverse turns, β turns, β bends, hairpin bends, 310 bends, kinks, widgets, etc.) are the first and most prevalent type of nonrepetitive structure that has been recognized. While

More information

Supporting Online Material. Av1 and Av2 were isolated and purified under anaerobic conditions according to

Supporting Online Material. Av1 and Av2 were isolated and purified under anaerobic conditions according to Supporting Online Material Materials and Methods Av1 and Av2 were isolated and purified under anaerobic conditions according to published protocols (S1). Crystals of nf-, pcp- and adp-av2:av1 complexes

More information

Biomolecules: lecture 6

Biomolecules: lecture 6 Biomolecules: lecture 6 - to learn the basics on how DNA serves to make RNA = transcription - to learn how the genetic code instructs protein synthesis - to learn the basics on how proteins are synthesized

More information

Mutation Rates and Sequence Changes

Mutation Rates and Sequence Changes s and Sequence Changes part of Fortgeschrittene Methoden in der Bioinformatik Computational EvoDevo University Leipzig Leipzig, WS 2011/12 From Molecular to Population Genetics molecular level substitution

More information

This is the knowledge that you should understand upon completing this section:

This is the knowledge that you should understand upon completing this section: DN 11 Syllabus hecklist This is the knowledge that you should understand upon completing this section: 11.1 DN DN occurs bound to proteins in chromosomes in the nucs and as unbound DN in the mitochondria.

More information

Residue Contact Prediction for Protein Structure using 2-Norm Distances

Residue Contact Prediction for Protein Structure using 2-Norm Distances Residue Contact Prediction for Protein Structure using 2-Norm Distances Nikita V Mahajan Department of Computer Science &Engg GH Raisoni College of Engineering, Nagpur LGMalik Department of Computer Science

More information

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen

Homology Modelling. Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Homology Modelling Thomas Holberg Blicher NNF Center for Protein Research University of Copenhagen Why are Protein Structures so Interesting? They provide a detailed picture of interesting biological features,

More information

CFSSP: Chou and Fasman Secondary Structure Prediction server

CFSSP: Chou and Fasman Secondary Structure Prediction server Wide Spectrum, Vol. 1, No. 9, (2013) pp 15-19 CFSSP: Chou and Fasman Secondary Structure Prediction server T. Ashok Kumar Department of Bioinformatics, Noorul Islam College of Arts and Science, Kumaracoil

More information

7.013 Problem Set 3 FRIDAY October 8th, 2004

7.013 Problem Set 3 FRIDAY October 8th, 2004 MIT Biology Department 7.012: Introductory Biology - Fall 2004 Instructors: Professor Eric Lander, Professor Robert. Weinberg, Dr. laudette ardel Name: T: 7.013 Problem Set 3 FRIDY October 8th, 2004 Problem

More information

AOCS/SQT Amino Acid Round Robin Study

AOCS/SQT Amino Acid Round Robin Study AOCS/SQT Amino Acid Round Robin Study J. V. Simpson and Y. Zhang National Corn-to-Ethanol Research Center Edwardsville, IL Richard Cantrill Technical Director AOCS, Urbana, IL Amy Johnson Soybean Quality

More information

Lecture 11: Gene Prediction

Lecture 11: Gene Prediction Lecture 11: Gene Prediction Study Chapter 6.11-6.14 1 Gene: A sequence of nucleotides coding for protein Gene Prediction Problem: Determine the beginning and end positions of genes in a genome Where are

More information

Worksheet: Mutations Practice

Worksheet: Mutations Practice Worksheet: Mutations Practice There are three ways that DNA can be altered when a mutation (change in DNA sequence) occurs. 1. Substitution one base-pairs is replaced by another: Example: G to C or A to

More information

The Genetic Code Metabolism Clay. A complete theory for the Origin of Life

The Genetic Code Metabolism Clay. A complete theory for the Origin of Life The Genetic Code Metabolism Clay A complete theory for the Origin of Life 1971-2016 Genetic Code G C A U C G A U G A C U G A C U G A C U G A C U Gly Ala Pro Arg Thr Ser Val ILeu Leu Glu Asp Gln Hist

More information

Degenerate Code. Translation. trna. The Code is Degenerate trna / Proofreading Ribosomes Translation Mechanism

Degenerate Code. Translation. trna. The Code is Degenerate trna / Proofreading Ribosomes Translation Mechanism Translation The Code is Degenerate trna / Proofreading Ribosomes Translation Mechanism Degenerate Code There are 64 possible codon triplets There are 20 naturally-encoding amino acids Several codons specify

More information

Name Date of Data Collection. Class Period Lab Days/Period Teacher

Name Date of Data Collection. Class Period Lab Days/Period Teacher Comparing Primates (adapted from Comparing Primates Lab, page 431-438, Biology Lab Manual, by Miller and Levine, Prentice Hall Publishers, copyright 2000, ISBN 0-13-436796-0) Background: One of the most

More information

G+C content. 1 Introduction. 2 Chromosomes Topology & Counts. 3 Genome size. 4 Replichores and gene orientation. 5 Chirochores.

G+C content. 1 Introduction. 2 Chromosomes Topology & Counts. 3 Genome size. 4 Replichores and gene orientation. 5 Chirochores. 1 Introduction 2 Chromosomes Topology & Counts 3 Genome size 4 Replichores and gene orientation 5 Chirochores 6 7 Codon usage 121 marc.bailly-bechet@univ-lyon1.fr Bacterial genome structures Introduction

More information

Protein Structure Prediction by Constraint Logic Programming

Protein Structure Prediction by Constraint Logic Programming MPRI C2-19 Protein Structure Prediction by Constraint Logic Programming François Fages, Constraint Programming Group, INRIA Rocquencourt mailto:francois.fages@inria.fr http://contraintes.inria.fr/ Molecules

More information

Phosphoserine-rich Protein from Phragmatopoma californica. Leila Jirari Mentor: Chengjun Sun Herbert Waite NIH, NSF, NASA

Phosphoserine-rich Protein from Phragmatopoma californica. Leila Jirari Mentor: Chengjun Sun Herbert Waite NIH, NSF, NASA Phosphoserine-rich Protein from Phragmatopoma californica Leila Jirari Mentor: Chengjun Sun Herbert Waite NIH, NSF, NASA Why Study This Worm? Underwater adhesive Glue adheres to eggs shells, glass, teeth

More information

Protein 3D Structure Prediction

Protein 3D Structure Prediction Protein 3D Structure Prediction Michael Tress CNIO ?? MREYKLVVLGSGGVGKSALTVQFVQGIFVDE YDPTIEDSYRKQVEVDCQQCMLEILDTAGTE QFTAMRDLYMKNGQGFALVYSITAQSTFNDL QDLREQILRVKDTEDVPMILVGNKCDLEDER VVGKEQGQNLARQWCNCAFLESSAKSKINVN

More information

Rajan Sankaranarayanan

Rajan Sankaranarayanan Proofreading during translation of the genetic code Rajan Sankaranarayanan Centre for Cellular and Molecular Biology (CCMB) Council for Scientific and Industrial Research (CSIR) Hyderabad, INDIA Accuracy

More information

Level 2 Biology, 2017

Level 2 Biology, 2017 91159 911590 2SUPERVISOR S Level 2 Biology, 2017 91159 Demonstrate understanding of gene expression 2.00 p.m. Wednesday 22 November 2017 Credits: Four Achievement Achievement with Merit Achievement with

More information

Integrated reactor feeding system amino acid feedback control via online HPLC for productivity gains

Integrated reactor feeding system amino acid feedback control via online HPLC for productivity gains Integrated reactor feeding system amino acid feedback control via online HPLC for productivity gains Application Note Biopharmaceuticals Author George Barringer, PhD David Lau, PhD Groton Biosystems Boxborough,

More information

The study of protein secondary structure and stability at equilibrium ABSTRACT

The study of protein secondary structure and stability at equilibrium ABSTRACT The study of protein secondary structure and stability at equilibrium Michelle Planicka Dept. of Physics, North Georgia College and State University, Dahlonega, GA REU, Dept. of Physics, University of

More information

The Thermofluor Method. Joanne Nettleship Oxford Protein Production Facility PEPC5 4th September 2006

The Thermofluor Method. Joanne Nettleship Oxford Protein Production Facility PEPC5 4th September 2006 The Thermofluor Method Joanne Nettleship Oxford Protein Production Facility PEPC5 4th September 2006 Background and Methodology Design and use of a general screen Focussed ligand-binding assays Limitations

More information

Protein Synthesis. Application Based Questions

Protein Synthesis. Application Based Questions Protein Synthesis Application Based Questions MRNA Triplet Codons Note: Logic behind the single letter abbreviations can be found at: http://www.biology.arizona.edu/biochemistry/problem_sets/aa/dayhoff.html

More information

DNA and the Double Helix in the Fifties: Papers Published in Nature which mention DNA and the Double Helix

DNA and the Double Helix in the Fifties: Papers Published in Nature which mention DNA and the Double Helix DNA and the Double Helix in the Fifties: Papers Published in Nature 1950-1960 which mention DNA and the Double Helix DNA paper Mention double helix 50 40 30 20 10 1950 1951 1952 1953 1954 1955 1956 1957

More information

1. DNA, RNA structure. 2. DNA replication. 3. Transcription, translation

1. DNA, RNA structure. 2. DNA replication. 3. Transcription, translation 1. DNA, RNA structure 2. DNA replication 3. Transcription, translation DNA and RNA are polymers of nucleotides DNA is a nucleic acid, made of long chains of nucleotides Nucleotide Phosphate group Nitrogenous

More information

CHAPTER 1. DNA: The Hereditary Molecule SECTION D. What Does DNA Do? Chapter 1 Modern Genetics for All Students S 33

CHAPTER 1. DNA: The Hereditary Molecule SECTION D. What Does DNA Do? Chapter 1 Modern Genetics for All Students S 33 HPER 1 DN: he Hereditary Molecule SEION D What Does DN Do? hapter 1 Modern enetics for ll Students S 33 D.1 DN odes For Proteins PROEINS DO HE nitty-gritty jobs of every living cell. Proteins are the molecules

More information

Examining the components of your peptide sample with AccuPep QC. Lauren Lu, Ph.D. October 29, 2015, 9:00-10:00 AM EST

Examining the components of your peptide sample with AccuPep QC. Lauren Lu, Ph.D. October 29, 2015, 9:00-10:00 AM EST Examining the components of your peptide sample with AccuPep QC Lauren Lu, Ph.D. October 29, 2015, 9:00-10:00 AM EST When do I need custom peptides? Custom peptides play an important role in many research

More information

(a) Which enzyme(s) make 5' - 3' phosphodiester bonds? (c) Which enzyme(s) make single-strand breaks in DNA backbones?

(a) Which enzyme(s) make 5' - 3' phosphodiester bonds? (c) Which enzyme(s) make single-strand breaks in DNA backbones? EXAMPLE QUESTIONS AND ANSWERS 1. Topoisomerase does which one of the following? (a) Makes new DNA strands. (b) Unties knots in DNA molecules. (c) Joins the ends of double-stranded DNA molecules. (d) Is

More information

Zool 3200: Cell Biology Exam 3 3/6/15

Zool 3200: Cell Biology Exam 3 3/6/15 Name: Trask Zool 3200: Cell Biology Exam 3 3/6/15 Answer each of the following questions in the space provided; circle the correct answer or answers for each multiple choice question and circle either

More information

BIL 256 Cell and Molecular Biology Lab Spring, 2007 BACKGROUND INFORMATION I. PROTEIN COMPOSITION AND STRUCTURE: A REVIEW OF THE BASICS

BIL 256 Cell and Molecular Biology Lab Spring, 2007 BACKGROUND INFORMATION I. PROTEIN COMPOSITION AND STRUCTURE: A REVIEW OF THE BASICS BIL 256 Cell and Molecular Biology Lab Spring, 2007 BACKGROUND INFORMATION I. PROTEIN COMPOSITION AND STRUCTURE: A REVIEW OF THE BASICS Proteins occupy a central position in the structure and function

More information

High-resolution structure of a papaya plant-defence barwin-like protein solved by in-house sulphur-sad phasing

High-resolution structure of a papaya plant-defence barwin-like protein solved by in-house sulphur-sad phasing High-resolution structure of a papaya plant-defence barwin-like protein solved by in-house sulphur-sad phasing Joëlle Huet, Emmanuel Jean Teinkela Mbosso, Sameh Soror, Franck Meyer, Yvan Looze, René Wintjens,

More information

Introduction to Proteins

Introduction to Proteins Introduction to Proteins Lecture 4 Module I: Molecular Structure & Metabolism Molecular Cell Biology Core Course (GSND5200) Matthew Neiditch - Room E450U ICPH matthew.neiditch@umdnj.edu What is a protein?

More information

Bioinformatics. ONE Introduction to Biology. Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012

Bioinformatics. ONE Introduction to Biology. Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012 Bioinformatics ONE Introduction to Biology Sami Khuri Department of Computer Science San José State University Biology/CS 123A Fall 2012 Biology Review DNA RNA Proteins Central Dogma Transcription Translation

More information

PROTEIN SYNTHESIS Study Guide

PROTEIN SYNTHESIS Study Guide PART A. Read the following: PROTEIN SYNTHESIS Study Guide Protein synthesis is the process used by the body to make proteins. The first step of protein synthesis is called Transcription. It occurs in the

More information

ENZYMES AND METABOLIC PATHWAYS

ENZYMES AND METABOLIC PATHWAYS ENZYMES AND METABOLIC PATHWAYS This document is licensed under the Attribution-NonCommercial-ShareAlike 2.5 Italy license, available at http://creativecommons.org/licenses/by-nc-sa/2.5/it/ 1. Enzymes build

More information

Welcome to Genome 371!

Welcome to Genome 371! Genome 371, 4 Jan 2010, Lecture 1 Welcome to Genome 371! If you are not registered - please don t take a seat! (class is full) - see Anne Paul (outside) to get on the wait list If you are registered and

More information

NOTES Gene Expression ACP Biology, NNHS

NOTES Gene Expression ACP Biology, NNHS Name Date Block NOTES Gene Expression ACP Biology, NNHS Model 1: Transcription the process of genes in DNA being copied into a messenger RNA 1. Where in the cell is DNA found? 2. Where in the cell does

More information

7.014 Quiz II 3/18/05. Write your name on this page and your initials on all the other pages in the space provided.

7.014 Quiz II 3/18/05. Write your name on this page and your initials on all the other pages in the space provided. 7.014 Quiz II 3/18/05 Your Name: TA's Name: Write your name on this page and your initials on all the other pages in the space provided. This exam has 10 pages including this coversheet. heck that you

More information

Codon Bias with PRISM. 2IM24/25, Fall 2007

Codon Bias with PRISM. 2IM24/25, Fall 2007 Codon Bias with PRISM 2IM24/25, Fall 2007 from RNA to protein mrna vs. trna aminoacid trna anticodon mrna codon codon-anticodon matching Watson-Crick base pairing A U and C G binding first two nucleotide

More information

NOTES Nucleotide Sequences of the Genes for Two Distinct Cephalosporin Acylases from a Pseudomonas Strain

NOTES Nucleotide Sequences of the Genes for Two Distinct Cephalosporin Acylases from a Pseudomonas Strain JOURNAL OF BACTERIOLOGY, Dec. 1987, p. 5821-5826 0021-9193/87/125821-06$02.00/0 Copyright 1987, American Society for Microbiology Vol. 169, No. 12 NOTES Nucleotide Sequences of the Genes for Two Distinct

More information

Cambridge International Examinations Cambridge International Advanced Subsidiary and Advanced Level

Cambridge International Examinations Cambridge International Advanced Subsidiary and Advanced Level ambridge International Examinations ambridge International Advanced Subsidiary and Advanced Level *8744875516* BIOLOGY 9700/22 Paper 2 AS Level Structured Questions October/November 2016 1 hour 15 minutes

More information

Chapter 8. One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model. Sebastian Kmiecik and Andrzej Kolinski.

Chapter 8. One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model. Sebastian Kmiecik and Andrzej Kolinski. Chapter 8 One-Dimensional Structural Properties of Proteins in the Coarse-Grained CABS Model Abstract Despite the significant increase in computational power, molecular modeling of protein structure using

More information

Ligand immobilization using thiol-disulphide exchange

Ligand immobilization using thiol-disulphide exchange A P P L I C A T I T E 9 Ligand immobilization using thiol-disulphide exchange Abstract This Application ote describes an immobilization procedure based on thioldisulphide exchange, providing a valuable

More information

RNA: Transcription and Triplet Code

RNA: Transcription and Triplet Code RNA: Transcription and Triplet Code There are Five Kinds of RNA, All of Which are Templated from DNA. The first type of RNA is trna. The "t" stands for "transfer". This RNA is the RNA that transfers amino

More information

MOLEBIO LAB #3: Electrophoretic Separation of Proteins

MOLEBIO LAB #3: Electrophoretic Separation of Proteins MOLEBIO LAB #3: Electrophoretic Separation of Proteins Introduction: Proteins occupy a central position in the structure and function of all living organisms. Some proteins serve as structural components

More information

BIOLOGY/HUMAN BIOLOGY BY1

BIOLOGY/HUMAN BIOLOGY BY1 andidate Name entre Number andidate Number 2 GE AS/A level 1071/01 BILGY/UMAN BILGY BY1 A.M. TUESDAY, 12 January 2010 1 1 2 hours For s use Question Maximum Mark 1 6 2 6 3 11 4 11 5 12 6 14 7 10 Total

More information

Mutagenesis. Classification of mutation. Spontaneous Base Substitution. Molecular Mutagenesis. Limits to DNA Pol Fidelity.

Mutagenesis. Classification of mutation. Spontaneous Base Substitution. Molecular Mutagenesis. Limits to DNA Pol Fidelity. Mutagenesis 1. Classification of mutation 2. Base Substitution 3. Insertion Deletion 4. s 5. Chromosomal Aberration 6. Repair Mechanisms Classification of mutation 1. Definition heritable change in DNA

More information

Bioinformation by Biomedical Informatics Publishing Group

Bioinformation by Biomedical Informatics Publishing Group Study of codon bias perspective of fungal xylanase gene by multivariate analysis Smriti Shrivastava, Raju Poddar, Pratyoosh Shukla*, Kunal Mukhopadhyay Department of Biotechnology, Birla Institute of Technology

More information

Diversity in DNA recognition by p53 revealed by crystal structures with Hoogsteen base pairs

Diversity in DNA recognition by p53 revealed by crystal structures with Hoogsteen base pairs SUPPLEMENTARY INFORMATION Diversity in DNA recognition by p53 revealed by crystal structures with Hoogsteen base pairs Malka Kitayner 1, 3, Haim Rozenberg 1, 3, Remo Rohs 2, 3, Oded Suad 1, Dov Rabinovich

More information

APPENDIX. Appendix. Table of Contents. Ethics Background. Creating Discussion Ground Rules. Amino Acid Abbreviations and Chemistry Resources

APPENDIX. Appendix. Table of Contents. Ethics Background. Creating Discussion Ground Rules. Amino Acid Abbreviations and Chemistry Resources Appendix Table of Contents A2 A3 A4 A5 A6 A7 A9 Ethics Background Creating Discussion Ground Rules Amino Acid Abbreviations and Chemistry Resources Codons and Amino Acid Chemistry Behind the Scenes with

More information

1. Introduction. 2. Materials and Method

1. Introduction. 2. Materials and Method American Journal of Pharmacological Sciences, 2016, Vol. 4, No. 1, 1-6 Available online at http://pubs.sciepub.com/ajps/4/1/1 Science and Education Publishing DOI:10.12691/ajps-4-1-1 In-silico Designing

More information

INTRODUCTION TO THE MOLECULAR GENETICS OF THE COLOR MUTATIONS IN ROCK POCKET MICE

INTRODUCTION TO THE MOLECULAR GENETICS OF THE COLOR MUTATIONS IN ROCK POCKET MICE The Making of the The Fittest: Making of the Fittest Natural Selection Natural and Adaptation Selection and Adaptation Educator Materials TEACHER MATERIALS INTRODUCTION TO THE MOLECULAR GENETICS OF THE

More information

Zwitterion Chromatography ZIC

Zwitterion Chromatography ZIC Zwitterion Chromatography ZIC A novel technique, with unique selectivity, suitable for preparative scale separations? PhD Einar Pontén What is Zwitterion Chromatography? Our definition: Liquid chromatography

More information

Middle Amino Acid in Proteins: Comparison of Predicted and

Middle Amino Acid in Proteins: Comparison of Predicted and Proc. Nat. Acad. Sci. USA Vol. 70, No. 5, pp. 1473-1477, May 1973 The Influence of Nearest-Neighbor Amino Acids on the Conformation of the Middle Amino Acid in Proteins: Comparison of Predicted and Experimental

More information

DNA & Protein Synthesis #21

DNA & Protein Synthesis #21 Name: Period: Date: Living Environment Lab DNA & Protein Synthesis #21 Introduction Of all the molecules that is in the body, DNA is perhaps the most important. DNA or dioxiribosenucleic acid is important

More information

1. DNA replication. (a) Why is DNA replication an essential process?

1. DNA replication. (a) Why is DNA replication an essential process? ame Section 7.014 Problem Set 3 Please print out this problem set and record your answers on the printed copy. Answers to this problem set are to be turned in to the box outside 68120 by 5:00pm on Friday

More information

LE STRUTTURE β Antiparallel A residue in an antiparallel beta strand has values of -139 and +135 degrees for the backbone dihedral angles F and Y respectively. Antiparallel beta sheets are thought

More information

Ensemble refinement shows conformational flexibility in crystal structures of human complement factor D

Ensemble refinement shows conformational flexibility in crystal structures of human complement factor D Supplementary Information for Ensemble refinement shows conformational flexibility in crystal structures of human complement factor D Federico Forneris a,b, B. Tom Burnley a,b,c and Piet Gros a * a Crystal

More information

A Zero-Knowledge Based Introduction to Biology

A Zero-Knowledge Based Introduction to Biology A Zero-Knowledge Based Introduction to Biology Konstantinos (Gus) Katsiapis 25 Sep 2009 Thanks to Cory McLean and George Asimenos Cells: Building Blocks of Life cell, membrane, cytoplasm, nucleus, mitochondrion

More information

Chapter 11 Nucleic Acids and Protein Synthesis

Chapter 11 Nucleic Acids and Protein Synthesis Chapter 11 ucleic Acids and Protein Synthesis Molecular Biology Biomolecules are synthesized in the same order. replication general transfer: occurs normally in cells transcription translation special

More information

Speaker: Yu-Chen Ku Professor: Ching-Tsan Huang, Ph. D. Source: Biochemical Journal (2007) 402, Date: December 4th, 2007

Speaker: Yu-Chen Ku Professor: Ching-Tsan Huang, Ph. D. Source: Biochemical Journal (2007) 402, Date: December 4th, 2007 Directed evolution and structural analysis of N-carbamoyl-D-amino acid amidohydrolase provide insights into recombinant protein solubility in Escherichia coli Speaker: Yu-Chen Ku Professor: Ching-Tsan

More information

Protein Synthesis Fairy Tale

Protein Synthesis Fairy Tale Name: Protein Synthesis Fairy Tale Date: Period: Fairy Tale: "Once upon a time there were two fraternal twin brothers: Donald N. Armstrong and Ronald Armstrong. Donald was the smarter of the two, and he

More information

UNIT (12) MOLECULES OF LIFE: NUCLEIC ACIDS

UNIT (12) MOLECULES OF LIFE: NUCLEIC ACIDS UNIT (12) MOLECULES OF LIFE: NUCLEIC ACIDS Nucleic acids are extremely large molecules that were first isolated from the nuclei of cells. Two kinds of nucleic acids are found in cells: RNA (ribonucleic

More information

Lecture for Wednesday. Dr. Prince BIOL 1408

Lecture for Wednesday. Dr. Prince BIOL 1408 Lecture for Wednesday Dr. Prince BIOL 1408 THE FLOW OF GENETIC INFORMATION FROM DNA TO RNA TO PROTEIN Copyright 2009 Pearson Education, Inc. Genes are expressed as proteins A gene is a segment of DNA that

More information

The Cys 2. His 2. Research Article 451

The Cys 2. His 2. Research Article 451 Research Article 451 High-resolution structures of variant Zif268 DNA complexes: implications for understanding zinc finger DNA recognition Monicia Elrod-Erickson 1, Timothy E Benson 1 and Carl O Pabo

More information